Skip to content

Instantly share code, notes, and snippets.

@Seldaek
Created April 21, 2016 12:33
Show Gist options
  • Select an option

  • Save Seldaek/27a141c7e21f1a1e816461b97c199930 to your computer and use it in GitHub Desktop.

Select an option

Save Seldaek/27a141c7e21f1a1e816461b97c199930 to your computer and use it in GitHub Desktop.
PHP Ecosystem Scan
This file has been truncated, but you can view the full file.
<?php return array (
'file' =>
array (
'README' => 71549,
'.gitignore' => 56048,
'LICENSE' => 42975,
'.travis.yml' => 27817,
'phpunit.xml.dist' => 14730,
'phpunit.xml' => 12788,
'composer.lock' => 10886,
'.gitattributes' => 6851,
'CHANGELOG' => 6765,
'.scrutinizer.yml' => 5365,
'contributing' => 4027,
'.editorconfig' => 3550,
'module.php' => 2663,
'build.xml' => 1832,
'.coveralls.yml' => 1738,
'index.php' => 1706,
'.php_cs' => 1591,
'bootstrap.php' => 1152,
'makefile' => 1120,
'_config.php' => 1054,
'licence' => 1033,
'.htaccess' => 879,
'.styleci.yml' => 731,
'phpspec.yml' => 688,
'VERSION' => 685,
'autoload_classmap.php' => 645,
'autoload.php' => 641,
'example.php' => 628,
'phpcs.xml' => 619,
'composer.phar' => 616,
'.codeclimate.yml' => 577,
'.gitmodules' => 553,
'conduct' => 513,
'phpunit.php' => 467,
'COPYING' => 463,
'test.php' => 455,
'TODO' => 452,
'codeception.yml' => 425,
'CHANGES' => 393,
'vagrantfile' => 387,
'UPGRADE' => 381,
'config.php' => 362,
'start.php' => 340,
'package.xml' => 318,
'autoload_register.php' => 295,
'manifest.xml' => 291,
'phpmd.xml' => 290,
'autoload_function.php' => 289,
'phpdoc.dist.xml' => 277,
'install' => 254,
'box.json' => 246,
'.project' => 242,
'behat.yml' => 235,
'phpspec.yml.dist' => 231,
'circle.yml' => 228,
'logo.png' => 225,
'.ds_store' => 220,
'contributors' => 211,
'authors' => 202,
'autoloader.php' => 194,
'index.html' => 193,
'build.default.properties' => 192,
'init.php' => 190,
'notice' => 189,
'registration.php' => 188,
'server.php' => 187,
'.bowerrc' => 185,
'exception.php' => 181,
'yii.bat' => 180,
'.buildpath' => 170,
'requirements.php' => 170,
'CREDITS' => 167,
'apigen.neon' => 165,
'.env.example' => 163,
'modman' => 159,
'.semver' => 154,
'ext_emconf.php' => 151,
'.atoum.php' => 150,
'ruleset.xml' => 149,
'build.properties' => 147,
'artisan' => 141,
'mkdocs.yml' => 139,
'.check-author.yml' => 136,
'appveyor.yml' => 136,
'functions.php' => 133,
'phpdoc.xml' => 132,
'favicon.ico' => 131,
'ext_localconf.php' => 130,
'demo.php' => 128,
'change' => 123,
'config.xml' => 123,
'client.php' => 122,
'code-of-conduct' => 122,
'yii' => 122,
'MIT-LICENSE' => 120,
'helpers.php' => 116,
'dockerfile' => 113,
'widget.php' => 109,
'behat.yml.dist' => 109,
'ride.json' => 107,
'logo.gif' => 105,
'routes.php' => 102,
'screenshot.png' => 100,
'ext_tables.php' => 99,
'autoloadexample.php' => 97,
'robots' => 96,
'phpunit.travis.xml' => 95,
'icon.png' => 95,
'ext_icon.gif' => 94,
'manifest.php' => 93,
'doxyfile' => 92,
'autoload.php.dist' => 92,
'provides.json' => 91,
'build.php' => 91,
'extension.xml' => 91,
'module.json' => 90,
'.bootstrap.atoum.php' => 90,
'init_autoloader.php' => 89,
'docker-compose.yml' => 89,
'console' => 87,
'api.php' => 87,
'install.php' => 83,
'controller.php' => 83,
'readme.textile' => 83,
'build.sh' => 83,
'phpdox.xml' => 82,
'copyright' => 81,
'app.php' => 81,
'phpmd.xml.dist' => 81,
'robofile.php' => 80,
'gemfile' => 79,
'config.json' => 78,
'upgrade-2.2' => 78,
'include.php' => 76,
'activate.php' => 76,
'init' => 76,
'plugin.php' => 75,
'travis.phpunit.xml' => 74,
'copying.lesser' => 74,
'.sensiolabs.yml' => 72,
'init.bat' => 72,
'serviceprovider.php' => 71,
'upgrade-2.3' => 71,
'ext_tables.sql' => 69,
'cache.php' => 68,
'phpunit.xml.ci' => 67,
'code_of_conduct' => 67,
'router.php' => 67,
'upgrading' => 66,
'request.php' => 65,
'phpci.yml' => 65,
'application.php' => 64,
'test' => 63,
'phpunit.dist.xml' => 62,
'style.css' => 62,
'.formatter.yml' => 62,
'collection.php' => 62,
'response.php' => 62,
'guardfile' => 61,
'examples.php' => 61,
'config.rb' => 61,
'events.php' => 60,
'install.sh' => 60,
'rakefile' => 60,
'class.pth' => 58,
'phpdox.xml.dist' => 58,
'connection.php' => 58,
'cli-config.php' => 56,
'mailer.php' => 55,
'ezinfo.php' => 55,
'phpspec.yml.ci' => 55,
'.travis.env' => 54,
'.travis.key' => 54,
'composer.json~' => 53,
'manager.php' => 53,
'.travis.install' => 53,
'couscous.yml' => 53,
'sami.php' => 52,
'image.php' => 52,
'factory.php' => 52,
'DESCRIPTION' => 52,
'scrutinizer.yml' => 51,
'.travis.composer.config.json' => 51,
'.gush.yml' => 51,
'upgrade-2.4' => 51,
'readme.html' => 51,
'ext_conf_template' => 50,
'console.php' => 50,
'activerecord.php' => 49,
'test.sh' => 49,
'file.php' => 49,
'gemfile.lock' => 49,
'.hhconfig' => 49,
'.travis.php.ini' => 49,
'asset.php' => 48,
'parser.php' => 48,
'web.config' => 48,
'extension.php' => 47,
'sonar-project.properties' => 47,
'version.php' => 47,
'message.php' => 47,
'sample.php' => 46,
'.hgignore' => 46,
'.coke' => 45,
'.arcconfig' => 45,
'view.php' => 45,
'history' => 45,
'setup.php' => 44,
'procfile' => 44,
'manifest.json' => 44,
'.infra.json' => 44,
'deactivate.php' => 44,
'session.php' => 43,
'container.php' => 43,
'cli.php' => 43,
'changelog-1.0' => 43,
'campaignchain.yml' => 43,
'capfile' => 43,
'form.php' => 43,
'box.json.dist' => 42,
'puli.json' => 42,
'database.php' => 42,
'license-mit' => 42,
'package.php' => 42,
'peridot.php' => 42,
'elefant.json' => 41,
'loader.php' => 41,
'search.php' => 41,
'user.php' => 41,
'.state' => 41,
'language.xml' => 41,
'.dunitconfig' => 41,
'.rmt.yml' => 40,
'change.xml' => 40,
'admin.php' => 40,
'screenshot-1.png' => 40,
'travis.php.ini' => 40,
'base.php' => 39,
'event.php' => 39,
'ext_icon.png' => 39,
'phinx.yml' => 39,
'pallo.json' => 39,
'.env' => 39,
'phprelease.ini' => 38,
'screenshot.jpg' => 38,
'query.php' => 38,
'phpcs.xml.dist' => 37,
'curl.php' => 37,
'template_map.php' => 37,
'.gitreview' => 37,
'shippable.yml' => 37,
'runtests.sh' => 37,
'default-enable' => 37,
'coverage-checker.php' => 37,
'uninstall.php' => 37,
'.old-scrutinizer.yml' => 36,
'versioning' => 36,
'html.php' => 36,
'.travis.sh' => 36,
'gulpfile.js' => 36,
'package.ini' => 36,
'route.php' => 36,
'.jshintrc' => 36,
'phpunit.phar' => 36,
'_tests_bootstrap.php' => 36,
'phpunit' => 35,
'codeception.dist.yml' => 35,
'ini.php' => 34,
'plugin.xml' => 34,
'assets.php' => 34,
'release' => 34,
'documentation' => 34,
'cacert.pem' => 34,
'roadmap' => 34,
'.sami.php' => 34,
'descriptor.php' => 33,
'repository.php' => 33,
'options.php' => 33,
'main.php' => 33,
'.package.yml' => 32,
'config.yml' => 32,
'wp-cli.yml' => 32,
'generate-api.sh' => 32,
'.dockerignore' => 31,
'page.php' => 31,
'phpunit.xml.travis' => 31,
'icon.svg' => 31,
'command.php' => 31,
'activefield.php' => 31,
'header.php' => 31,
'news' => 31,
'tests.php' => 30,
'http.php' => 30,
'helper.php' => 30,
'unlicense' => 30,
'constants.php' => 29,
'model.php' => 29,
'validator.php' => 29,
'settings.php' => 29,
'run-tests.sh' => 29,
'cs.sh' => 29,
'build.properties.dev' => 29,
'core.php' => 29,
'db.php' => 29,
'packages.json' => 29,
'.php_cs.dist' => 29,
'auth.php' => 29,
'.atoum.bootstrap.php' => 28,
'license_afl' => 28,
'readme.mkd' => 28,
'footer.php' => 28,
'.tavis.yml' => 28,
'src.php' => 28,
'tests.xml' => 28,
'phpunit.sh' => 28,
'wercker.yml' => 28,
'build.properties.default' => 27,
'menu.php' => 27,
'.phpspec_cs' => 27,
'activeform.php' => 27,
'configuration.php' => 27,
'phpunit-bootstrap.php' => 27,
'installer.php' => 27,
'.travis.composer.php' => 27,
'button.php' => 27,
'logger.php' => 26,
'nav.php' => 26,
'dispatcher.php' => 26,
'generator.php' => 26,
'update.php' => 26,
'activequery.php' => 26,
'phpmd.sh' => 26,
'stub.php' => 25,
'translation.php' => 25,
'run_tests.sh' => 25,
'build.jenkins.xml' => 25,
'redirect.php' => 25,
'registry.php' => 25,
'assetbundle.php' => 25,
'benchmark.php' => 25,
'make-toc' => 25,
'upgrade-2.0' => 25,
'php.ini' => 25,
'component.php' => 25,
'makedoc.sh' => 25,
'init.sh' => 25,
'release-notes' => 25,
'.mailmap' => 25,
'icon.php' => 25,
'humans' => 25,
'error.php' => 25,
'url.php' => 25,
'template.php' => 25,
'json.php' => 25,
'migration.php' => 25,
'humbug.json.dist' => 24,
'callback.php' => 24,
'phing.xml' => 24,
'datepicker.php' => 24,
'phpunit.hhvm.xml' => 24,
'fontawesomeasset.php' => 24,
'ext_autoload.php' => 24,
'dropdown.php' => 24,
'service.php' => 24,
'pom.xml' => 24,
'boot.php' => 24,
'phpunit-ci.xml' => 23,
'docs' => 23,
'manifest.yml' => 23,
'ext.php' => 23,
'screenshot-2.png' => 23,
'readme_ru' => 23,
'config.ini' => 23,
'facadeprovider.php' => 23,
'environment.php' => 23,
'readme.ru' => 23,
'util.php' => 23,
'coverage.clover' => 22,
'koharness.php' => 22,
'filesystem.php' => 22,
'log.php' => 22,
'run.php' => 22,
'.config' => 22,
'setup' => 22,
'.gitlab-ci.yml' => 22,
'readme.md~' => 22,
'cron.php' => 22,
'querybuilder.php' => 22,
'worker.php' => 22,
'.phpdoc-md' => 22,
'.travis.install.sh' => 22,
'infra.php' => 22,
'login.php' => 21,
'debug.php' => 21,
'dependencies.ini' => 21,
'finder.php' => 21,
'codesniffer.ruleset.xml' => 21,
'.drone.yml' => 21,
'momentasset.php' => 21,
'api' => 21,
'sidebar.php' => 21,
'config.yml.dist' => 20,
'setup.sh' => 20,
'metadata.php' => 20,
'config.php.dist' => 20,
'load.php' => 20,
'rmt.json' => 20,
'classloader.php' => 20,
'wp-config.php' => 20,
'module-config.json' => 20,
'alert.php' => 20,
'markdown.php' => 20,
'build' => 20,
'rmt' => 20,
'filter.php' => 20,
'composer.yml' => 19,
'404.php' => 19,
'navbar.php' => 19,
'post-install' => 19,
'tcpdf.php' => 19,
'travis.yml' => 19,
'.composer-auth.json' => 19,
'releases.json' => 19,
'notes' => 19,
'single.php' => 19,
'license-2.0' => 19,
'backmatter' => 19,
'common.php' => 19,
'utils.php' => 19,
'.dreamfactory.php' => 19,
'mail.php' => 19,
'bundle.php' => 19,
'tinymce.php' => 19,
'coreasset.php' => 18,
'phpcs-ruleset.xml' => 18,
'upgrade-3.0' => 18,
'bob_config.php' => 18,
'.appveyor.yml' => 18,
'scripthandler.php' => 18,
'handler.php' => 18,
'builder.php' => 18,
'release_notes' => 18,
'dynamicreturntypemeta.json' => 18,
'license-agpl' => 18,
'archive.php' => 18,
'tinymceasset.php' => 18,
'phpunit_bootstrap.php' => 18,
'translator.php' => 18,
'license-commercial-websites' => 18,
'usage' => 18,
'jfusion.xml' => 18,
'graph.php' => 18,
'update' => 18,
'license-commercial-website' => 18,
'dev.phpunit.xml' => 18,
'license-commercial-saas' => 18,
'map.php' => 18,
'index-test.php' => 17,
'deps' => 17,
'contribute' => 17,
'changelog.yml' => 17,
'action.php' => 17,
'uploader.php' => 17,
'arr.php' => 17,
'readme_en' => 17,
'ext_typoscript_setup' => 17,
'build.local.xml' => 17,
'errorhandler.php' => 17,
'fig.yml' => 17,
'exampleconfig.yaml' => 17,
'autoload.json' => 17,
'docs.php' => 17,
'connect.php' => 17,
'clearsessions.php' => 17,
'bootstrap.hh' => 17,
'upgrade-1.1' => 17,
'config-sample.php' => 17,
'component.json' => 16,
'peridot.hh' => 16,
'openid.php' => 16,
'xvengine.json' => 16,
'sage.config' => 16,
'table.php' => 16,
'screenshot-3.png' => 16,
'views.php' => 16,
'select2asset.php' => 16,
'.travis.composer.json' => 16,
'clientinterface.php' => 16,
'gridview.php' => 16,
'.atoum.travis.php' => 16,
'changelog-1.1' => 16,
'tcpdf_parser.php' => 16,
'tasks' => 16,
'html.inc' => 16,
'change_log' => 16,
'review' => 15,
'panel.php' => 15,
'modal.php' => 15,
'breadcrumbs.php' => 15,
'cacheinterface.php' => 15,
'infra.js' => 15,
'nginx.conf' => 15,
'sms.php' => 15,
'ckeditor.php' => 15,
'bootstrap.php.dist' => 15,
'queue.php' => 15,
'testrunner.yml' => 15,
'readme.ja' => 15,
'starter.php' => 15,
'travis-php.ini' => 15,
'.php_cs.php' => 15,
'deploy.sh' => 15,
'copying lesser' => 15,
'.arclint' => 15,
'testing' => 15,
'.phpstorm.meta.php' => 15,
'xmlrpc.php' => 15,
'storage.php' => 15,
'migrations.yml' => 15,
'datetimepicker.php' => 15,
'config.example.php' => 15,
'.env.dist' => 15,
'faq' => 15,
'phpunit.bat' => 14,
'composer.php' => 14,
'psr2tabs.xml' => 14,
'inputwidget.php' => 14,
'examples' => 14,
'codesniffer' => 14,
'kernel.php' => 14,
'paginator.php' => 14,
'htaccess' => 14,
'xml.php' => 14,
'phpcompatinfo.json' => 14,
'bootstrap.sh' => 14,
'.travis.coverage.sh' => 14,
'pagination.php' => 14,
'humbug.json' => 14,
'example.html' => 14,
'.version' => 14,
'run-tests' => 14,
'readme-git' => 14,
'example.png' => 14,
'.cloak.toml' => 14,
'tag.php' => 14,
'.travis-phpunit.xml' => 14,
'feed.php' => 14,
'date.php' => 14,
'lab.config' => 14,
'.coveralls.toml' => 14,
'build-pre-commit.xml' => 14,
'config' => 14,
'node.php' => 14,
'grumphp.yml' => 14,
'license.mit' => 14,
'comments.php' => 14,
'buttongroup.php' => 14,
'select2.php' => 13,
'datetimepickerasset.php' => 13,
'readme-ru' => 13,
'serializer.php' => 13,
'schema.php' => 13,
'entity.php' => 13,
'mpdf.php' => 13,
'testcase.php' => 13,
'datepickerasset.php' => 13,
'blok.php' => 13,
'provision.sh' => 13,
'theme.php' => 13,
'item.php' => 13,
'taskfile' => 13,
'requirements' => 13,
'deploy.php' => 13,
'upload.php' => 13,
'codeclimate.sh' => 13,
'app.json' => 13,
'validation.php' => 13,
'.scrunitizer.yml' => 13,
'phar-stub.php' => 13,
'boxfile' => 13,
'progress.php' => 13,
'guide' => 13,
'result.php' => 13,
'author.php' => 13,
'.htaccess.sample' => 13,
'sphinxsearchbundle.php' => 13,
'prolog.php' => 13,
'oauth.php' => 13,
'recipe.php' => 13,
'default_option.php' => 12,
'readme.org' => 12,
'tcpdf_autoconfig.php' => 12,
'content.php' => 12,
'tcpdf_import.php' => 12,
'phpunit.xml-dist' => 12,
'import.php' => 12,
'phpunit-ci.xml.dist' => 12,
'phpmd-pre-commit.xml' => 12,
'template.xml' => 12,
'docblox.dist.xml' => 12,
'typeaheadasset.php' => 12,
'ueditor.php' => 12,
'_ide_helper.php' => 12,
'upgrade_to_1_2' => 12,
'run-test' => 12,
'install.xml' => 12,
'config_fonts.php' => 12,
'mpdf.css' => 12,
'compile.sh' => 12,
'inflector.php' => 12,
'releasenotes' => 12,
'wp-config-sample.php' => 12,
'wechat.php' => 12,
'cache.properties' => 12,
'browser.php' => 12,
'preview.png' => 12,
'tcpdf_barcodes_2d.php' => 12,
'install.sql' => 12,
'tcpdf_barcodes_1d.php' => 12,
'test-cov' => 12,
'connectioninterface.php' => 12,
'pearfarm.spec' => 12,
'package.xml.tmpl' => 12,
'revision' => 12,
'config.doxy' => 12,
'config.default.php' => 12,
'updates.php' => 12,
'demo.html' => 12,
'codecept.phar' => 12,
'runtests' => 12,
'path.php' => 12,
'register.php' => 12,
'config.m4' => 12,
'oauthtoken.php' => 12,
'cli' => 12,
'.pullapprove.yml' => 12,
'rss.php' => 12,
'index' => 12,
'update.sh' => 11,
'compress.php' => 11,
'gpl' => 11,
'wp-links-opml.php' => 11,
'progbar.css' => 11,
'wp-settings.php' => 11,
'wp-mail.php' => 11,
'wp-login.php' => 11,
'wp-load.php' => 11,
'phpconfig.ini' => 11,
'color.php' => 11,
'.directory' => 11,
'wp-trackback.php' => 11,
'data.php' => 11,
'wp-cron.php' => 11,
'wp-comments-post.php' => 11,
'homestead' => 11,
'wp-blog-header.php' => 11,
'wp-activate.php' => 11,
'wp-signup.php' => 11,
'samson.php' => 11,
'props.json' => 11,
'compiler.php' => 11,
'lib.php' => 11,
'logout.php' => 11,
'container.yml' => 11,
'cookie.php' => 11,
'license.lgpl' => 11,
'usermodule.php' => 11,
'yii.php' => 11,
'class.ext_update.php' => 11,
'activefixture.php' => 11,
'mysql.php' => 11,
'export.php' => 11,
'config.sample.php' => 11,
'.hgtags' => 11,
'upgrade-2.1' => 11,
'tabs.php' => 11,
'assets.json' => 11,
'runner.php' => 11,
'release.sh' => 11,
'404.html' => 11,
'usage.php' => 11,
'setting.php' => 11,
'document.php' => 11,
'typecheck' => 11,
'di.yml' => 11,
'phpspec.hhvm.yml' => 11,
'str.php' => 11,
'changelog-2.0' => 11,
'dumper.php' => 11,
'composers.php' => 11,
'crossdomain.xml' => 11,
'field.php' => 11,
'phpunit.bootstrap.php' => 11,
'daterangepicker.php' => 11,
'resetter.php' => 10,
'oauth2.php' => 10,
'payment.php' => 10,
'phpunit.coverage.xml' => 10,
'fileloader.php' => 10,
'php.ini.sample' => 10,
'qrcode.php' => 10,
'sidenav.php' => 10,
'tests.sh' => 10,
'text.php' => 10,
'.bumpversion.cfg' => 10,
'phakefile' => 10,
'daterangepickerasset.php' => 10,
'sitemap.php' => 10,
'get.php' => 10,
'task.php' => 10,
'.run' => 10,
'test.html' => 10,
'store.php' => 10,
'create-phar.php' => 10,
'bootstrap-dev.php' => 10,
'doxygen.conf' => 10,
'apigen.yml' => 10,
'kindeditorasset.php' => 10,
'adminasset.php' => 10,
'license.html' => 10,
'nitpick.json' => 10,
'qa-tools.json' => 10,
'adminmodule.php' => 10,
'readme.asciidoc' => 10,
'readme-ja' => 10,
'convert.php' => 10,
'crypt.php' => 10,
'globals.php' => 10,
'facade.php' => 10,
'runtests.bat' => 10,
'.eslintrc' => 10,
'slider.php' => 10,
'.jshintignore' => 10,
'info' => 10,
'captcha.php' => 10,
'vendors.php' => 10,
'apiary.apib' => 10,
'contributing.textile' => 10,
'ueditorasset.php' => 10,
'make-unit' => 10,
'run-tests-coverage' => 10,
'context.php' => 10,
'compile.php' => 10,
'module.conf.yaml' => 10,
'module.yaml' => 10,
'ajax.php' => 10,
'lgpl-3.0' => 10,
'analytics.php' => 10,
'formbuilder.php' => 10,
'autocompleteasset.php' => 10,
'example2.php' => 10,
'.travis_shell_after_success.sh' => 10,
'authaction.php' => 10,
'.travis.yml.dist' => 10,
'bootstrapasset.php' => 10,
'autoload.inc.php' => 10,
'splclassloader.php' => 10,
'invalidresponseexception.php' => 10,
'viewrenderer.php' => 10,
'uri.php' => 10,
'run-me.bat' => 10,
'bugfree.json' => 10,
'baseclient.php' => 10,
'translate.php' => 9,
'installation' => 9,
'hwioauthbundle.php' => 9,
'phpunit.local.xml' => 9,
'wrapper.php' => 9,
'imagecache.php' => 9,
'adminlteasset.php' => 9,
'aoe-logo.png' => 9,
'pager.php' => 9,
'app.yaml' => 9,
'dependencies' => 9,
'dco' => 9,
'token.php' => 9,
'build.xml.dist' => 9,
'currency.php' => 9,
'phpspec-ci.yml' => 9,
'.-travis.yml' => 9,
'.travis.ini' => 9,
'.gitignore~' => 9,
'argument.php' => 9,
'connectionfactory.php' => 9,
'manual' => 9,
'compatibility.php' => 9,
'theme.xml' => 9,
'xmlseclibs.php' => 9,
'group.php' => 9,
'object.php' => 9,
'security.php' => 9,
'changelog-0.x' => 9,
'.jscsrc' => 9,
'badge.php' => 9,
'htmlbuilder.php' => 9,
'sami-config.php' => 9,
'sami.config.php' => 9,
'lisence' => 9,
'phpunit-functional.xml.dist' => 9,
'phpunit-coverage.xml' => 9,
'managerregistry.php' => 9,
'email.php' => 9,
'apigen.conf' => 9,
'formatter.php' => 9,
'mddoc.xml' => 9,
'tutorial.php' => 9,
'docs.json' => 9,
'tags' => 9,
'sonatauserbundle.php' => 9,
'tree.php' => 9,
'helloworld.php' => 9,
'crawler.php' => 9,
'actioncolumn.php' => 9,
'paths.php' => 9,
'category.php' => 9,
'pakefile.php' => 9,
'example1.php' => 9,
'vendors.sh' => 9,
'composer.json.dist' => 9,
'composer' => 9,
'.phpcs.xml' => 9,
'i18n.php' => 9,
'cname' => 9,
'phpunit.xsd' => 9,
'thumbnail.php' => 9,
'package.sh' => 9,
'yiic.php' => 9,
'issue_template' => 9,
'processor.php' => 9,
'readme.php' => 9,
'lang.php' => 9,
'activeassets.php' => 9,
'development_readme' => 9,
'hacking' => 9,
'twitter.php' => 9,
'getting_started' => 9,
'daemon.php' => 9,
'loaderinterface.php' => 9,
'authentication.php' => 9,
'font info' => 8,
'copying.lib' => 8,
'gpl-license' => 8,
'bootstrap_phpunit.php' => 8,
'sami_docs.php' => 8,
'codemirrorasset.php' => 8,
'yaml.php' => 8,
'giiasset.php' => 8,
'spark.info' => 8,
'yiic' => 8,
'settings.gradle' => 8,
'elements.php' => 8,
'log' => 8,
'build.gradle' => 8,
'ckeditorasset.php' => 8,
'screenshot-index.png' => 8,
'screenshot-4.png' => 8,
'qc.yml' => 8,
'portkey.json' => 8,
'backend.php' => 8,
'fancyboxasset.php' => 8,
'readme_cn' => 8,
'.jms.yml' => 8,
'config_lang2fonts.php' => 8,
'simple_html_dom.php' => 8,
'build.bat' => 8,
'deploy' => 8,
'lang2fonts.css' => 8,
'config_script2lang.php' => 8,
'uploadbehavior.php' => 8,
'adwords.php' => 8,
'process.php' => 8,
'script_behat.sh' => 8,
'kahlan-config.php' => 8,
'script_phpunit.sh' => 8,
'.borisrc' => 8,
'gallerymanager.php' => 8,
'versions' => 8,
'styles.css' => 8,
'packagexmlsetup.php' => 8,
'doc' => 8,
'oauth1.php' => 8,
'index.tpl' => 8,
'gallerybehavior.php' => 8,
'htmlserviceprovider.php' => 8,
'collect.php' => 8,
'databaseserviceprovider.php' => 8,
'time.php' => 8,
'contribution' => 8,
'eventinterface.php' => 8,
'changelog-2.1' => 8,
'phpexcel.php' => 8,
'.bower.json' => 8,
'indexmanager.php' => 8,
'php-cs-fixer' => 8,
'injector.php' => 8,
'stream.php' => 8,
'disqus.php' => 8,
'setup.py' => 8,
'howitworks' => 8,
'tests.bootstrap.php' => 8,
'info.xml' => 8,
'schema.xml' => 8,
'job.php' => 8,
'sortablegridview.php' => 8,
'report.php' => 8,
'.px_execute.php' => 8,
'debug-test.php' => 8,
'driver.php' => 8,
'change.log' => 8,
'basecontroller.php' => 8,
'.apigen.yml' => 8,
'start.sh' => 8,
'urlmanager.php' => 8,
'uploadaction.php' => 8,
'phpcs.sh' => 8,
'print.css' => 8,
'.env-example' => 8,
'push-tests' => 8,
'driverinterface.php' => 8,
'tools.php' => 8,
'codestyle.xml' => 8,
'locale.php' => 8,
'dialog.php' => 8,
'format.php' => 8,
'n98-magerun.yaml' => 8,
'.pharignore' => 8,
'_bootstrap.php' => 8,
'.php_cs.cache' => 8,
'layout.php' => 8,
'compile' => 8,
'features' => 8,
'.eslintignore' => 8,
'urlgenerator.php' => 8,
'run-tests.bat' => 8,
'moduletrait.php' => 8,
'readme.en' => 8,
'manifest' => 8,
'angularasset.php' => 7,
'source.php' => 7,
'.coverall.yml' => 7,
'gpl-3.0' => 7,
'gravatar.php' => 7,
'._.ds_store' => 7,
'phinx.php' => 7,
'baseoauth.php' => 7,
'.config.json' => 7,
'make.php' => 7,
'imperaviredactorasset.php' => 7,
'logo.jpg' => 7,
'kindeditor.php' => 7,
'permission.php' => 7,
'textdirectionimperaviredactorpluginasset.php' => 7,
'pdo.php' => 7,
'thanks' => 7,
'datatable.jpg' => 7,
'win.runtest.bat' => 7,
'fontfamilyimperaviredactorpluginasset.php' => 7,
'plugin.yml' => 7,
'fontcolorimperaviredactorpluginasset.php' => 7,
'timepicker.php' => 7,
'fontsizeimperaviredactorpluginasset.php' => 7,
'fullscreenimperaviredactorpluginasset.php' => 7,
'latlng.php' => 7,
'configuration' => 7,
'info.php' => 7,
'mapasset.php' => 7,
'jquery.min.js' => 7,
'modulesserviceprovider.php' => 7,
'readme.git' => 7,
'package2.xml' => 7,
'clipsimperaviredactorpluginasset.php' => 7,
'changelog-3.0' => 7,
'mit.license' => 7,
'bfw_modules_info.php' => 7,
'phpdoc.sh' => 7,
'media.php' => 7,
'orchestra.json' => 7,
'startup.php' => 7,
'env.php' => 7,
'script.php' => 7,
'rest.php' => 7,
'status' => 7,
'fullcalendar.php' => 7,
'editablecolumn.php' => 7,
'gentry.json' => 7,
'filters.php' => 7,
'pluginmanager.php' => 7,
'barcodes.php' => 7,
'.phpunit.xml' => 7,
'readme-id' => 7,
'db.sql' => 7,
'publish.sh' => 7,
'travis.ini' => 7,
'phpdoc.ini.dist' => 7,
'config.w32' => 7,
'foundationasset.php' => 7,
'string.php' => 7,
'moduleasset.php' => 7,
'services.yml' => 7,
'type.php' => 7,
'socket.php' => 7,
'install.html' => 7,
'copyng' => 7,
'mime.php' => 7,
'changelog.html' => 7,
'security' => 7,
'install-frameworkmissing.html' => 7,
'generate.php' => 7,
'chart.php' => 7,
'make-junctions.sh' => 7,
'resources.php' => 7,
'jquery.js' => 7,
'treeview.php' => 7,
'routecollection.php' => 7,
'package.xml.tpl' => 7,
'comment.php' => 7,
'widgetasset.php' => 7,
'doctrine-mongo-mapping.xsd' => 7,
'phpunit.cnf.ini' => 7,
'license-gpl' => 7,
'signer.php' => 7,
'googlebundle.php' => 7,
'rtl.css' => 7,
'mapsmanager.php' => 7,
'neo4jphpversiontask.php' => 7,
'notifier.php' => 7,
'phpunit_mysql.xml' => 7,
'.travis.yaml' => 7,
'recaptcha.php' => 7,
'datetime.php' => 7,
'pbj-schemas.php' => 7,
'cas.php' => 7,
'interface.php' => 7,
'phpunit.cmd' => 7,
'.npmignore' => 7,
'example-google.php' => 7,
'php-cs-fixer.phar' => 7,
'phpinfo.php' => 7,
'.env.travis' => 7,
'gruntfile.js' => 7,
'elfinder.php' => 7,
'readme_old' => 7,
'.csslintrc' => 7,
'upgrade.html' => 7,
'storageinterface.php' => 7,
'slimscrollasset.php' => 7,
'apple-touch-icon.png' => 7,
'flash.php' => 7,
'highcharts.php' => 7,
'factoryinterface.php' => 7,
'person.php' => 7,
'crud.php' => 7,
'codesniffer.php' => 7,
'config.neon' => 7,
'sql.php' => 7,
'load_font.php' => 7,
'bump-version.sh' => 7,
'dompdf_config.custom.inc.php' => 7,
'exceptions.php' => 7,
'errors.php' => 7,
'.bzrignore' => 7,
'testsuite' => 7,
'.vimrc' => 7,
'logo.svg' => 7,
'phpcs.ruleset.xml' => 7,
'hybridresult.php' => 7,
'check.php' => 7,
'build.properties.dist' => 7,
'.apishka.php' => 7,
'config.inc.php' => 7,
'config.test.php' => 7,
'soapclient.php' => 7,
'summary' => 7,
'example' => 7,
'taxonomy.php' => 7,
'release.php' => 7,
'hooks.php' => 7,
'yiic.bat' => 7,
'docker-compose.yml.dist' => 7,
'notorm.php' => 7,
'pdf.php' => 7,
's3.php' => 7,
'managerconfigurator.php' => 6,
'soapresponse.php' => 6,
'soaprequest.php' => 6,
'running_behat' => 6,
'tableimperaviredactorpluginasset.php' => 6,
'package.boot.php' => 6,
'activeformasset.php' => 6,
'filemanagerimperaviredactorpluginasset.php' => 6,
'__init__.php' => 6,
'definedlinksimperaviredactorpluginasset.php' => 6,
'counterimperaviredactorpluginasset.php' => 6,
'resolver.php' => 6,
'note.development.nov.2011' => 6,
'messageconfig.php' => 6,
'run-tests.php' => 6,
'limiterimperaviredactorpluginasset.php' => 6,
'textexpanderimperaviredactorpluginasset.php' => 6,
'meta.php' => 6,
'upgrade-1.3' => 6,
'videoimperaviredactorpluginasset.php' => 6,
'db.xml' => 6,
'framework.php' => 6,
'upgrade-1.0' => 6,
'soapkernel.php' => 6,
'basemodel.php' => 6,
'fosuserevents.php' => 6,
'fosuserbundle.php' => 6,
'note.thenetcircle' => 6,
'imagemanagerimperaviredactorpluginasset.php' => 6,
'doctrine-mapping.xsd' => 6,
'armadillofile.yml' => 6,
'writer.php' => 6,
'changelog-0.1' => 6,
'plugin.json' => 6,
'patents' => 6,
'matcher.php' => 6,
'extension.json' => 6,
'selector.php' => 6,
'imagldapbundle.php' => 6,
'phpunit.sample.xml' => 6,
'buildtools' => 6,
'calendar.php' => 6,
'lexer.php' => 6,
'ueditoraction.php' => 6,
'plugins' => 6,
'wordpress.php' => 6,
'build.phpunit.xml' => 6,
'coverage.xml' => 6,
'phonenumber.php' => 6,
'treeviewasset.php' => 6,
'herbert.config.php' => 6,
'test_build' => 6,
'.acid.yml.dist' => 6,
'linkpager.php' => 6,
'transport.php' => 6,
'admingeneratorgeneratorbundle.php' => 6,
'definition.php' => 6,
'behavior.php' => 6,
'run-all.sh' => 6,
'htmlawed.php' => 6,
'development' => 6,
'dist.sh' => 6,
'rules.xml' => 6,
'armadillo_standin.sh' => 6,
'upgrade-2.8' => 6,
'themeasset.php' => 6,
'mapper.php' => 6,
'endpoint.php' => 6,
'spec' => 6,
'unittests.xml' => 6,
'howto' => 6,
'ocular.phar' => 6,
'realestatemssqlbundle.php' => 6,
'build-dev.xml' => 6,
'autocomplete.php' => 6,
'sortable.php' => 6,
'routingserviceprovider.php' => 6,
'imagemanager.php' => 6,
'routerinterface.php' => 6,
'htmlfacade.php' => 6,
'formfacade.php' => 6,
'readme.mkdn' => 6,
'carousel.php' => 6,
'acl.php' => 6,
'.noninteractive' => 6,
'formatconverter.php' => 6,
'access.php' => 6,
'2dbarcodes.php' => 6,
'config.yaml' => 6,
'opengraph.php' => 6,
'buildphar.php' => 6,
'transaction.php' => 6,
'cachemanager.php' => 6,
'materializeasset.php' => 6,
'attachment.php' => 6,
'make-junctions.bat' => 6,
'params.json' => 6,
'htmlcolors.php' => 6,
'webuploaderasset.php' => 6,
'validate.php' => 6,
'twitteroauth.php' => 6,
'win.composer.update.bat' => 6,
'content-none.php' => 6,
'changes-2.1.0' => 6,
'simpletest.php' => 6,
'navigation.php' => 6,
'users.php' => 6,
'rule.php' => 6,
'tcpdf.fdf' => 6,
'render.php' => 6,
'dataprovider.php' => 6,
'unicode_data.php' => 6,
'datatablesasset.php' => 6,
'help.php' => 6,
'dompdf.php' => 6,
'dompdf_config.inc.php' => 6,
'.eproject' => 6,
'timer.php' => 6,
'webuploader.php' => 6,
'readme.debian' => 6,
'inputfile.php' => 6,
'sayhello.php' => 6,
'rebuild.sh' => 6,
'arguments.php' => 6,
'runphpunit' => 6,
'runcomposer' => 6,
'up.sh' => 6,
'fancybox.php' => 6,
'kahlan-config.travis.php' => 6,
'review-1.4' => 6,
'travis.phpunit.xml.dist' => 6,
'pugxmultiuserbundle.php' => 6,
'notification.php' => 6,
'common.inc.php' => 6,
'mit-licence' => 6,
'nelmioapidocbundle.php' => 6,
'reader.php' => 6,
'datatypes.php' => 6,
'review-1.2' => 6,
'pbj-schema-stores.php' => 6,
'responseinterface.php' => 6,
'seeder.php' => 6,
'.travis-config.ini' => 6,
'eventdispatcher.php' => 6,
'element.php' => 6,
'license-agpl.html' => 6,
'license-commercial-saas.html' => 6,
'license-commercial-website.html' => 6,
'license-commercial-websites.html' => 6,
'home.php' => 6,
'filenotfoundexception.php' => 6,
'run-tests-hhvm' => 6,
'link.php' => 6,
'bootstrapper.php' => 6,
'singleton.php' => 6,
'cli-config.php.dist' => 6,
'role.php' => 6,
'pbjc.yml' => 6,
'.sami' => 6,
'uploadimagebehavior.php' => 6,
'tcpdf.crt' => 6,
'account.php' => 6,
'topsdk.php' => 6,
'parameter.php' => 6,
'upgrade_guide' => 6,
'teste.php' => 6,
'readme_spanish' => 6,
'expression.php' => 6,
'screenshot-inner.png' => 6,
'smarty_3.1_notes' => 6,
'php.ini.dist' => 6,
'boris' => 6,
'config.dist.php' => 6,
'jmsjobqueuebundle.php' => 6,
'phpunit-coverage-html.xml' => 6,
'smarty_3.0_bc_notes' => 6,
'httpexception.php' => 6,
'parameters.php' => 6,
'config_cp.php' => 6,
'filesystemmap.php' => 6,
'.phpmd.xml' => 6,
'readme.zh' => 6,
'smarty_2_bc_notes' => 6,
'repositoryinterface.php' => 6,
'simplehtmldom.php' => 6,
'extrasetup.php' => 6,
'np' => 6,
'myconfig.ini' => 6,
'php-semver-checker-git.yml.dist' => 6,
'vagrantfile.dist' => 6,
'_ss_environment.php' => 6,
'mousewheelasset.php' => 6,
'codefile.php' => 6,
'editable.php' => 6,
'markdowneditor.php' => 6,
'demo.gif' => 6,
'detailview.php' => 6,
'aliases.php' => 6,
'twig.php' => 6,
'entry.php' => 5,
'pre-commit' => 5,
'validatorinterface.php' => 5,
'croncontroller.php' => 5,
'annotation.php' => 5,
'scrut.json' => 5,
'example3.php' => 5,
'paymentfactory.php' => 5,
'phpbench.json.dist' => 5,
'index.xsl' => 5,
'fastclickasset.php' => 5,
'relation.php' => 5,
'pipeline.php' => 5,
'sessioninterface.php' => 5,
'parserinterface.php' => 5,
'readme.adoc' => 5,
'creditos' => 5,
'modernizrasset.php' => 5,
'changelog-3.1' => 5,
'copying-mit' => 5,
'collectioninterface.php' => 5,
'upgrade_to_1_1' => 5,
'headers.php' => 5,
'iconbar.php' => 5,
'phpunit-integration.xml' => 5,
'stofdoctrineextensionsbundle.php' => 5,
'codeclimate.yml' => 5,
'sass-compiler.php' => 5,
'exemple.php' => 5,
'.bldr.yml' => 5,
'userpath.php' => 5,
'documentation.html' => 5,
'release-notes.html' => 5,
'lena512color.jpg' => 5,
'detection.dat' => 5,
'facedetector.php' => 5,
'upgrade-1.5' => 5,
'fileinput.php' => 5,
'pathcontroller.php' => 5,
'ftp.php' => 5,
'api.json' => 5,
'test.bat' => 5,
'authorize.php' => 5,
'changelog-1.2' => 5,
'encrypter.php' => 5,
'gallerymanagerasset.php' => 5,
'problematicaclmanagerbundle.php' => 5,
'value.php' => 5,
'localpath.php' => 5,
'reporter.php' => 5,
'.composer.json.swp' => 5,
'readme.fr' => 5,
'documentacao_moip-php.pdf' => 5,
'sdk.class.php' => 5,
'queryinterface.php' => 5,
'autorun.php' => 5,
'review-1.1' => 5,
'config.js' => 5,
'phpbench.json' => 5,
'assetscallback.php' => 5,
'language.php' => 5,
'license.lesser' => 5,
'xmlmimefilter.php' => 5,
'wssecurityfilter.php' => 5,
'number.php' => 5,
'basepath.php' => 5,
'ftppath.php' => 5,
'mimefilter.php' => 5,
'summernote.php' => 5,
'cheatsheet' => 5,
'package.yml' => 5,
'zipper.sh' => 5,
'cookies.php' => 5,
'handler.template.php' => 5,
'stringhelper.php' => 5,
'encoder.php' => 5,
'testsuite.php' => 5,
'pluploadasset.php' => 5,
'icon.jpg' => 5,
'pluploadaction.php' => 5,
'plupload.php' => 5,
'chunkuploader.php' => 5,
'phpunit-travis.xml' => 5,
'timezone.php' => 5,
'version.json' => 5,
'phpword.ini.dist' => 5,
'todos' => 5,
'datamatrix.php' => 5,
'readme.dist' => 5,
'makefile.am' => 5,
'cli-tests.php' => 5,
'channel.php' => 5,
'point.php' => 5,
'pdf417.php' => 5,
'changelog.php' => 5,
'sample_push.php' => 5,
'.pre-commit' => 5,
'cropperasset.php' => 5,
'vendors.win.php' => 5,
'sample_push_custom.php' => 5,
'sample_push_many.php' => 5,
'sample_server.php' => 5,
'send.php' => 5,
'medoo.php' => 5,
'install-composer.sh' => 5,
'iotcpdfbundle.php' => 5,
'leiame' => 5,
'amazon-config.default.php' => 5,
'slender.yml' => 5,
'scientist.png' => 5,
'.gitkeep' => 5,
'typeahead.php' => 5,
'global.php' => 5,
'structure.sql' => 5,
'sql.sql' => 5,
'run-travis' => 5,
'spinner.php' => 5,
'shtumiusefulbundle.php' => 5,
'spbowerbundle.php' => 5,
'managerinterface.php' => 5,
'datagridevents.php' => 5,
'.gitattribute' => 5,
'phpunit_config.xml' => 5,
'version-check.json' => 5,
'theme.json' => 5,
'docs.sh' => 5,
'grid.php' => 5,
'.hedron.yml' => 5,
'sample_feedback.php' => 5,
'build-phar' => 5,
'configurationinterface.php' => 5,
'fullcalendarasset.php' => 5,
'foscommentbundle.php' => 5,
'book.json' => 5,
'match.php' => 5,
'travis.sh' => 5,
'progressbar.php' => 5,
'select2bootstrapasset.php' => 5,
'box.php' => 5,
'select.php' => 5,
'defaults.php' => 5,
'order.php' => 5,
'phpunit.no_autoload.xml' => 5,
'searchform.php' => 5,
'sphinxapi.php' => 5,
'resque.php' => 5,
'csv.php' => 5,
'shell.php' => 5,
'license.pdf' => 5,
'cover.png' => 5,
'.atoum.treemap.php' => 5,
'phpunit.mysql.xml' => 5,
'metronic.php' => 5,
'.phpdoc.xml' => 5,
'counter.php' => 5,
'excel.php' => 5,
'bugs' => 5,
'gallerymanageraction.php' => 5,
'liesmich' => 5,
'geolocation.php' => 5,
'config_fonts-distr-without-otl.php' => 5,
'license_yaml' => 5,
'themes.php' => 5,
'protocol.php' => 5,
'doctrinebundle.php' => 5,
'service' => 5,
'news.php' => 5,
'article.php' => 5,
'printasset.php' => 5,
'fileinterface.php' => 5,
'hh_autoload.json' => 5,
'fpdi_bridge.php' => 5,
'aggregateserviceprovider.php' => 5,
'cs-fixer' => 5,
'player.php' => 5,
'sortablegridaction.php' => 5,
'eventmanager.php' => 5,
'_changelog' => 5,
'basehtml.php' => 5,
'sortablegridasset.php' => 5,
'.htaccess.dist' => 5,
'eventsubscriberinterface.php' => 5,
'js.php' => 5,
'download.php' => 5,
'classmap.php' => 5,
'zip.php' => 5,
'redisqueue.php' => 5,
'mod_form.php' => 5,
'phpunit.xml.travisci' => 5,
'.dunitconfig-nightly' => 5,
'fr.php' => 5,
'ca-bundle.crt' => 5,
'change-log' => 5,
'locallib.php' => 5,
'reference.php' => 5,
'fpdf.php' => 5,
'jmsi18nroutingbundle.php' => 5,
'fpdf.css' => 5,
'ipn.php' => 5,
'encoding.php' => 5,
'gump.class.php' => 5,
'expressionlanguage.php' => 5,
'htmlawed_readme.htm' => 5,
'arrayhelper.php' => 5,
'htmlawed_readme' => 5,
'activedataprovider.php' => 5,
'preloader.php' => 5,
'inittestsuite.php' => 5,
'stats.php' => 5,
'testclass.tt' => 5,
'bootboxasset.php' => 5,
'sonatamediabundle.php' => 5,
'cron.sh' => 5,
'class.pop3.php' => 5,
'index.php.sample' => 5,
'sitemap.xml' => 5,
'mage' => 5,
'class.phpmailer.php' => 5,
'phpunit.xml.example' => 5,
'bootstrap.js' => 5,
'sessionmanager.php' => 5,
'sortablegridbehavior.php' => 5,
'infinitescrollasset.php' => 5,
'fosjsroutingbundle.php' => 5,
'garbagecollect.php' => 5,
'generate.sh' => 5,
'generate_api' => 5,
'tutorial' => 5,
'.mime' => 5,
'jsonresponse.php' => 5,
'sessionserviceprovider.php' => 5,
'update-gh-pages.sh' => 5,
'class.smtp.php' => 5,
'autoload.dist.php' => 5,
'remote.php' => 5,
'modelmanager.php' => 5,
'viewtopic.php' => 5,
'lgpl' => 5,
'htmlawedtest.php' => 5,
'htmlawed_testcase' => 5,
'buttondropdown.php' => 5,
'enum.php' => 5,
'fontawesome.php' => 5,
'license-apache' => 5,
'routing.php' => 5,
'profiler.php' => 5,
'messages.php' => 5,
'cart.php' => 5,
'screen.png' => 5,
'yuicompressor.jar' => 5,
'makerelease.sh' => 5,
'animateasset.php' => 5,
'packager' => 5,
'screen-shot.png' => 5,
'kindeditorwidget.php' => 5,
'fluent.php' => 5,
'runmessage' => 5,
'license.textile' => 5,
'collapse.php' => 5,
'phpunit.functional.xml.dist' => 5,
'applicationinterface.php' => 5,
'phpspec-html.yml' => 5,
'phpspec-clover.yml' => 5,
'packager.php' => 5,
'thankyou' => 5,
'contributions' => 5,
'galleryimage.php' => 5,
'datatables.php' => 5,
'venne-phing.xml' => 5,
'codecept' => 5,
'show.php' => 5,
'system.php' => 5,
'assetsjqueryadapter.php' => 5,
'recorder.php' => 5,
'upgrade-1.2' => 5,
'fileupload.php' => 5,
'upgrade-1.4' => 5,
'httpclient.php' => 5,
'.doxygen' => 5,
'minion' => 5,
'eventdispatcherinterface.php' => 5,
'package_compatible.xml' => 5,
'menus.php' => 5,
'dump.sql' => 5,
'formatterinterface.php' => 5,
'favicon.png' => 5,
'shoppingcart.php' => 5,
'default-disable' => 5,
'phpunit.xml.hhvm' => 5,
'datetimebehavior.php' => 5,
'clover.xml' => 5,
'paypal.php' => 5,
'migratecontroller.php' => 5,
'namespaceditemresolver.php' => 5,
'httpclientinterface.php' => 5,
'translationserviceprovider.php' => 5,
'coverage' => 5,
'.env-sample' => 5,
'autoloader.class.php' => 5,
'gatewayinterface.php' => 5,
'sliderasset.php' => 5,
'timeline.php' => 5,
'dynamicmodel.php' => 5,
'porting_info' => 5,
'validationexception.php' => 5,
'install.bat' => 5,
'_register_database.php' => 5,
'menuasset.php' => 5,
'branches' => 5,
'sync.php' => 5,
'emailinterface.php' => 5,
'password.php' => 5,
'silverstripe_version' => 5,
'commit.bat' => 5,
'sandbox.php' => 5,
'imagebehavior.php' => 5,
'migrationserviceprovider.php' => 5,
'sweetalertasset.php' => 5,
'allincl.php' => 5,
'nestedsetbehavior.php' => 4,
'phpcodesniffer.xml' => 4,
'phpdoc.ini' => 4,
'jstree.php' => 4,
'phpunit-integration-legacy.xml' => 4,
'grammar.php' => 4,
'bitly.php' => 4,
'alertasset.php' => 4,
'proxy.php' => 4,
'accordion.php' => 4,
'permissions.php' => 4,
'configinterface.php' => 4,
'codeofconduct' => 4,
'ref.js' => 4,
'usermanagementmodule.php' => 4,
'pull_request_template' => 4,
'i.sh' => 4,
'statement.php' => 4,
'chatasset.php' => 4,
'changelog.htm' => 4,
'faq.htm' => 4,
'db.class.php' => 4,
'.phpunit' => 4,
'ref.php' => 4,
'listener.php' => 4,
'templateengine.php' => 4,
'ref.css' => 4,
'schema.sql' => 4,
'configexception.php' => 4,
'dispatch.php' => 4,
'menubuilder.php' => 4,
'bootstrap.inc.php' => 4,
'parameters.yml.dist' => 4,
'front-page.php' => 4,
'hello.php' => 4,
'indexer.php' => 4,
'fosfacebookbundle.php' => 4,
'searchbundle.php' => 4,
'tsmarty2c.php' => 4,
'mediawiki-extension.json' => 4,
'demo' => 4,
'compatibility-test.php' => 4,
'phpairbrakebundle.php' => 4,
'class.krumo.php' => 4,
'library.php' => 4,
'ivorygooglemapbundle.php' => 4,
'pear.php' => 4,
'obfuscator.php' => 4,
'containerawarejob.php' => 4,
'idiorm.php' => 4,
'.dir-locals.el' => 4,
'readme.sublime-workspace' => 4,
'routerexception.php' => 4,
'money.php' => 4,
'mailchimp.php' => 4,
'codesniffer.conf' => 4,
'php.php' => 4,
'output.png' => 4,
'solr.php' => 4,
'fpdf_tpl.php' => 4,
'config-example.php' => 4,
'jwt.php' => 4,
'serializerinterface.php' => 4,
'pdostatement.php' => 4,
'data' => 4,
'phpdocumentor.phar' => 4,
'converter.php' => 4,
'dev' => 4,
'style.php' => 4,
'svggraphmultilinegraph.php' => 4,
'svggraphmultiradargraph.php' => 4,
'viewforum.php' => 4,
'viewerrorbag.php' => 4,
'instance.php' => 4,
'pluralizer.php' => 4,
'svggraphmultiscattergraph.php' => 4,
'svggraphmultigraph.php' => 4,
'svggraphpattern.php' => 4,
'svggraphpie3dgraph.php' => 4,
'title.php' => 4,
'svggraphpiegraph.php' => 4,
'gettext.php' => 4,
'svggraphpointgraph.php' => 4,
'dbmanager.php' => 4,
'example4.php' => 4,
'locallang_db.xml' => 4,
'thumbaction.php' => 4,
'svggraphhorizontalbargraph.php' => 4,
'redis.php' => 4,
'phpspec.no-coverage.yml' => 4,
'svggraphhorizontalfloatingbargraph.php' => 4,
'video.php' => 4,
'filebehavior.php' => 4,
'tips' => 4,
'svggraphlinegraph.php' => 4,
'build-phar.php' => 4,
'svggraphhorizontalgroupedbargraph.php' => 4,
'run-test.sh' => 4,
'svggraphhorizontalstackedbargraph.php' => 4,
'svggraphjavascript.php' => 4,
'routeinterface.php' => 4,
'svggraphpolarareagraph.php' => 4,
'svggraphpopulationpyramid.php' => 4,
'svggraphgroupedcylindergraph.php' => 4,
'address.php' => 4,
'svggraph.ini' => 4,
'uploadedfile.php' => 4,
'mailserviceprovider.php' => 4,
'presenter.php' => 4,
'controllerinterface.php' => 4,
'dispatcherinterface.php' => 4,
'etspaymentogonebundle.php' => 4,
'paginationserviceprovider.php' => 4,
'packagecreator.php' => 4,
'containerinterface.php' => 4,
'codesniffer.conf.dist' => 4,
'apiexception.php' => 4,
'requestinterface.php' => 4,
'datetimecomparevalidator.php' => 4,
'svggraphstructureddata.php' => 4,
'.nitpick.json' => 4,
'renderer.php' => 4,
'workbenchserviceprovider.php' => 4,
'svggraphradargraph.php' => 4,
'travis.xml' => 4,
'svggraphscattergraph.php' => 4,
'liqpay.php' => 4,
'edit_form.php' => 4,
'post.php' => 4,
'htmlform.php' => 4,
'svggraphstackedlinegraph.php' => 4,
'svggraphstackedbar3dgraph.php' => 4,
'messagebag.php' => 4,
'svggraphstackedbargraph.php' => 4,
'svggraphstackedcylindergraph.php' => 4,
'ext_tables_static+adt.sql' => 4,
'htmlstring.php' => 4,
'regioncode.php' => 4,
'currencies.json' => 4,
'mailparser.php' => 4,
'nexmoaccount.php' => 4,
'phpdoc.xml-dist' => 4,
'.build.props' => 4,
'phings' => 4,
'nexmoreceipt.php' => 4,
'nexmomessage.php' => 4,
'settingsaction.php' => 4,
'foselasticabundle.php' => 4,
'delete.php' => 4,
'properties.php' => 4,
'utilities.php' => 4,
'manual.html' => 4,
'travis-config.ini' => 4,
'module.ini' => 4,
'deployment.properties' => 4,
'doc.sh' => 4,
'doc.php' => 4,
'redirector.php' => 4,
'treeasset.php' => 4,
'config.php-development' => 4,
'guid.php' => 4,
'readme.dcy' => 4,
'codecept.bat' => 4,
'jobinterface.php' => 4,
'mysql.sql' => 4,
'timeago.php' => 4,
'product.php' => 4,
'liscense' => 4,
'kcfinderasset.php' => 4,
'default.php' => 4,
'changelog.mkd' => 4,
'testlistener.php' => 4,
'test-config.yml.dist' => 4,
'abstractcontroller.php' => 4,
'config.php.example' => 4,
'phonenumberutil.php' => 4,
'svggraphdata.php' => 4,
'dialogasset.php' => 4,
'notify.php' => 4,
'svggraphbargraph.php' => 4,
'svggraphboxandwhiskergraph.php' => 4,
'svggraphbubblegraph.php' => 4,
'svggraphcylindergraph.php' => 4,
'svggraphdonutgraph.php' => 4,
'svggraphaxislog.php' => 4,
'merchant.php' => 4,
'svggraphexplodedpiegraph.php' => 4,
'svggraphfloatingbargraph.php' => 4,
'svggraphgridgraph.php' => 4,
'svggraphgroupedbar3dgraph.php' => 4,
'svggraphgroupedbargraph.php' => 4,
'svggraphbar3dgraph.php' => 4,
'svggraphaxisfixeddoubleended.php' => 4,
'invoker.php' => 4,
'countrycodetoregioncodemap.php' => 4,
'services.php' => 4,
'ewzrecaptchabundle.php' => 4,
'filterinterface.php' => 4,
'schemamanager.php' => 4,
'platform.php' => 4,
'growl.php' => 4,
'svggraph.php' => 4,
'svggraphaxisfixed.php' => 4,
'svggraph3dgraph.php' => 4,
'svggraphaxis.php' => 4,
'_license' => 4,
'numberparseexception.php' => 4,
'transformer.php' => 4,
'phonemetadata.php' => 4,
'svggraphaxisdoubleended.php' => 4,
'.php_cs-fixers.php' => 4,
'google.php' => 4,
'webtestcase.php' => 4,
'columnschema.php' => 4,
'readme.rdoc' => 4,
'build.vagrant.properties' => 4,
'server_status.php' => 4,
'licenses' => 4,
'server_sql.php' => 4,
'.drone.sec' => 4,
'server_replication.php' => 4,
'server_privileges.php' => 4,
'server_plugins.php' => 4,
'filtermanager.php' => 4,
'server_import.php' => 4,
'server_export.php' => 4,
'server_status_monitor.php' => 4,
'server_engines.php' => 4,
'.description.php' => 4,
'watchr.rb' => 4,
'server_databases.php' => 4,
'lint.php' => 4,
'server_collations.php' => 4,
'server_binlog.php' => 4,
'phpunit.teamcity.mssql.xml' => 4,
's3path.php' => 4,
'loggerinterface.php' => 4,
'schema_export.php' => 4,
'server_status_advisor.php' => 4,
'server_status_processes.php' => 4,
'prefs_forms.php' => 4,
'settings.ini' => 4,
'sanitizer.php' => 4,
'htmlcompressor.php' => 4,
'tbl_replace.php' => 4,
'tbl_relation.php' => 4,
'experimental' => 4,
'tbl_recent_favorite.php' => 4,
'phppackage.png' => 4,
'oil' => 4,
'tbl_operations.php' => 4,
'tbl_indexes.php' => 4,
'tbl_import.php' => 4,
'tbl_gis_visualization.php' => 4,
'server_status_queries.php' => 4,
'tbl_get_field.php' => 4,
'tbl_find_replace.php' => 4,
'tbl_export.php' => 4,
'tbl_create.php' => 4,
'tbl_chart.php' => 4,
'tbl_change.php' => 4,
'tbl_addfield.php' => 4,
'show_config_errors.php' => 4,
'server_variables.php' => 4,
'server_user_groups.php' => 4,
'server_status_variables.php' => 4,
'prefs_manage.php' => 4,
'develop' => 4,
'tbl_select.php' => 4,
'phpunit-dist.xml' => 4,
'db_events.php' => 4,
'db_designer.php' => 4,
'db_datadict.php' => 4,
'db_central_columns.php' => 4,
'contributor_license_agreement.html' => 4,
'config-sample.inc.php' => 4,
'config.sample.inc.php' => 4,
'math.php' => 4,
'chk_rel.php' => 4,
'posting.php' => 4,
'composite.php' => 4,
'soapclientbuilder.php' => 4,
'db_import.php' => 4,
'wsaddressingfilter.php' => 4,
'wsdldownloader.php' => 4,
'adapterinterface.php' => 4,
'processmanager.php' => 4,
'phpunit-html-coverage.xml' => 4,
'cubex' => 4,
'package.jpg' => 4,
'summernoteasset.php' => 4,
'contributors.html' => 4,
'set.php' => 4,
'contact.php' => 4,
'db_export.php' => 4,
'db_operations.php' => 4,
'.travis_install_dependencies.sh' => 4,
'gis_data_editor.php' => 4,
'phpguard.yml.dist' => 4,
'buttonwidget.php' => 4,
'license.bsd' => 4,
'lexikmailerbundle.php' => 4,
'layout.html' => 4,
'phpunit.coverage.xml.dist' => 4,
'phpmyadmin.css.php' => 4,
'normalization.php' => 4,
'markup.php' => 4,
'license.php' => 4,
'import_status.php' => 4,
'file_echo.php' => 4,
'copying3' => 4,
'error_report.php' => 4,
'db_triggers.php' => 4,
'applicationfactory.php' => 4,
'db_tracking.php' => 4,
'compiler.jar' => 4,
'db_structure.php' => 4,
'db_sql_format.php' => 4,
'db_sql_autocomplete.php' => 4,
'db_sql.php' => 4,
'db_search.php' => 4,
'db_routines.php' => 4,
'tbl_row_action.php' => 4,
'tbl_sql.php' => 4,
'turbosms.php' => 4,
'bootstrapthemeasset.php' => 4,
'boxfile.install' => 4,
'bootstrap.css' => 4,
'grammar.pp' => 4,
'phpmailerautoload.php' => 4,
'alipay.php' => 4,
'ccdnusersecuritybundle.php' => 4,
'public.php' => 4,
'status.php' => 4,
'profile.php' => 4,
'formgenerator.php' => 4,
'.travis_publish_doc.sh' => 4,
'bootstrappluginasset.php' => 4,
'example-wrapper.php' => 4,
'licanse' => 4,
'laravel' => 4,
'rb.php' => 4,
'column.php' => 4,
'checkboxcolumn.php' => 4,
'momentjsasset.php' => 4,
'twigextension.php' => 4,
'assetmanager.php' => 4,
'smarty.php' => 4,
'.php-cs-fixer.php' => 4,
'uploadifyasset.php' => 4,
'random.php' => 4,
'example-form.php' => 4,
'card.php' => 4,
'watch.sh' => 4,
'php_parser.php' => 4,
'gallery.php' => 4,
'bench.php' => 4,
'infinitescrollpager.php' => 4,
'announce' => 4,
'structure.php' => 4,
'parameterbag.php' => 4,
'browse.php' => 4,
'slug.php' => 4,
'middlewareinterface.php' => 4,
'middleware.php' => 4,
'apigen' => 4,
'example-cloudfront.php' => 4,
'writeme' => 4,
'.preflight' => 4,
'materializepluginasset.php' => 4,
'datatablesbootstrapasset.php' => 4,
'debugpanel.php' => 4,
'ide_helper.php' => 4,
'buttonfixedaction.php' => 4,
'.cfignore' => 4,
'splfileinfo.php' => 4,
'bootstrapswitchasset.php' => 4,
'travisci-phpunit.xml' => 4,
'fastimage.php' => 4,
'easyimage.php' => 4,
'tbl_structure.php' => 4,
'arrayutils.php' => 4,
'containerawaretrait.php' => 4,
'alias.php' => 4,
'phpserver.php' => 4,
'directive.php' => 4,
'.snippets' => 4,
'maskmoneyasset.php' => 4,
'directory.php' => 4,
'yii2-setting-preview.png' => 4,
'webapp.php' => 4,
'view_operations.php' => 4,
'view_create.php' => 4,
'version_check.php' => 4,
'dal.php' => 4,
'schedule.php' => 4,
'user_password.php' => 4,
'cropasset.php' => 4,
'transformation_wrapper.php' => 4,
'transformation_overview.php' => 4,
'tbl_zoom_select.php' => 4,
'phpdoc.yml' => 4,
'deprecated' => 4,
'tbl_triggers.php' => 4,
'readme.creole' => 4,
'tbl_tracking.php' => 4,
'documentinterface.php' => 4,
'plivo.php' => 4,
'utilsbundle.php' => 4,
'config.ru' => 4,
'languageasset.php' => 4,
'thumbs.db' => 4,
'lessc.inc.php' => 4,
'apiclient.php' => 4,
'.user.ini' => 4,
'sensiogeneratorbundle.php' => 4,
'catalog.php' => 4,
'serialcolumn.php' => 4,
'spreadsheetreader.php' => 4,
'captchaaction.php' => 4,
'spreadsheetreader_csv.php' => 4,
'acf.php' => 4,
'teste' => 4,
'spreadsheetreader_ods.php' => 4,
'dev.php' => 4,
'spreadsheetreader_xls.php' => 4,
'spreadsheetreader_xlsx.php' => 4,
'option.php' => 4,
'extractor.php' => 4,
'orm.php' => 4,
'datamapper.php' => 4,
'phpmig.php' => 4,
'block.php' => 4,
'property.php' => 4,
'specificationinterface.php' => 4,
'db_qbe.php' => 4,
'hipmandrillbundle.php' => 4,
'encodings_maps.php' => 4,
'config.inc.php.dist' => 4,
'dist.php' => 4,
'oauthrequest.php' => 4,
'cropper.php' => 4,
'oauthexception.php' => 4,
'oauthdatastore.php' => 4,
'togglecolumn.php' => 4,
'gridviewasset.php' => 4,
'oauthsignaturemethod.php' => 4,
'unitstype.php' => 4,
'size.php' => 4,
'pluginabstract.php' => 4,
'overlaytrait.php' => 4,
'optionstrait.php' => 4,
'objectabstract.php' => 4,
'maptypeid.php' => 4,
'oauthserver.php' => 4,
'oauthutil.php' => 4,
'latlngbounds.php' => 4,
'env.example' => 4,
'checker.php' => 4,
'icingaexchange.yml' => 4,
'uikitasset.php' => 4,
'example.htaccess' => 4,
'migrations.json' => 4,
'accounts.json' => 4,
'highchartsasset.php' => 4,
'visualpaginator.php' => 4,
'migrate.php' => 4,
'example.css' => 4,
'formserviceprovider.php' => 4,
'connector.php' => 4,
'protoc-gen-php.php' => 4,
'protoc-gen-php.bat' => 4,
'gofile' => 4,
'release-0.1.0' => 4,
'braincraftedbootstrapbundle.php' => 4,
'latlngliteral.php' => 4,
'eventtype.php' => 4,
'output.php' => 4,
'config.template.php' => 4,
'build.linux.properties' => 4,
'build.mac.properties' => 4,
'oxygen' => 4,
'processorinterface.php' => 4,
'.codeclimate' => 4,
'changes 5.7.3' => 4,
'txt.license' => 4,
'txt.version' => 4,
'scheduler.php' => 4,
'app' => 4,
'configure.php' => 4,
'maintainers' => 4,
'botdetector.php' => 4,
'a' => 4,
'ext-all.js' => 4,
'locallang.xml' => 4,
'filemanager.php' => 4,
'user.sql' => 4,
'clientabstract.php' => 4,
'sonatadoctrinemongodbadminbundle.php' => 4,
'srgb.icc' => 4,
'relationbehavior.php' => 4,
'spotcolors.php' => 4,
'tcpdf.p12' => 4,
'tcpdf_filters.php' => 4,
'browse_foreigners.php' => 4,
'.travis' => 4,
'sami_configuration.php' => 4,
'local-config-sample.php' => 4,
'buildapi.sh' => 4,
'bootstrap-vagrant.sh' => 4,
'readme_exportafacil' => 4,
'embed.php' => 4,
'meta.yml' => 4,
'upgrade-1.9' => 4,
'consoleserviceprovider.php' => 4,
'avalancheimaginebundle.php' => 4,
'display.php' => 4,
'oauthconsumer.php' => 4,
'dropzone.php' => 4,
'database.png' => 4,
'topbarsection.php' => 4,
'grammar.y' => 4,
'topbar.php' => 4,
'modules.php' => 4,
'readme-en' => 4,
'dropzoneasset.php' => 4,
'navigationwidget.php' => 4,
'breadcrumb.php' => 4,
'class.php' => 4,
'sessionhandler.php' => 4,
'unitofwork.php' => 4,
'foundationiconasset.php' => 4,
'function.php' => 4,
'behat.yml-dist' => 4,
'webserver.php' => 4,
'formmetadata.php' => 4,
'generate-docs.sh' => 4,
'baseimage.php' => 4,
'classes.png' => 4,
'recaptchavalidator.php' => 4,
'config.json.dist' => 4,
'dropdownbutton.php' => 4,
'formmapper.php' => 4,
'lessify.inc.php' => 3,
'.scrutinzer.yml' => 3,
'detached.php' => 3,
'httpresource.php' => 3,
'web_tester.php' => 3,
'upgrade-3.2' => 3,
'plessc' => 3,
'help_my_tests_dont_work_anymore' => 3,
'target.php' => 3,
'run-test-hhvm' => 3,
'default_reporter.php' => 3,
'apple-touch-icon-114x114-precomposed.png' => 3,
'releases' => 3,
'upgrade-3.1' => 3,
'taskinterface.php' => 3,
'encryptor.php' => 3,
'scss.php' => 3,
'nginx_app.conf' => 3,
'makefile.pl' => 3,
'xmlparser.php' => 3,
'readme-dev' => 3,
'touchspin.php' => 3,
'travisconfig.ini' => 3,
'phpspec.yml.hhvm' => 3,
'yiidebugviewrenderer.php' => 3,
'phpunit.watcher.json' => 3,
'basestorage.php' => 3,
'changelog-4.0' => 3,
'nelmiosecuritybundle.php' => 3,
'storeinterface.php' => 3,
'netterobots' => 3,
'aliasloader.php' => 3,
'objectresolver.php' => 3,
'lessify' => 3,
'welcome.php' => 3,
'file-header.phps' => 3,
'publish' => 3,
'sypexgeo.php' => 3,
'macaw.php' => 3,
'code-coverage.xml' => 3,
'.travis.before-install' => 3,
'passwordinterface.php' => 3,
'authenticator.php' => 3,
'expectation.php' => 3,
'eclipse.php' => 3,
'knpzendcachebundle.php' => 3,
'connectoraction.php' => 3,
'partner.php' => 3,
'userevents.php' => 3,
'update.bat' => 3,
'debugaction.php' => 3,
'conventions' => 3,
'hearsayrequirejsbundle.php' => 3,
'install.mysql' => 3,
'install.pgsql' => 3,
'geo.php' => 3,
'install.sqlite' => 3,
'auth-schema-mysql.sql' => 3,
'auth-schema-postgresql.sql' => 3,
'summernotelanguageasset.php' => 3,
'collector.php' => 3,
'ccdnforumforumbundle.php' => 3,
'dbug.php' => 3,
'phpcs_ruleset.xml' => 3,
'apple-touch-icon-precomposed.png' => 3,
'demo.sql' => 3,
'doctrine_annotations.php' => 3,
'whiteoctobertcpdfbundle.php' => 3,
'license_osl' => 3,
'front.php' => 3,
'gallerycontroller.php' => 3,
'tmp' => 3,
'nestedsortableasset.php' => 3,
'nestedsortable.php' => 3,
'envoy.blade.php' => 3,
'environaut.xml' => 3,
'apple-touch-icon-72x72-precomposed.png' => 3,
'private.php' => 3,
'operator.php' => 3,
'syliusorderevents.php' => 3,
'ecommerce.php' => 3,
'groovey' => 3,
'sxgeo.php' => 3,
'gen.php' => 3,
'_lgpl' => 3,
'apple-touch-icon-144x144-precomposed.png' => 3,
'knpgaufrettebundle.php' => 3,
'npm-debug.log' => 3,
'notice.php' => 3,
'lisezmoi' => 3,
'app.json.dist' => 3,
'comparatorinterface.php' => 3,
'.git-push-everywhere' => 3,
'dropdownx.php' => 3,
'lecense' => 3,
'datetimeattribute.php' => 3,
'navx.php' => 3,
'sortablelistview.php' => 3,
'phpdoctor.ini' => 3,
'phpunit-lts.phar' => 3,
'treeviewinput.php' => 3,
'apple-touch-icon-57x57-precomposed.png' => 3,
'serviceregistry.php' => 3,
'screenshot-1.jpg' => 3,
'entitymanager.php' => 3,
'.travis-php.ini' => 3,
'readme_rus' => 3,
'pdepend.xml.dist' => 3,
'filehandlerinterface.php' => 3,
'poll.php' => 3,
'yiidebugtoolbar.php' => 3,
'htaccess.example' => 3,
'license_tr' => 3,
'sismo.config.php.dist' => 3,
'unit_tester.php' => 3,
'validationserviceprovider.php' => 3,
'tpl.php' => 3,
'thelia' => 3,
'yiidebugcontroller.php' => 3,
'luascriptbuilder.php' => 3,
'cmsbundle.php' => 3,
'yiidebugtoolbarpanel.php' => 3,
'datetimecomparevalidationasset.php' => 3,
'symfony' => 3,
'stamp.yml' => 3,
'yiidebugcomponentproxy.php' => 3,
'googlemaps.php' => 3,
'svggraphstackedgroupedbargraph.php' => 3,
'before_script.sh' => 3,
'yiidebug.php' => 3,
'yiidebugtoolbarroute.php' => 3,
'symfony license' => 3,
'structure' => 3,
'trace.php' => 3,
'.phpunit.bootstrap.php' => 3,
'phpcodesniffer' => 3,
'doxygen_input_filter.php' => 3,
'ajaxbutton.php' => 3,
'infobox.php' => 3,
'funk.yml.dist' => 3,
'annotations' => 3,
'facebook.php' => 3,
'uikitalmostflatasset.php' => 3,
'simple.php' => 3,
'uikitgradientasset.php' => 3,
'git.php' => 3,
'uikitpluginasset.php' => 3,
'oauth2serverbundle.php' => 3,
'apccache.php' => 3,
'ole.php' => 3,
'serve' => 3,
'require.php' => 3,
'fileinputasset.php' => 3,
'config.php.template' => 3,
'exemplo.php' => 3,
'licencse' => 3,
'test.css' => 3,
'compile-apache.php' => 3,
'xhprof.php' => 3,
'minify.php' => 3,
'template.latte' => 3,
'twitterapiexchange.php' => 3,
'changelog.textile' => 3,
'screenshot1.png' => 3,
'module.conf.local.yaml' => 3,
'leeme' => 3,
'selectable.php' => 3,
'routes' => 3,
'extensionbuilder.json' => 3,
'frames.php' => 3,
'r.php' => 3,
'githubmarkdown.php' => 3,
'pear.sh' => 3,
'http-console.php' => 3,
'sessionstorage.php' => 3,
'creds-dist.php' => 3,
'history.php' => 3,
'.zfproject.xml' => 3,
'spyc.php' => 3,
'exceptionhandler.php' => 3,
'dashboard.json' => 3,
'yiidebugviewhelper.php' => 3,
'youtube.php' => 3,
'filesystemserviceprovider.php' => 3,
'cookiejar.php' => 3,
'jmsserializerbundle.php' => 3,
'blog.php' => 3,
'phpqrcode.php' => 3,
'slidermodule.php' => 3,
'menumodule.php' => 3,
'pheanstalk_init.php' => 3,
'spyc.yaml' => 3,
'conf.php' => 3,
'queuemanager.php' => 3,
'tidy_parser.php' => 3,
'scss.inc.php' => 3,
'typeinterface.php' => 3,
'.atoum.php.dist' => 3,
'.gitmessage' => 3,
'sqsqueue.php' => 3,
'changelog-2.x' => 3,
'test_case.php' => 3,
'shell_tester.php' => 3,
'.styleci' => 3,
'todo.xml' => 3,
'scorer.php' => 3,
'istorage.php' => 3,
'calendar.png' => 3,
'swiftmailerbundle.php' => 3,
'toast.php' => 3,
'.test.php' => 3,
'filemaker.php' => 3,
'abstracttype.php' => 3,
'changelog-1.x' => 3,
'reflection_php5.php' => 3,
'mock_objects.php' => 3,
'fmsteamcondenserbundle.php' => 3,
'pakefile' => 3,
'monitor.php' => 3,
'treeviewinputasset.php' => 3,
'puppetfile' => 3,
'authmanager.php' => 3,
'whois.gtld.fastdomain.php' => 3,
'whois.gtld.corporatedomains.php' => 3,
'whois.gtld.directnic.php' => 3,
'whois.gtld.domaindiscover.php' => 3,
'whois.gtld.domainpeople.php' => 3,
'whois.gtld.dotster.php' => 3,
'whois.gtld.dreamhost.php' => 3,
'whois.gtld.enom.php' => 3,
'whois.gtld.fabulous.php' => 3,
'whois.gtld.gandi.php' => 3,
'whois.gtld.ascio.php' => 3,
'whois.gtld.genericb.php' => 3,
'whois.gtld.godaddy.php' => 3,
'avocodeformextensionsbundle.php' => 3,
'whois.gtld.iana.php' => 3,
'whois.gtld.interdomain.php' => 3,
'whois.gtld.itsyourdomain.php' => 3,
'run' => 3,
'whois.gtld.joker.php' => 3,
'whois.gtld.assorted.php' => 3,
'whois.gtld.alldomains.php' => 3,
'whois.gtld.melbourneit.php' => 3,
'whois.de.php' => 3,
'whois.client.php' => 3,
'whois.cn.php' => 3,
'whois.co.php' => 3,
'geocoder.php' => 3,
'whois.co.za.php' => 3,
'whois.coop.php' => 3,
'jobworkload.php' => 3,
'whois.cz.php' => 3,
'whois.edu.php' => 3,
'whois.gtld.afternic.php' => 3,
'jobbase.php' => 3,
'whois.eu.php' => 3,
'whois.fi.php' => 3,
'gearmancontroller.php' => 3,
'whois.fj.php' => 3,
'gearmancomponent.php' => 3,
'bootstrap.min.css' => 3,
'whois.fr.php' => 3,
'composer_install_github_key.sh' => 3,
'whois.gtld.markmonitor.php' => 3,
'whois.gtld.moniker.php' => 3,
'phpunit-integration-legacy-solr.xml' => 3,
'whois.ie.php' => 3,
'whois.gtld.schlund.php' => 3,
'whois.gtld.srsplus.php' => 3,
'whois.gtld.tmagnic.php' => 3,
'whois.gtld.tvcorp.php' => 3,
'whois.gtld.wildwestdomains.php' => 3,
'whois.hu.php' => 3,
'whois.icon.png' => 3,
'whois.idna.php' => 3,
'whois.il.php' => 3,
'whois.gtld.register.php' => 3,
'whois.in.php' => 3,
'whois.info.php' => 3,
'whois.int.php' => 3,
'whois.ip.afrinic.php' => 3,
'whois.ip.apnic.php' => 3,
'whois.ip.arin.php' => 3,
'whois.ip.krnic.php' => 3,
'whois.ip.lacnic.php' => 3,
'whois.gtld.rrpproxy.php' => 3,
'whois.gtld.publicdomainregistry.php' => 3,
'whois.gtld.name.php' => 3,
'whois.gtld.nicco.php' => 3,
'whois.gtld.nameintel.php' => 3,
'whois.gtld.namejuice.php' => 3,
'apcclassloader.php' => 3,
'classcollectionloader.php' => 3,
'whois.gtld.nameking.php' => 3,
'whois.gtld.names4ever.php' => 3,
'whois.gtld.namevault.php' => 3,
'whois.gtld.networksolutions.php' => 3,
'whois.gtld.nicline.php' => 3,
'whois.gtld.psiusa.php' => 3,
'classmapgenerator.php' => 3,
'debugclassloader.php' => 3,
'starrating.php' => 3,
'mapclassloader.php' => 3,
'growlasset.php' => 3,
'whois.gtld.onlinenic.php' => 3,
'whois.gtld.opensrs.php' => 3,
'whois.gtld.ovh.php' => 3,
'whois.gtld.php' => 3,
'whois.cl.php' => 3,
'whois.ch.php' => 3,
'scrollup.php' => 3,
'boleto_banestes.php' => 3,
'boleto_cef_sigcb.php' => 3,
'boleto_cef.php' => 3,
'boleto_bradesco.php' => 3,
'boleto_besc.php' => 3,
'scdatetimepickerbundle.php' => 3,
'regex.php' => 3,
'notificationevents.php' => 3,
'boleto_bb.php' => 3,
'boleto_banespa.php' => 3,
'boleto_hsbc.php' => 3,
'boleto_bancoob.php' => 3,
'boleto cef - contra apresentacao.zip' => 3,
'functions' => 3,
'ftpexception.php' => 3,
'rresque.php' => 3,
'smarty.class.php' => 3,
'entitytrait.php' => 3,
'qrbitstream.php' => 3,
'boleto_cef_sinco.php' => 3,
'run_test.sh' => 3,
'qrconst.php' => 3,
'tsmarty2c.1' => 3,
'awssdk.php' => 3,
'dynamicindex.php' => 3,
'changelog-3.2' => 3,
'tables.sql' => 3,
'bootstraptrait.php' => 3,
'boleto_unibanco.php' => 3,
'block.t.php' => 3,
'function.locale.php' => 3,
'boleto_sudameris.php' => 3,
'boleto_itau.php' => 3,
'boleto_sofisa.php' => 3,
'readme2' => 3,
'boleto_sicredi.php' => 3,
'controllerlistener.php' => 3,
'boleto_santander_banespa.php' => 3,
'boleto_real.php' => 3,
'travis-php-config.ini' => 3,
'package-container.yml' => 3,
'boleto_nossacaixa.php' => 3,
'qrconfig.php' => 3,
'qrencode.php' => 3,
'whois.cat.php' => 3,
'whois.at.php' => 3,
'whois.ae.php' => 3,
'sqldatabase.php' => 3,
'whois.aero.php' => 3,
'sqlstatement.php' => 3,
'whois.ag.php' => 3,
'module_creation' => 3,
'whois.am.php' => 3,
'whois.asia.php' => 3,
'whois.au.php' => 3,
'example.cli.php' => 3,
'whois.be.php' => 3,
'whois.bh.php' => 3,
'endpoint-cors.php' => 3,
'install_archive' => 3,
'whois.biz.php' => 3,
'timepickerasset.php' => 3,
'puppet.php' => 3,
'whois.br.php' => 3,
'whois.ca.php' => 3,
'npdata.ser' => 3,
'release_process' => 3,
'qrimage.php' => 3,
'stash.php' => 3,
'qrinput.php' => 3,
'qrlib.php' => 3,
'roles.php' => 3,
'qrmask.php' => 3,
'_manifest_exclude' => 3,
'ext_typoscript_constants' => 3,
'settings.yml' => 3,
'queueinterface.php' => 3,
'mobiledetect.php' => 3,
'handlers' => 3,
'qrrscode.php' => 3,
'qrspec.php' => 3,
'assertion.php' => 3,
'qrsplit.php' => 3,
'qrtools.php' => 3,
'soap.php' => 3,
'qrvect.php' => 3,
'ci_instance.php' => 3,
'adminmanager.php' => 3,
'whois.ip.lib.php' => 3,
'whois.ip.php' => 3,
'concepts' => 3,
'bootstrap-for-theme.php' => 3,
'simpleimage.php' => 3,
'migrate' => 3,
'header.jpg' => 3,
'fab.png' => 3,
'blank.html' => 3,
'fancyboxhelpersasset.php' => 3,
'yiit.php' => 3,
'baserepository.php' => 3,
'.svnignore' => 3,
'find.php' => 3,
'signature.php' => 3,
'readme_zh_cn' => 3,
'ckeditorwidgetasset.php' => 3,
'fosoauthserverbundle.php' => 3,
'ckeditortrait.php' => 3,
'modelbehavior.php' => 3,
'bolt' => 3,
'fssolrbundle.php' => 3,
'elements.html' => 3,
'validationasset.php' => 3,
'apigen.sh' => 3,
'dbtestcase.php' => 3,
'loggablebehavior.php' => 3,
'sso.php' => 3,
'memcachesasl.php' => 3,
'jstreeasset.php' => 3,
'not-gettexted.php' => 3,
'head.php' => 3,
'logtarget.php' => 3,
'debugasset.php' => 3,
'hackunit.php' => 3,
'es.php' => 3,
'imagecolor.php' => 3,
'notifyjsasset.php' => 3,
'pot-ext-meta.php' => 3,
'animatecssasset.php' => 3,
'highcharts.src.js' => 3,
'highcharts.js' => 3,
'highcharts-more.src.js' => 3,
'highcharts-more.js' => 3,
'nav.tpl' => 3,
'uploadify.php' => 3,
'fullcalendarwidget.php' => 3,
'notrixmailerloopbundle.php' => 3,
'datatablestabletoolsasset.php' => 3,
'trends.php' => 3,
'write.php' => 3,
'watcher.php' => 3,
'readwrite.php' => 3,
'datetimehelper.php' => 3,
'indexaction.php' => 3,
'spam.php' => 3,
'backup.php' => 3,
'folder.php' => 3,
'build.js' => 3,
'read.php' => 3,
'generic.php' => 3,
'bucket.php' => 3,
'insert.php' => 3,
'ticket.php' => 3,
'serve.php' => 3,
'tile.png' => 3,
'phpunit.xml.sample' => 3,
'herzultforumbundle.php' => 3,
'phpunit_sqlite.xml' => 3,
404 => 3,
'variable.php' => 3,
'htmlhelper.php' => 3,
'docker-entrypoint.sh' => 3,
'run_phpcs.sh' => 3,
'composer-install.sh' => 3,
'.gitsplit.yml' => 3,
'raindroproutingbundle.php' => 3,
'phrozn.png' => 3,
'scheme.php' => 3,
'instagramwidget.php' => 3,
'notyasset.php' => 3,
'languages.php' => 3,
'composer.dev.json' => 3,
'dir.php' => 3,
'textcat.php' => 3,
'docker-compose.yml.sample' => 3,
'vk.php' => 3,
'mime.types' => 3,
'install_phalcon.sh' => 3,
'debug.tpl' => 3,
'phpunit-integration.xml.dist' => 3,
'makepot.php' => 3,
'sort.php' => 3,
'whois.ip.ripe.php' => 3,
'whois.servers.php' => 3,
'whois.pro.php' => 3,
'whois.pt.php' => 3,
'whois.re.php' => 3,
'whois.ro.php' => 3,
'whois.ru.php' => 3,
'whois.rwhois.php' => 3,
'whois.sc.php' => 3,
'whois.se.php' => 3,
'whois.si.php' => 3,
'whois.pl.php' => 3,
'whois.su.php' => 3,
'whois.tel.php' => 3,
'whois.travel.php' => 3,
'whois.uk.php' => 3,
'whois.us.php' => 3,
'whois.utils.php' => 3,
'whois.ve.php' => 3,
'whois.wf.php' => 3,
'whois.pm.php' => 3,
'whois.parser.php' => 3,
'whois.xxx.php' => 3,
'whois.main.php' => 3,
'scrollupasset.php' => 3,
'whois.ir.php' => 3,
'whois.is.php' => 3,
'whois.it.php' => 3,
'whois.jp.php' => 3,
'whois.lt.php' => 3,
'whois.lu.php' => 3,
'whois.ly.php' => 3,
'whois.me.php' => 3,
'whois.org.za.php' => 3,
'whois.mobi.php' => 3,
'whois.museum.php' => 3,
'whois.mx.php' => 3,
'whois.name.php' => 3,
'whois.nl.php' => 3,
'whois.nu.php' => 3,
'whois.nz.php' => 3,
'whois.org.php' => 3,
'imdb.class.php' => 3,
'whois.ws.php' => 3,
'maskmoney.php' => 3,
'redactormodule.php' => 3,
'macros.twig' => 3,
'pdf_parser.php' => 3,
'sandbox' => 3,
'themedefaultasset.php' => 3,
'colorbox.php' => 3,
'themeclassicasset.php' => 3,
'themebootstrapasset.php' => 3,
'emongoclient.php' => 3,
'emongocriteria.php' => 3,
'emongodataprovider.php' => 3,
'fpdi_pdf_parser.php' => 3,
'emongodocument.php' => 3,
'emongoexception.php' => 3,
'emongofile.php' => 3,
'emongologroute.php' => 3,
'metatags.php' => 3,
'emongomodel.php' => 3,
'emongosort.php' => 3,
'codeigniter' => 3,
'stats' => 3,
'pdf_context.php' => 3,
'fpdi.php' => 3,
'whois.yt.php' => 3,
'bowerassets.php' => 3,
'whois.zanet.php' => 3,
'markdowneditorasset.php' => 3,
'coverage.php' => 3,
'team' => 3,
'foqelasticabundle.php' => 3,
'phar-manifest.php' => 3,
'juiasset.php' => 3,
'arraycollection.php' => 3,
'domain.php' => 3,
'scope.php' => 3,
'phpunit.xml.nocoverage' => 3,
'unit_tests.php' => 3,
'forms.php' => 3,
'loader.gif' => 3,
'.ethna' => 3,
'test.sql' => 3,
'notfoundexception.php' => 3,
'wishlist.php' => 3,
'restclient.php' => 3,
'css.php' => 3,
'whois.fm.php' => 3,
'jcropasset.php' => 3,
'connectionresolverinterface.php' => 3,
'desktop.ini' => 3,
'masonryasset.php' => 3,
'cssmin.php' => 3,
'compare.php' => 3,
'exampleconfig.xml' => 3,
'connectionresolver.php' => 3,
'databasemanager.php' => 3,
'datepickerlanguageasset.php' => 3,
'go.php' => 3,
'phpunit.integration.xml' => 3,
'mysqlconnection.php' => 3,
'postgresconnection.php' => 3,
'queryexception.php' => 3,
'sqliteconnection.php' => 3,
'appasset.php' => 3,
'strings.php' => 3,
'sqlserverconnection.php' => 3,
'build-phar.sh' => 3,
'test_nbbc.php' => 3,
'jsonview.php' => 3,
'deployment.sample.ini' => 3,
'upgrade 2.2' => 3,
'upgrade 2.1' => 3,
'dbconnectioninterface.php' => 3,
'dbquery.php' => 3,
'magnificpopupasset.php' => 3,
'genemuformbundle.php' => 3,
'oldsoundrabbitmqbundle.php' => 3,
'dbqueryinterface.php' => 3,
'changelog 2.2' => 3,
'changelog 2.1' => 3,
'sonatablockbundle.php' => 3,
'curler.php' => 3,
'seedserviceprovider.php' => 3,
'sharedhostinstall' => 3,
'powered_by_nbbc_small.png' => 3,
'sample_distributed.php' => 3,
'sample_asn-v6.php' => 3,
'gameq.php' => 3,
'row.php' => 3,
'sample_city-v6.php' => 3,
'sample_city.php' => 3,
'class.xsl' => 3,
'.php.ini' => 3,
'sample-v6.php' => 3,
'importbundle.php' => 3,
'routes.yml' => 3,
'gearmanbundle.php' => 3,
'multi.php' => 3,
'sample_netspeed.php' => 3,
'index.html.twig' => 3,
'sidebar.xsl' => 3,
'geoipregionvars.php' => 3,
'aliyunoss.php' => 3,
'koowa-component.xml' => 3,
'introjsasset.php' => 3,
'ohinstagrambundle.php' => 3,
'mellatbank.php' => 3,
'module.js' => 3,
'config.ini.dist' => 3,
'config-dist.php' => 3,
'apydatagridbundle.php' => 3,
'geoipcity.inc' => 3,
'lexiktranslationbundle.php' => 3,
'project.php' => 3,
'datatable.php' => 3,
'bcrypt.php' => 3,
'whiteoctoberswiftmailerdbbundle.php' => 3,
'license-gpl3' => 3,
'geoip.inc' => 3,
'resourceevents.php' => 3,
'powered_by_nbbc.png' => 3,
'sample_org.php' => 3,
'codemirror.php' => 3,
'serviceproviderinterface.php' => 3,
'resultaction.php' => 3,
'sonatadoctrineormadminbundle.php' => 3,
'entityexception.php' => 3,
'eventmanagertrait.php' => 3,
'successaction.php' => 3,
'phpunit-coverage.xml.dist' => 3,
'failaction.php' => 3,
'odnoklassniki.php' => 3,
'apache-license-2.0' => 3,
'init.deployment.php' => 3,
'besimplessoauthbundle.php' => 3,
'promise.php' => 3,
'sample.db' => 3,
'ivorylucenesearchbundle.php' => 3,
'example.jpg' => 3,
'servicemanager.php' => 3,
'bundle-skel' => 3,
'nestedsetquery.php' => 3,
'toastrasset.php' => 3,
'create.bat' => 3,
'spark' => 3,
'select2action.php' => 3,
'playbook.yml' => 3,
'jsonld.php' => 3,
'delegate.php' => 3,
'notifierinterface.php' => 3,
'ip.php' => 3,
'install_vendors.sh' => 3,
'robo' => 3,
'annotations.php' => 3,
'baseaction.php' => 3,
'cacheexception.php' => 3,
'io.php' => 3,
'elfinderconnectoraction.php' => 3,
'mpdfexception.php' => 3,
'nestedset.php' => 3,
'pnotify.php' => 3,
'dotenv.php' => 3,
'phpdoc' => 3,
'sami-config.inc.php' => 3,
'mediainterface.php' => 3,
'subnav.php' => 3,
'help.sh' => 3,
'.readme.md.swp' => 3,
'how' => 3,
'padam87attributebundle.php' => 3,
'seo.php' => 3,
'ipgeobase.php' => 3,
'wheel' => 3,
'sgdatatablesbundle.php' => 3,
'cite.bib' => 3,
'crontab.php' => 3,
'tinymcecompressoraction.php' => 3,
'phpunitbootstrap.php' => 3,
'maintenancemode.php' => 3,
'meetup.php' => 3,
'cleantalk.class.php' => 3,
'paceasset.php' => 3,
'.env.sample' => 3,
'widgetinterface.php' => 3,
'duallistbox.php' => 3,
'binary.php' => 3,
'cartactionevent.php' => 3,
'cartpositioninterface.php' => 3,
'cartpositionproviderinterface.php' => 3,
'cartpositiontrait.php' => 3,
'costcalculationevent.php' => 3,
'serverfileinput.php' => 3,
'discountbehavior.php' => 3,
'sample_netspeedcell.php' => 3,
'underscore.php' => 3,
'cooptilleulsckeditorsonatamediabundle.php' => 3,
'cutterasset.php' => 3,
'ext.js' => 3,
'leaf.php' => 3,
'timeagoasset.php' => 3,
'test-dist.ini' => 3,
'changelog-1.3' => 3,
'.htneatindex' => 3,
'sonus.sublime-workspace' => 3,
'addcommands.php' => 3,
'pest.php' => 3,
'adapter.php' => 3,
'cutter.php' => 3,
'deploy.ini' => 3,
'redirectresponse.php' => 3,
'input.php' => 3,
'ext-dev.js' => 3,
'autotest_watchr.rb' => 3,
'package.pear' => 3,
'.htrouter.php' => 3,
'test.xml' => 3,
'tinymceelfinder.php' => 3,
'entrypoint.sh' => 3,
'stripe.php' => 3,
'controllerdispatcher.php' => 3,
'krumo.sample.ini' => 3,
'gerrit.json' => 3,
'ext-debug.js' => 3,
'composer.laravel.json' => 3,
'ext-all-debug-w-comments.js' => 3,
'ext-all-debug.js' => 3,
'.rspec' => 3,
'firewall.php' => 3,
'ext-all-dev.js' => 3,
'ext-debug-w-comments.js' => 3,
'quickbase.php' => 3,
'pestjson.php' => 3,
'altorouter.php' => 3,
'abstractextension.php' => 3,
'changlog' => 3,
'web.php' => 3,
'runtests.php' => 3,
'generatepackage.php' => 3,
'evn.sh' => 3,
'config.dist.json' => 3,
'twilio.php' => 3,
'img.php' => 3,
'ru2ftwofactorbundle.php' => 3,
'phpunit.idea.xml' => 3,
'print.php' => 3,
'windowsazuredistributionbundle.php' => 3,
'data.json' => 3,
'soundcloud.php' => 3,
'classes.php' => 3,
'configs.php' => 3,
'pestxml.php' => 3,
'eventlistener.php' => 3,
'sonus.sublime-project' => 3,
'resumable_example.php' => 3,
'multiprocessing_example.php' => 3,
'readme.zh-cn' => 3,
'coveralls.json' => 3,
'authorizenet.php' => 3,
'chartasset.php' => 3,
'instagram.php' => 3,
'akismet.php' => 3,
'example_form.php' => 3,
'serializerawareinterface.php' => 3,
'bootstraprtlasset.php' => 3,
'readme_zh' => 3,
'phpunit-ms.xml.dist' => 3,
'cacheserviceprovider.php' => 3,
'elfinderwidget.php' => 3,
'mock.php' => 3,
'sample_region.php' => 3,
'review-1.3' => 3,
'sonatapagebundle.php' => 3,
'hooker.json' => 3,
'jqueryasset.php' => 3,
'readme.mediawiki' => 3,
'tests.html' => 3,
'review-1.5' => 3,
'php.html' => 3,
'memberlist.php' => 3,
'errorhandlertrait.php' => 3,
'instructions.html' => 3,
'smartyengine.php' => 3,
'apache.html' => 3,
'pharbuilder.php' => 3,
'donate' => 3,
'release notes' => 3,
'casperjs.php' => 3,
'options_user_settings_set.php' => 3,
'pre-commit.sample' => 3,
'requirements_check.php' => 3,
'fontawesomeassets.php' => 3,
'oembedserviceprovider.php' => 3,
'codeception.travis.yml' => 3,
'oembed.php' => 3,
'ioniconassets.php' => 3,
'thumblib.inc.php' => 3,
'jqwidgetsasset.php' => 3,
'.agignore' => 3,
'thumbbase.inc.php' => 3,
'tmplasset.php' => 3,
'phpthumb.inc.php' => 3,
'exampleusage.php' => 3,
'gdthumb.inc.php' => 3,
'consolebundle.php' => 3,
'htmltag.php' => 3,
'cookbook' => 3,
'.howiattributes' => 3,
'test1.php' => 3,
'systeminfo.php' => 3,
'catalog.xml' => 3,
'alidatatablebundle.php' => 3,
'swiftmailsystem.php' => 3,
'master.twig' => 3,
'matcherinterface.php' => 3,
'fileuploadasset.php' => 3,
'composer.json.bak' => 3,
'readme.upgrading' => 3,
'readme.providers' => 3,
'readme.provider-guide' => 3,
'sonatadatagridbundle.php' => 3,
'httprequest.php' => 3,
'vagrant-provision.sh' => 3,
'read.me' => 3,
'passwordgenerator.php' => 3,
'providers.php' => 3,
'dateintervalbundle.php' => 3,
'tables.php' => 3,
'test,json' => 3,
'coding_standards' => 3,
'create.php' => 3,
'bootstrap-root.sh' => 3,
'dao.php' => 3,
'ivoryckeditorbundle.php' => 3,
'docmd.json' => 3,
'appkernel.php' => 3,
'manifest.in' => 3,
'doxygen.config' => 3,
'gssdk.php' => 3,
'cell.php' => 3,
'holamon.php' => 3,
'web_package.info' => 3,
'.parameters.php' => 3,
'kint.class.php' => 3,
'normalizer.php' => 3,
'webtools.php' => 3,
'common.xml' => 3,
'nestable.php' => 3,
'sniff.php' => 3,
'haanga-cli.php' => 3,
'baseasset.php' => 3,
'authmodule.php' => 3,
'miniond' => 3,
'samiconfig.php' => 3,
'bootstrap_all_modules.php' => 3,
'example.phpunit.xml' => 3,
'index.php.example' => 3,
'composer_release_notes' => 3,
'bootstrapinterface.php' => 3,
'inheritance_release_notes' => 3,
'new_features' => 3,
'datasource.php' => 3,
'asseticbundle.php' => 3,
'phalcon.sh' => 3,
'doctrine' => 3,
'ajaxfilter.php' => 3,
'a.php' => 3,
'upgrade-1.8' => 3,
'.exrc' => 3,
'arc2_getpreferredformat.php' => 3,
'apikey-dist.php' => 3,
'arc2_getformat.php' => 3,
'arc2_resource.php' => 3,
'arc2_reader.php' => 3,
'amazonwebservicesfactory.php' => 3,
'amazonwebservices.php' => 3,
'trsteelckeditorbundle.php' => 3,
'fabfile.py' => 3,
'phpunit.oauth1.xml' => 3,
'arc2.php' => 3,
'extract.php' => 3,
'rss2.php' => 3,
'rss1.php' => 3,
'atom.php' => 3,
'packagist.php' => 3,
'events' => 3,
'example.config.php' => 3,
'phpunit.ci.xml' => 3,
'multiselectasset.php' => 3,
'_tests_boostrap.php' => 3,
'pmdrules.xml' => 3,
'hello_world.php' => 3,
'php-git-hooks.yml.sample' => 3,
'registrationinterface.php' => 3,
'userinterface.php' => 3,
'tinymcelangasset.php' => 3,
'coresphereconsolebundle.php' => 3,
'widophttpadapterbundle.php' => 3,
'datagrid.php' => 3,
'defaultvaluesupplier.php' => 3,
'resourceregistrar.php' => 3,
'doctrinemigrationsbundle.php' => 3,
'upgrade-4.0' => 3,
'twittercard.php' => 3,
'install.json' => 3,
'abstractlogger.php' => 3,
'braintree.php' => 3,
'generatorinterface.php' => 3,
'countrycodetoregioncodemapfortesting.php' => 3,
'di.php' => 3,
'cleanup.sh' => 3,
'containerawareinterface.php' => 3,
'arc2_class.php' => 3,
'failedjob.php' => 3,
'querybuilderinterface.php' => 3,
'nbt' => 3,
'autounit' => 3,
'zend-license' => 3,
'angularanimateasset.php' => 3,
'placeholder.php' => 3,
'agpl' => 3,
'.htaccess.example' => 3,
'whiteoctoberpagerfantabundle.php' => 3,
'phpunit.autoload.php.dist' => 3,
'datamapperinterface.php' => 3,
'qywechat.php' => 3,
'uploadevents.php' => 3,
'mpwechat.php' => 3,
'content-link.php' => 3,
'tracker.php' => 3,
'hash.php' => 3,
'sample.html' => 3,
'requireasset.php' => 3,
'httpkernel.php' => 3,
'forminterface.php' => 3,
'formexception.php' => 3,
'liuggioexcelbundle.php' => 3,
'check.sh' => 3,
'js_localize.php' => 3,
'global.js' => 3,
'lock.php' => 3,
'bag.php' => 3,
'selection.json' => 3,
'cronbundle.php' => 3,
'filegetcontentsloader.php' => 3,
'maintenance.php' => 3,
'example.sh' => 3,
'search.html' => 3,
'phar.php' => 3,
'readme-pt_br' => 3,
'expressionfunction.php' => 3,
'tasks.xml' => 3,
'expressionfunctionproviderinterface.php' => 3,
'parsedexpression.php' => 3,
'menusserviceprovider.php' => 3,
'menuitem.php' => 3,
'serializedparsedexpression.php' => 3,
'syntaxerror.php' => 3,
'.todo' => 3,
'tokenstream.php' => 3,
'menufacade.php' => 3,
'widgets.php' => 3,
'rmspushnotificationsbundle.php' => 3,
'punkavefileuploaderbundle.php' => 3,
'control_registry.inc.php' => 3,
'angularrouteasset.php' => 3,
'toggle.php' => 3,
'chatlibasset.php' => 3,
'chatwidget.php' => 3,
'tpgextjsbundle.php' => 3,
'amchartasset.php' => 3,
'commands.php' => 3,
'stringutils.php' => 3,
' changelog' => 3,
'detect.php' => 3,
'fxpassetplugin.php' => 3,
'assetevents.php' => 3,
'abstractclient.php' => 3,
'phpunit.xml.dev' => 3,
'.classpath' => 3,
'createphar.php' => 3,
'wp-cli.php' => 3,
'modalasset.php' => 3,
'modelinterface.php' => 3,
'abstractpaginator.php' => 3,
'raw.sql' => 3,
'formtest.php' => 3,
'lengthawarepaginator.php' => 3,
'bootstrapthreepresenter.php' => 3,
'config.sample' => 3,
'urlinterface.php' => 3,
'migration' => 3,
'bootstrapthreenextpreviousbuttonrenderertrait.php' => 3,
'cachetrait.php' => 3,
'kindeditorcontroller.php' => 3,
'travis-init.sh' => 3,
'urlwindow.php' => 3,
'migrationgenerator.php' => 3,
'memcachedconnector.php' => 3,
'.php-cs' => 3,
'generate-doc' => 3,
'omnipaybundle.php' => 3,
'phpmd_rules.xml' => 3,
'inspectations.xml' => 3,
'invalidargumentexception.php' => 3,
'mdruleset.xml' => 3,
'phpfastcache.php' => 3,
'cmd.php' => 3,
'imageinterface.php' => 3,
'jmstranslationbundle.php' => 3,
'phalcon.bat' => 3,
'.env.local.php' => 3,
'phalcon.php' => 3,
'prove.php' => 3,
'test2.php' => 3,
'phalcon.pear' => 3,
'memcache.php' => 3,
'translatorinterface.php' => 3,
'abstractdriver.php' => 3,
'returnurl.php' => 3,
'dbexception.php' => 3,
'phalcon-completion.bash' => 3,
'apidoc.json' => 3,
'thrift_protocol.ini' => 3,
'readme.apache' => 3,
'plugins.php' => 3,
'yuicompressor-2.4.8.jar' => 3,
'generate-package.php' => 3,
'pom.xml.dist' => 3,
'regexp.php' => 3,
'makefile-neam' => 3,
'gplv3' => 3,
'urlwindowpresentertrait.php' => 3,
'.gtignore' => 3,
'useragent.php' => 3,
'simplebootstrapthreepresenter.php' => 3,
'makepackage.php' => 3,
'scanner.php' => 3,
'serverinterface.php' => 3,
'oss.php' => 3,
'yiiwheels.php' => 3,
'filesysteminterface.php' => 3,
'content-page.php' => 3,
'standard' => 3,
'example.composer.json' => 3,
'elfinder.html' => 3,
'prestacmssandboxbundle.php' => 2,
'twocheckoutadapter.php' => 2,
'twocheckout.php' => 2,
'lincense' => 2,
'kcfinderwidgetasset.php' => 2,
'config.codekit' => 2,
'sami.phar' => 2,
'kcfinderinputwidget.php' => 2,
'benchmark' => 2,
'kcfinder.php' => 2,
'phpbu.xml.sample' => 2,
'example.json' => 2,
'ccdncomponentcrumbtrailbundle.php' => 2,
'twocheckoutcharge.php' => 2,
'install-apigen.sh' => 2,
'flag.php' => 2,
'tinymce.gzip.php' => 2,
'screenshot.gif' => 2,
'twocheckoutmessage.php' => 2,
'twocheckoutnotification.php' => 2,
'install-apigen.sh.bat' => 2,
'push-docs-to-gh-pages.sh' => 2,
'yuccaprerenderbundle.php' => 2,
'adminltepluginasset.php' => 2,
'errors.json' => 2,
'twocheckoutreturn.php' => 2,
'entitymanagerinterface.php' => 2,
'push.sh' => 2,
'fkrcssurlrewritebundle.php' => 2,
'newscoopfacebookmetabundle.php' => 2,
'mailqueue.php' => 2,
'migrationmodule.php' => 2,
'functions.sh' => 2,
'bc-mapi.php' => 2,
'remoteserviceprovider.php' => 2,
'remotemanager.php' => 2,
'multiconnection.php' => 2,
'elfindervolumeflysystem.php' => 2,
'config.dist.ini' => 2,
'run_phpcs_experiment.php' => 2,
'resourcecontroller.php' => 2,
'colorboxasset.php' => 2,
'bc-mapi-cache.php' => 2,
'multipleselectasset.php' => 2,
'filemodel.php' => 2,
'.labname' => 2,
'cloner.php' => 2,
'seclibgateway.php' => 2,
'commentsmodule.php' => 2,
'trustyserviceprovider.php' => 2,
'addtrustexternalcaroot.crt' => 2,
'command_classes.php' => 2,
'anvil.php' => 2,
'yaml_translation_patterns.yml' => 2,
'cps_api.php' => 2,
'cps_simple.php' => 2,
'trusty.php' => 2,
'.atoum.coverage.php' => 2,
'validatorserviceprovider.php' => 2,
'.lgtm' => 2,
'lgpl-license' => 2,
'_autoload.php' => 2,
'tagsinput.php' => 2,
'tagsinputasset.php' => 2,
'coveralls.yml' => 2,
'documentation.config.xml' => 2,
'daemoncontroller.php' => 2,
'keys.php' => 2,
'event.js' => 2,
'multipleselect.php' => 2,
'baseyii.php' => 2,
'intltelinputasset.php' => 2,
'matrix.php' => 2,
'uploadcare.php' => 2,
'datacolumn.php' => 2,
'vreshtwiliobundle.php' => 2,
'filesbehavior.php' => 2,
'set_guzzle5.sh' => 2,
'template.js' => 2,
'config.inc.php.sample' => 2,
'screenshot1.jpg' => 2,
'ueditorcontroller.php' => 2,
'fatalerrorexception.php' => 2,
'magic.php' => 2,
'game.php' => 2,
'colorpickerwidget.php' => 2,
'xlsview.php' => 2,
'easyimageasset.php' => 2,
'phpzone.yml' => 2,
'ueditorwidget.php' => 2,
'uploadifyaction.php' => 2,
'uploadcropasset.php' => 2,
'uploadcrop.php' => 2,
'inarrayvalidator.php' => 2,
'.hound.yml' => 2,
'documentfactoryinterface.php' => 2,
'preview.php' => 2,
'defaultdocumentfactory.php' => 2,
'statistics.php' => 2,
'widgetmanager.php' => 2,
'prompts.json' => 2,
'dsl_config.dist' => 2,
'tikaapp.php' => 2,
'readmegen' => 2,
'soqratehtml2pdfbundle.php' => 2,
'openpayu.php' => 2,
'unitpay.php' => 2,
'readmegen.yml' => 2,
'phpbu' => 2,
'b2_api.php' => 2,
'iso4217test.php' => 2,
'newscoopeditorbundle.php' => 2,
'coverage.sh' => 2,
'ajax.js' => 2,
'validatorexception.php' => 2,
'fnactivefield.php' => 2,
'curlchannel.php' => 2,
'note.json' => 2,
'checklicense.php' => 2,
'frequencewebcalendrbundle.php' => 2,
'cjson.php' => 2,
'stfalcontinymcebundle.php' => 2,
'liipimaginebundle.php' => 2,
'annotationreader.php' => 2,
'phinx.dist.yml' => 2,
'recaptchalib.php' => 2,
'containerloader.php' => 2,
'rcserviredbundle.php' => 2,
'iso4217.php' => 2,
'httpkernelinterface.php' => 2,
'coverage.yml' => 2,
'migrationmanager.php' => 2,
'weixin.php' => 2,
'peridot.coverage.php' => 2,
'nginx.sample.conf' => 2,
'send24.php' => 2,
'config.php.sample' => 2,
'clientjson.php' => 2,
'angular-resource.min.js' => 2,
'upyun.class.php' => 2,
'qrcode.class.php' => 2,
'stageinterface.php' => 2,
'exceptionserviceprovider.php' => 2,
'.phptidy-config.php' => 2,
'composerextension.php' => 2,
'jorobo.dist.ini' => 2,
'jorobo.ini' => 2,
'config.yaml.dist' => 2,
'backbee' => 2,
'angular-resource.js' => 2,
'yo.php' => 2,
'jquery-ui.min.js' => 2,
'php' => 2,
'emigratecommand.php' => 2,
'docker-compose-example.yml' => 2,
'pear5.php' => 2,
'serializeattributeexception.php' => 2,
'deserializeattributeexception.php' => 2,
'payubundle.php' => 2,
'ccdncomponentbbcodebundle.php' => 2,
'readme.wiki' => 2,
'memberserviceprovider.php' => 2,
'.docgen' => 2,
'emailaddressvalidator.php' => 2,
'gatewayfactory.php' => 2,
'readme-laravel' => 2,
'webmoney.php' => 2,
'angular-route.js' => 2,
'ext-theme-classic-sandbox.js' => 2,
'membertab.php' => 2,
'upgrade-2.0.0' => 2,
'listview.php' => 2,
'options_user_settings.php' => 2,
'ckeditorwidget.php' => 2,
'slyrelationbundle.php' => 2,
'extdirectbundle.php' => 2,
'makefile.docker' => 2,
'class.phpmaileroauthgoogle.php' => 2,
'deploy.example.php' => 2,
'runtime.php' => 2,
'class.phpmaileroauth.php' => 2,
'editableaction.php' => 2,
'csvview.php' => 2,
'languarasymfonybundle.php' => 2,
'sendgrid_loader.php' => 2,
'gateway.php' => 2,
'stat.php' => 2,
'ccdnforumadminbundle.php' => 2,
'sendgrid.php' => 2,
'readonly.php' => 2,
'sake' => 2,
'colorpickerasset.php' => 2,
'fpjsformvalidatorbundle.php' => 2,
'ccdncomponentcommonbundle.php' => 2,
'main.php5' => 2,
'cli-script.php' => 2,
'readme_composerinstall' => 2,
'.htaccess.original' => 2,
'extender.php' => 2,
'zayassborisbundle.php' => 2,
'solrinterface.php' => 2,
'autogitpull.sublime-project' => 2,
'get_oauth_token.php' => 2,
'pagesize.php' => 2,
'lisezmoi.mkd' => 2,
'externallib.php' => 2,
'serializedattributes.php' => 2,
'_read_me' => 2,
'channelinterface.php' => 2,
'shortcode.php' => 2,
'phpbu.xsd' => 2,
'tokenizer.php' => 2,
'baseform.php' => 2,
'bootstrapevents.php' => 2,
'restbundle.php' => 2,
'multilanguagebehavior.php' => 2,
'apiquery.php' => 2,
'ajaxform.php' => 2,
'deploy_cfg.sh.init' => 2,
'singleasset.php' => 2,
'multipleasset.php' => 2,
'countries.php' => 2,
'multilanguagehelper.php' => 2,
'confighelper.php' => 2,
'.module.php' => 2,
'docs.ini' => 2,
'deploy_cfg.sh.travis' => 2,
'command' => 2,
'super-cpt.php' => 2,
'ccdncomponentdashboardbundle.php' => 2,
'devicedetector.php' => 2,
'conf.json' => 2,
'.scrutiizer.yml' => 2,
'extend_doc' => 2,
'caxyelasticsearchbundle.php' => 2,
'readme-pt-br' => 2,
'example_debug.png' => 2,
'developer' => 2,
'phpsigepfpdf.php' => 2,
'servicecontainer.php' => 2,
'tableview.php' => 2,
'abstractfixture.php' => 2,
'exporterview.php' => 2,
'multilanguagetrait.php' => 2,
'_lisez_moi' => 2,
'phploy.bat' => 2,
'bootswatchasset.php' => 2,
'staffimrollbarbundle.php' => 2,
'phpunit-mysql.xml' => 2,
't3jquery' => 2,
'rollbarreporter.php' => 2,
'phploy.php' => 2,
'schebtwofactorbundle.php' => 2,
'tests' => 2,
'assetmanagerinterface.php' => 2,
'reportdecisionmanager.php' => 2,
'jquerycookieasset.php' => 2,
'runphpunittests.sh' => 2,
'angular-route.min.js' => 2,
'html2pdf.php' => 2,
'admin_tools.php' => 2,
'fnactiveform.php' => 2,
'excelformatter.php' => 2,
'subscriber.php' => 2,
'adminer.css' => 2,
'multilanguageurlmanager.php' => 2,
'kwattromarkdownbundle.php' => 2,
'kernelevents.php' => 2,
'database_mysql.sql' => 2,
'.travis-build.sh' => 2,
'dates.php' => 2,
1 => 2,
'json_io.php' => 2,
'magnificpopup.php' => 2,
'head' => 2,
'ccdncomponentattachmentbundle.php' => 2,
'easyuiasset.php' => 2,
'credentials.json' => 2,
'bindinginterface.php' => 2,
'index.php.bak' => 2,
'reflected_runner.php' => 2,
'observer.php' => 2,
'svggraphdatalabels.php' => 2,
'svggraphcolours.php' => 2,
'svggraphbarandlinegraph.php' => 2,
'importinterface.php' => 2,
'dynamicformbundle.php' => 2,
'phpunit_pgsql.xml' => 2,
'bootstrapbundle.php' => 2,
'drupal-ti' => 2,
'pdfresponseformatter.php' => 2,
'ansible.cfg' => 2,
'baseconverter.php' => 2,
'makefile.in' => 2,
'glorpenpropelbundle.php' => 2,
'grunt-menu.sh' => 2,
'locationpickerasset.php' => 2,
'multiselectwidget.php' => 2,
'readme_zh-cn' => 2,
'.vagrant' => 2,
'portlet.php' => 2,
'sparklineasset.php' => 2,
'wsdlgenerator.php' => 2,
'webservice.php' => 2,
'select2widget.php' => 2,
'knobasset.php' => 2,
'class-plugin.php' => 2,
'jcropwidget.php' => 2,
'grunt-installer.sh' => 2,
'waveform.php' => 2,
'consulta' => 2,
'ohformerrorlogbundle.php' => 2,
'readme_1' => 2,
'filecontroller.php' => 2,
'menubundle.php' => 2,
'watcher' => 2,
'nestableasset.php' => 2,
'config.json.sample' => 2,
'phar-cli-stub.php' => 2,
'phphelper.php' => 2,
'slickwidget.php' => 2,
'generate_package_xml.php' => 2,
'.pharcc.yml' => 2,
'convention.php' => 2,
'ci.sh' => 2,
'added info fonts' => 2,
'container.xml' => 2,
'simplecache.php' => 2,
'readme_fr' => 2,
'tadckatreeevents.php' => 2,
'autoload.php-dist' => 2,
'ldap.php' => 2,
'filename.sql' => 2,
'apex' => 2,
'pusher.php' => 2,
'readme.pdf' => 2,
'flintlabsformmetadatabundle.php' => 2,
'release-1.0.0' => 2,
'highlightjsasset.php' => 2,
'notificacao' => 2,
'package.png' => 2,
'syntaxhighlighter.php' => 2,
'emailer.php' => 2,
'amqplibconnector.php' => 2,
'amqp.php' => 2,
'.nojekyll' => 2,
'how-to' => 2,
'constraintvalidatorfactory.php' => 2,
'apimodule.php' => 2,
'twigengine.php' => 2,
'yiinewrelic.php' => 2,
'yiinewrelicclientscript.php' => 2,
'picture.png' => 2,
'fieldinterface.php' => 2,
'init.sql' => 2,
'.vimproject' => 2,
'.phpspec.yml' => 2,
'plugin.png' => 2,
'clean' => 2,
'region.php' => 2,
'swiper.php' => 2,
'hierarchy.php' => 2,
'imgur.php' => 2,
'smsserviceinterface.php' => 2,
'.travis.yml.old' => 2,
'curlwrapper.php' => 2,
'bmatznerfoundationbundle.php' => 2,
'invalidconfigexception.php' => 2,
'travis.yaml' => 2,
'amqplibconnectorssl.php' => 2,
'requisicao_pagamento' => 2,
'param' => 2,
'flotasset.php' => 2,
'excanvasasset.php' => 2,
'gitmanager.sh' => 2,
'codemirrorwidget.php' => 2,
'restexception.php' => 2,
'admingeneratoruserbundle.php' => 2,
'ifilter.php' => 2,
'redisconnector.php' => 2,
'install_amqp.sh' => 2,
'bootstrap-media-lightbox.min.js' => 2,
'bootstrap-media-lightbox.less' => 2,
'forms' => 2,
'bootstrap-media-lightbox.js' => 2,
'array.php' => 2,
'bootstrap-media-lightbox.css' => 2,
'gauges.yml' => 2,
'ooyalaapi.php' => 2,
'tpredactorbundle.php' => 2,
'celery.php' => 2,
'sample-data.sql' => 2,
'plex.php' => 2,
'getid3core.php' => 2,
'routeproviderinterface.php' => 2,
'routecompilerinterface.php' => 2,
'routecompiler.php' => 2,
'amqppeclconnector.php' => 2,
'apns.php' => 2,
'apnsgcm.php' => 2,
'phpmqtt.php' => 2,
'knppiwikbundle.php' => 2,
'roller_xhprof.php' => 2,
'knpdisqusbundle.php' => 2,
'mcapi.class.php' => 2,
'sample.htaccess' => 2,
'propel.yaml' => 2,
'now.php' => 2,
'doxygen' => 2,
'knpmarkdownbundle.php' => 2,
'markdownparserinterface.php' => 2,
'phpunit-cov.xml' => 2,
'presentableinterface.php' => 2,
'knpmenubundle.php' => 2,
'bootstrapconfirmationasset.php' => 2,
'update.readme' => 2,
'abstractdocument.php' => 2,
'knpradbundle.php' => 2,
'knpsnappybundle.php' => 2,
'datetimeformatter.php' => 2,
'pagesbundle.php' => 2,
'composer.json.save' => 2,
'escaper.php' => 2,
'expr.php' => 2,
'record.php' => 2,
'updating' => 2,
'h2o.php' => 2,
'agent.php' => 2,
'support.readme' => 2,
'kitanoconnectionbundle.php' => 2,
'doctrine-extensions-mapping.xsd' => 2,
'bootstrapselectasset.php' => 2,
'owners' => 2,
'b' => 2,
'connectionmanager.php' => 2,
'panel.phtml' => 2,
'google-analytics-readme' => 2,
'ruleschecker.php' => 2,
'statementinterface.php' => 2,
'travis-ci-apache' => 2,
'association.php' => 2,
'associationcollection.php' => 2,
'tags.php' => 2,
'assetconverter.php' => 2,
'resultset.php' => 2,
'cacheevents.php' => 2,
'how-to-install' => 2,
'how-to-use' => 2,
'travisphp.ini' => 2,
'sync_data.py' => 2,
'tableregistry.php' => 2,
'db' => 2,
'imageuploadbehavior.php' => 2,
'main.css' => 2,
'phpdir.h' => 2,
'phpdir.c' => 2,
'path.h' => 2,
'path.c' => 2,
'kptivepaymentsipsbundle.php' => 2,
'fsidoctrineextensionsbundle.php' => 2,
'model.class.php' => 2,
'upgrade_from_ratchet' => 2,
'cmakelists' => 2,
'_aerospike_ide_helper.php' => 2,
'phpcs_rules.xml' => 2,
'videojsasset.php' => 2,
'apicontroller.php' => 2,
'modelhelper.php' => 2,
'bulutyazilimlocationbundle.php' => 2,
'kgstaticbundle.php' => 2,
'bulutyazilimfeedbackbundle.php' => 2,
'opcache.php' => 2,
'usersasset.php' => 2,
'routemanager.php' => 2,
'rollbar.php' => 2,
'curlhttp.php' => 2,
'wpcept' => 2,
'wpcept.bat' => 2,
'ext_icon.svg' => 2,
'.env.php' => 2,
'lswapicallerbundle.php' => 2,
'prestasonatagedmodoctrineextensionsbundle.php' => 2,
'refactor' => 2,
'twillio.php' => 2,
'lswmemcachebundle.php' => 2,
'offsitepaymentfactory.php' => 2,
'gcm.php' => 2,
'filehandler.php' => 2,
'zray.php' => 2,
'releasing' => 2,
'sami_config.php' => 2,
'googlecalendarasset.php' => 2,
'test.log' => 2,
'getstorage.php' => 2,
'upgrade-3.3' => 2,
'source' => 2,
'upgrade-3.4' => 2,
'lock.png' => 2,
'dns.php' => 2,
'kunstmaansentrybundle.php' => 2,
'datastore.php' => 2,
'domains.php' => 2,
'aceeditorasset.php' => 2,
'mailgun.php' => 2,
'twitter_client.json' => 2,
'whiteoctoberbreadcrumbsbundle.php' => 2,
'adjacencylistbehavior.php' => 2,
'materializedpathbehavior.php' => 2,
'builddocs.sh' => 2,
'upgrade-1.7' => 2,
'example_config.yml' => 2,
'whats_new' => 2,
'upgrade-1.6' => 2,
'geoip.php' => 2,
'passwordbehavior.php' => 2,
'.lin3s_cs.yml.dist' => 2,
'loginform.php' => 2,
'usermanager.php' => 2,
'dump.rdb' => 2,
'filereader.php' => 2,
'fieldset.php' => 2,
'cacheclientinterface.php' => 2,
'configurator.php' => 2,
'easythumbnail.php' => 2,
'easythumbnailimage.php' => 2,
'extendabletrait.php' => 2,
'errorstack.php' => 2,
'formevent.php' => 2,
'opencall.php' => 2,
'neklandfeedbundle.php' => 2,
'setterbuilder.php' => 2,
'imageservice.php' => 2,
'ss_upgrade_log' => 2,
'abstractevent.php' => 2,
'berylliumcachebundle.php' => 2,
'containerbuilder.php' => 2,
'filewriter.php' => 2,
'streamresponse.php' => 2,
'streamwriterinterface.php' => 2,
'streamwriterwrapper.php' => 2,
'readme-cn' => 2,
'accessor.php' => 2,
'util.js' => 2,
'processing.js' => 2,
'jquery.cookie.js' => 2,
'extendable.php' => 2,
'excanvas.min.js' => 2,
'theme.yaml' => 2,
'install_fr' => 2,
'extensionbase.php' => 2,
'confirm.js' => 2,
'phpspec-with-coverage.yml' => 2,
'networkserviceprovider.php' => 2,
'file-header.js' => 2,
'ext-theme-neptune.js' => 2,
'urlserviceprovider.php' => 2,
'ext-theme-gray.js' => 2,
'ext-theme-classic.js' => 2,
'graphinterface.php' => 2,
'ext-theme-access.js' => 2,
'ext-all-rtl.js' => 2,
'ext-all-rtl-dev.js' => 2,
'ext-all-rtl-debug.js' => 2,
'ext-all-rtl-debug-w-comments.js' => 2,
'mangopayevents.php' => 2,
'facebookstrategy.php' => 2,
'blockbuilder.php' => 2,
'vincetbootstrapformbundle.php' => 2,
'extensiontrait.php' => 2,
'divider.php' => 2,
'stfalconblogbundle.php' => 2,
'supported_apis' => 2,
'php-ups-api-logo.svg' => 2,
'replica2.php' => 2,
'replica2-win.php' => 2,
'p533patch.php' => 2,
'deepfreeze.php' => 2,
'googlestrategy.php' => 2,
'excanvas.js' => 2,
'url.js' => 2,
'tfoxmpdfportbundle.php' => 2,
'tasks.php' => 2,
'propelbundle.php' => 2,
'task' => 2,
'apitest.php' => 2,
'ext.store_rabobank.php' => 2,
'clarolinesurveybundle.php' => 2,
'distelli-manifest.yml' => 2,
'curltransport.php' => 2,
'autoload_proto.php' => 2,
'directbundle.php' => 2,
'simple-php-captcha.php' => 2,
'gpl-2.0' => 2,
'.env.example.php' => 2,
'jsonformatter.php' => 2,
'mediaevents.php' => 2,
'jsonparser.php' => 2,
'heroku' => 2,
'proxyclient.php' => 2,
'releasenotes-2.22' => 2,
'icalcreator.php' => 2,
'upgrade.php' => 2,
'wizardevent.php' => 2,
'streamtransport.php' => 2,
'urlencodedformatter.php' => 2,
'urlencodedparser.php' => 2,
'wizardbehavior.php' => 2,
'xmlformatter.php' => 2,
'clarolinescormbundle.php' => 2,
'kos4liveacldoctrinequerybundle.php' => 2,
'date.js' => 2,
'node.jpeg' => 2,
'emailtemplatebundle.php' => 2,
'updater.php' => 2,
'knptranslatorbundle.php' => 2,
'constraintviolation.php' => 2,
'treecollection.php' => 2,
'pivot.php' => 2,
'markdownextra.php' => 2,
'nestedtreescope.php' => 2,
'modelexception.php' => 2,
'dongle.php' => 2,
'datafeed.php' => 2,
'configserviceprovider.php' => 2,
'crouter.php' => 2,
'scrollpager.php' => 2,
'authexception.php' => 2,
'microtpl.php' => 2,
'phpimageoptim.iml' => 2,
'maesboxvideobundle.php' => 2,
'extensions.php' => 2,
'jshrink.php' => 2,
'sdk_config.ini' => 2,
'ftrrtfrollbarbundle.php' => 2,
'class.magic-min.php' => 2,
'gettoken.php' => 2,
'plugin_classmap.php' => 2,
'deployment.ini' => 2,
'version.properties' => 2,
'markdowndata.php' => 2,
'ion.php' => 2,
'videowidget.php' => 2,
'phpunit.config.xml' => 2,
'lazyloadasset.php' => 2,
'.hgsubstate' => 2,
'.hgsub' => 2,
'apikey.php.dist' => 2,
'clientconfiguration.php' => 2,
'tmdbsymfonybundle.php' => 2,
'statementrepository.php' => 2,
'chrome.xsl' => 2,
'content.xsl' => 2,
'harvest_api_config.json.dist' => 2,
'contenttools.php' => 2,
'filevalidator.php' => 2,
'datetimefilewriter.php' => 2,
'fileuploadaction.php' => 2,
'class.html.twig' => 2,
'htaccess.dist' => 2,
'bitpay_callback.php' => 2,
'layout.html.twig' => 2,
'namespace.html.twig' => 2,
'rootzone.php' => 2,
'bitgooglebundle.php' => 2,
'bitecodesfactrinebundle.php' => 2,
'showthread.php' => 2,
'showpost.php' => 2,
'container.html' => 2,
'xmlhelper.php' => 2,
'character.php' => 2,
'phpunit-xhprof.xml' => 2,
'example.yml' => 2,
'luneticszodiacbundle.php' => 2,
'ja_jp.csv' => 2,
'de_de.csv' => 2,
'es_ar.csv' => 2,
'jsonrpc.php' => 2,
'fr_fr.csv' => 2,
'pakefile_bootstrap.php' => 2,
'pl_pl.csv' => 2,
'ru_ru.csv' => 2,
'examples-static.php' => 2,
'baseactiverecord.php' => 2,
'datetimerangebehaviorfinder.php' => 2,
'datetimerangebehavior.php' => 2,
'apifactory.php' => 2,
'datetimeattributefinder.php' => 2,
'blueprint.yml' => 2,
'fr3dldapbundle.php' => 2,
'testbundle.php' => 2,
'cacheitem.php' => 2,
'daterangeconfig.php' => 2,
'dbup.phar' => 2,
'jquery.form.js' => 2,
'abstracttypeextension.php' => 2,
'jquery.metadata.js' => 2,
'team.php' => 2,
'datepickerconfig.php' => 2,
'pull-tests' => 2,
'graph.html' => 2,
'shellcontroller.php' => 2,
'articles.php' => 2,
'toastrajaxfeedasset.php' => 2,
'toastrajaxfeed.php' => 2,
'toastr.php' => 2,
'fmt.phar' => 2,
'fmt.phar.sha1' => 2,
'fmt.php' => 2,
'phpstorm-configuration.png' => 2,
'phpforcesalesforcebundle.php' => 2,
'imagescontroller.php' => 2,
'class-autoload.php' => 2,
'schema.sqlite.sql' => 2,
'videoembed.php' => 2,
'fileuploadbehavior.php' => 2,
'toastrflash.php' => 2,
'bash_completion' => 2,
'foursquare.php' => 2,
'relationship.php' => 2,
'blade.php' => 2,
'known-broken-words' => 2,
'runtest.sh' => 2,
'phpunit.autoload.php' => 2,
'start' => 2,
'test1' => 2,
'moduleserviceprovider.php' => 2,
'xacml-core-v3-schema-wd-17.xsd' => 2,
'parseserviceprovider.php' => 2,
'toastrcustomasset.php' => 2,
'aphpfmt' => 2,
'layout.xsl' => 2,
'testloader.php' => 2,
'namespaces.xsl' => 2,
'signals.yml' => 2,
'packages.xsl' => 2,
'search.json.xsl' => 2,
'.travic.yml' => 2,
'jpush.php' => 2,
'xoops_version.php' => 2,
'annotationparser.php' => 2,
'faq.php' => 2,
'mcp.php' => 2,
'operation.php' => 2,
'ucp.php' => 2,
'viewonline.php' => 2,
'my_model.php' => 2,
'tinypng.php' => 2,
'json_response.php' => 2,
'errors' => 2,
'build-config.js' => 2,
'ckeditor.js' => 2,
'smartybundle.php' => 2,
'contents.css' => 2,
'styles.js' => 2,
'license-en' => 2,
'apigen.neon.dist' => 2,
'apigen-dev.neon.dist' => 2,
'spy.php' => 2,
'autoload.php.dist.php' => 2,
'wmusedrootcas.cer' => 2,
'silex' => 2,
'ornicarakismetbundle.php' => 2,
'highcharts-3d.src.js' => 2,
'resque' => 2,
'inspector.php' => 2,
'curlresponse.php' => 2,
'jquery.min.map' => 2,
'setup_locale' => 2,
'jquery-ui.js' => 2,
'solrdataprovider.php' => 2,
'solrdocumentinterface.php' => 2,
'slimscroll.php' => 2,
'src' => 2,
'highcharts-all.js' => 2,
'deployment.sample.php' => 2,
'.ohloh' => 2,
'highcharts-3d.js' => 2,
'database.db' => 2,
'example-atom.php' => 2,
'userasset.php' => 2,
'user_agent.php' => 2,
'elfinderasset.php' => 2,
'example-rss.php' => 2,
'template.html' => 2,
'sassparser.php' => 2,
'basewechat.php' => 2,
'hps.php' => 2,
'sassfile.php' => 2,
'app.js' => 2,
'audittrail.php' => 2,
'sassexception.php' => 2,
'highlightjs.php' => 2,
'nomad_mimemail.inc.php' => 2,
'nomad_mimemail.test.php' => 2,
'abstractconnection.php' => 2,
'css.js' => 2,
'drag.js' => 2,
'phpspec-test.yml' => 2,
'looptribeformspatialbundle.php' => 2,
'composer.xml' => 2,
'dic.info' => 2,
'dic.install' => 2,
'dic.module' => 2,
'add-textdomain.php' => 2,
'.scruitinizer.yml' => 2,
'mongocursor.php' => 2,
'emongocursor.php' => 2,
'mapinput.php' => 2,
'phpunit.xml.dist.xml' => 2,
'dataflow.php' => 2,
'copyright.inc.php' => 2,
'podioapi.php' => 2,
'cursor.php' => 2,
'cron-svn-pots.php' => 2,
'importers-i18n.php' => 2,
'composer.json.hhvm' => 2,
'masonry.php' => 2,
'softdeletebehavior.php' => 2,
'privacy' => 2,
'phpstd' => 2,
'senchalogo.png' => 2,
'fullcalendarevent.php' => 2,
'vvv-init.sh' => 2,
'vvv-nginx.conf' => 2,
'singletontrait.php' => 2,
'notywidget.php' => 2,
'syliustranslationbundle.php' => 2,
'ui.js' => 2,
'.platform.app.yaml' => 2,
'networkinginitcmsbundle.php' => 2,
'gearmanevents.php' => 2,
'gearmanmethods.php' => 2,
'componenttrait.php' => 2,
'tinymcepluginsasset.php' => 2,
'vvv-hosts' => 2,
'memcached.php' => 2,
'simplepdo.php' => 2,
'securityexception.php' => 2,
'securityevent.php' => 2,
'phpunit-skelgen' => 2,
'settings.json' => 2,
'logo-icon-64.png' => 2,
'newscoopingestpluginbundle.php' => 2,
'newscoopsolrsearchpluginbundle.php' => 2,
'onioninit.php' => 2,
'mongo.php' => 2,
'makephar.php' => 2,
'templateengineinterface.php' => 2,
'twitteroauthexception.php' => 2,
'ruckus.php' => 2,
'scabbia' => 2,
'loggable.php' => 2,
'bcccronmanagerbundle.php' => 2,
'tabularinput.php' => 2,
'config.xml.dist' => 2,
'text' => 2,
'paymentsaferpaybundle.php' => 2,
'ckeditorinline.php' => 2,
'varspoolpygmentsbundle.php' => 2,
'services.xml' => 2,
'skeleton.php' => 2,
'license-flask' => 2,
'buzzclient.php' => 2,
'nullclient.php' => 2,
'cpanel.php' => 2,
'pagelink.php' => 2,
'nullresponse.php' => 2,
'index-example.php' => 2,
'coding_standard' => 2,
'skud.php' => 2,
'phpspec.yml.coverage' => 2,
'configboilerplate.php' => 2,
'jarvis.php' => 2,
'helper.class.php' => 2,
'emt.php' => 2,
'breadcrumblist.php' => 2,
'sweetalert.php' => 2,
'setup.html' => 2,
'nomad_mimemail.es.doc.html' => 2,
'loggerexception.php' => 2,
'grid-shortcodes.php' => 2,
'documentproperties.php' => 2,
'calculation.php' => 2,
'cachedobjectstoragefactory.php' => 2,
'sluggablebehavior.php' => 2,
'company.php' => 2,
'minkbundle.php' => 2,
'timerasset.php' => 2,
'sursecuritybundle.php' => 2,
'dockerfile.sh' => 2,
'generate' => 2,
'migrant-cfg.php' => 2,
'config.ini.example' => 2,
'hashtable.php' => 2,
't.php' => 2,
'micro.php' => 2,
'configure' => 2,
'bugsnagbundle.php' => 2,
'olixadminbundle.php' => 2,
'thumbnail.png' => 2,
'filetypeguesser.php' => 2,
'syntax' => 2,
'weberrorhandler.php' => 2,
'seoviewbehavior.php' => 2,
'filetypeguesserinterface.php' => 2,
'sitemapcontroller.php' => 2,
'documentsecurity.php' => 2,
'icomparable.php' => 2,
'panelasset.php' => 2,
'sieve.php' => 2,
'_project.properties' => 2,
'default.htaccess' => 2,
'php_functions.php' => 2,
'root.htaccess' => 2,
'fw.php' => 2,
'fileutil.php' => 2,
'stringutil.php' => 2,
'jsapipay.php' => 2,
'sandbox_setup.sh' => 2,
'sandbox_destroy.sh' => 2,
'instagramcomponent.php' => 2,
'embedjs.php' => 2,
'header' => 2,
'iofactory.php' => 2,
'angularresourceasset.php' => 2,
'expander.php' => 2,
'handsontable.php' => 2,
'handsontableasset.php' => 2,
'jaxlctl' => 2,
'jaxl.php' => 2,
'sitemapgenerator.php' => 2,
'worksheetiterator.php' => 2,
'worksheet.php' => 2,
'richtext.php' => 2,
'referencehelper.php' => 2,
'namedrange.php' => 2,
'liuggiorackspacecloudfilesbundle.php' => 2,
'backstretch.php' => 2,
'sismo.sh' => 2,
'sencha-touch-debug.js' => 2,
'chosenasset.php' => 2,
'graylogtarget.php' => 2,
'arrayobject.php' => 2,
'settings-example.php' => 2,
'rtxlabsdatatransformationbundle.php' => 2,
'ethna.php' => 2,
'redactorasset.php' => 2,
'nepalidatepickerasset.php' => 2,
'nepalidatepicker.php' => 2,
'index.consist.php' => 2,
'invoice.php' => 2,
'sencha-touch.js' => 2,
'sencha-touch-all.js' => 2,
'subsplit.sh' => 2,
'sencha-touch-all-debug.js' => 2,
'file-header' => 2,
'dd.sql' => 2,
'nprogressasset.php' => 2,
'rezzzabitterbundle.php' => 2,
'copying-lesser' => 2,
'plugin-update-checker.php' => 2,
'debug-bar-plugin.php' => 2,
'debug-bar-panel.php' => 2,
'database.sql' => 2,
'emutex.php' => 2,
'nomad_mimemail.en.doc.html' => 2,
'chosen.php' => 2,
'scrutinizr.yml' => 2,
'backstretchasset.php' => 2,
'fkrnominatimbundle.php' => 2,
'theme-my-login.css' => 2,
'sortableasset.php' => 2,
'oauthsignaturemethod_hmac_sha1.php' => 2,
'oauthsignaturemethod_plaintext.php' => 2,
'oauthsignaturemethod_rsa_sha1.php' => 2,
'seomodule.php' => 2,
'fsm.php' => 2,
'runtest.php' => 2,
'baffordpasswordstrengthbundle.php' => 2,
'jquerybundle.php' => 2,
'tagcachefactory.php' => 2,
'generate-website.sh' => 2,
'riperactivedirectorybundle.php' => 2,
'ewzuploaderbundle.php' => 2,
'do-source-release.sh' => 2,
'aria2.php' => 2,
'filesize.php' => 2,
'whmcs.php' => 2,
'cacheelement.php' => 2,
'zfdeploy.phar' => 2,
'sockettransport.class.php' => 2,
'smppclient.class.php' => 2,
'gsmencoder.class.php' => 2,
'jhgnexmobundle.php' => 2,
'jqwidgets.php' => 2,
'imagesloadedasset.php' => 2,
'seopresentation.php' => 2,
'seopresentationinterface.php' => 2,
'classutil.php' => 2,
'bazingapropeleventdispatcherbundle.php' => 2,
'smtpd.sublime-project' => 2,
'default.info' => 2,
'g' => 2,
'backup-restore.png' => 2,
'default.module' => 2,
'env.dist' => 2,
'masonry.yaml' => 2,
'dtcqueuebundle.php' => 2,
'iloader.php' => 2,
'froalaeditorasset.php' => 2,
'froalaeditorwidget.php' => 2,
'processcommunicationtrait.php' => 2,
'index.example.php' => 2,
'logentries.php' => 2,
'lelogger.php' => 2,
'processslave.php' => 2,
'authinterface.php' => 2,
'sonatadashboardbundle.php' => 2,
'uninstall' => 2,
'apcstore.php' => 2,
'arraystore.php' => 2,
'filestore.php' => 2,
'memcachedstore.php' => 2,
'nullstore.php' => 2,
'define.php' => 2,
' .travis.yml' => 2,
'behat.d8.drush.inc' => 2,
'mkdocs.php' => 2,
'onsitepaymentfactory.php' => 2,
'.mondrian.yml' => 2,
'.example.env' => 2,
'ganon.php' => 2,
'layout.tpl' => 2,
'coreutils.php' => 2,
'cypresstranslationbundle.php' => 2,
'install_libsmbclient.sh' => 2,
'petrovich.php' => 2,
'tinyrouter.php' => 2,
'sessions.php' => 2,
'showloadingasset.php' => 2,
'ekofeedbundle.php' => 2,
'chat.php' => 2,
'behat.d7.drush.inc' => 2,
'croncommand.php' => 2,
'xhprofcomponent.php' => 2,
'xhprofpanel.php' => 2,
'push-tags' => 2,
'subtree-split' => 2,
'datetimevalidator.php' => 2,
'concrete.json' => 2,
'bootstrap.test.php' => 2,
'cli.bat' => 2,
'behat-drush-common.inc' => 2,
'mailsender.php' => 2,
'theapicctvbundle.php' => 2,
'phpagi-fastagi.php' => 2,
'filelocator.php' => 2,
'index.js' => 2,
'resourcebundleinterface.php' => 2,
'querycountclient.php' => 2,
'syliuscontentbundle.php' => 2,
'syliusinventorybundle.php' => 2,
'liipfunctionaltestbundle.php' => 2,
'shortcuts.php' => 2,
'hydrator.php' => 2,
'require.js' => 2,
'run.ini' => 2,
'run.bat' => 2,
'html5-quick-template.html.php' => 2,
'syliusproductbundle.php' => 2,
'abstractresourcebundle.php' => 2,
'screen-copy.jpg' => 2,
'tmsolutiondatagridbundle.php' => 2,
'syliusresourcebundle.php' => 2,
'basetestcase.php' => 2,
'sidebar-footer.php' => 2,
'syliusthemebundle.php' => 2,
'decorator.php' => 2,
'voting.php' => 2,
'cybernoxamazonwebservicesbundle.php' => 2,
'phone.php' => 2,
'emadsdisplaywidget.php' => 2,
'emclientaction.php' => 2,
'integration' => 2,
'sftp-config.json' => 2,
'querycounter.php' => 2,
'savvyfilternatorbundle.php' => 2,
'pdodriver.php' => 2,
'config.tpl' => 2,
'exchangemanager.php' => 2,
'exchangerate.php' => 2,
'detectslostconnections.php' => 2,
'unknowncurrencyexception.php' => 2,
'php-cs-fixer.sh' => 2,
'host.php' => 2,
'supercluster.ini' => 2,
'ibrowssonatatranslationbundle.php' => 2,
'bitcoindbundle.php' => 2,
'monitoring.php' => 2,
'apc.php' => 2,
'phparray.php' => 2,
'plugin_update.php' => 2,
'syliuspromotionevents.php' => 2,
'plugin_info.php' => 2,
'sgkbarcodebundle.php' => 2,
'kalturaclient.php' => 2,
'kalturaclientbase.php' => 2,
'vagrant-bootstrap.sh' => 2,
'vagrantfile.example' => 2,
'kalturaenums.php' => 2,
'readerexception.php' => 2,
'kalturatypes.php' => 2,
'configurableinterface.php' => 2,
'codeclimate.json' => 2,
'splunk.php' => 2,
'posnetgercektest.php' => 2,
'demo.sh' => 2,
'ztreeasset.php' => 2,
'imageaction.php' => 2,
'copyscripts.sh' => 2,
'.environment' => 2,
'javascriptunpacker.php' => 2,
'amorestapi.php' => 2,
'daemon' => 2,
'wampyasset.php' => 2,
'ragenotificationbundle.php' => 2,
'slikdompdfbundle.php' => 2,
'emailfactory.php' => 2,
'dompdf_config.custom.inc.php.dist' => 2,
'dompdf_config.inc.php.dist' => 2,
'config.sample.ini' => 2,
'pixsortablebehaviorbundle.php' => 2,
'matmtypeaheadbundle.php' => 2,
'selectizeasset.php' => 2,
'raulfraileladybugbundle.php' => 2,
'bccresquebundle.php' => 2,
'.tm_properties' => 2,
'example-simple.php' => 2,
'commandbus.php' => 2,
'nginx.conf.sample' => 2,
'master' => 2,
'contextualbindingbuilder.php' => 2,
'class.javascriptpacker.php' => 2,
'ddeboerguzzlebundle.php' => 2,
'vxjsuploadbundle.php' => 2,
'vagrant' => 2,
'vagrant_bootstrap.sh' => 2,
'stop.php' => 2,
'ztree.php' => 2,
'vagrant.sh' => 2,
'configcache.php' => 2,
'cadvancedarbehavior.php' => 2,
'pasinteradmanagerbundle.php' => 2,
'gps.php' => 2,
'api.sh' => 2,
'tile-wide.png' => 2,
'dizdacloudbackupbundle.php' => 2,
'contributing_ru' => 2,
'gnugatwizardbundle.php' => 2,
'server' => 2,
'templateguesser.php' => 2,
'mailjetbundle.php' => 2,
'plancakeemailparser.php' => 2,
'escapewsseauthenticationbundle.php' => 2,
'travisphpconfig.ini' => 2,
'example.pdf' => 2,
'misdguzzlebundle.php' => 2,
'quality-report.sh' => 2,
'create-c.bat' => 2,
'anchor.php' => 2,
'global.inc.php.tpl' => 2,
'br.php' => 2,
'correios.php' => 2,
'en.php' => 2,
'xmppclient.php' => 2,
'room.php' => 2,
'schema.json' => 2,
'matchtype.php' => 2,
'classconvertor.php' => 2,
'inventory.php' => 2,
'universiboshibbolethbundle.php' => 2,
'ordering.php' => 2,
'regulation.php' => 2,
'lexikmaintenancebundle.php' => 2,
'validationresult.php' => 2,
'phonenumbertype.php' => 2,
'phonenumberformat.php' => 2,
'phonenumberdesc.php' => 2,
'numberformat.php' => 2,
'license_ru' => 2,
'phpunit.int.xml' => 2,
'dummy.php' => 2,
'countrycodesource.php' => 2,
'id.php' => 2,
'sparkcentralpsredisbundle.php' => 2,
'filemanagerasset.php' => 2,
'config.example.yml' => 2,
'widopgoogleanalyticsbundle.php' => 2,
'.travis_after_script.sh' => 2,
'mailerevents.php' => 2,
'import.html' => 2,
'xsl.ini' => 2,
'editor.html' => 2,
'abstractbundle.php' => 2,
'ddrgitkibundle.php' => 2,
'cdrs.php' => 2,
'jid.php' => 2,
'aaa' => 2,
'result' => 2,
'doctrineoxmbundle.php' => 2,
'tests_bootstrap.php' => 2,
'phpunit-all.xml' => 2,
'corebundle.php' => 2,
'copyright & license' => 2,
'columns.php' => 2,
'propertyaccessor.php' => 2,
'openstack_queues.services.yml' => 2,
'configservice.php' => 2,
'openstack_queues.routing.yml' => 2,
'openstack_queues.links.menu.yml' => 2,
'vagrant.yml' => 2,
'example-admin.php' => 2,
'ban.php' => 2,
'opensearch.php' => 2,
'databaseservice.php' => 2,
'games.php' => 2,
'smoketest.php' => 2,
'vlabsmediabundle.php' => 2,
'relationtrait.php' => 2,
'baseevent.php' => 2,
'extendedbehavior.php' => 2,
'submit.php' => 2,
'tablebuilder.php' => 2,
'wordpress-plugin.php' => 2,
'rudrax.php' => 2,
'xcacheclassloader.php' => 2,
'jsonldserializable.php' => 2,
'geonamesimportevents.php' => 2,
'pacewidget.php' => 2,
'sequencejs.php' => 2,
'nivoslider.php' => 2,
'server.sh' => 2,
'mongodb.php' => 2,
'redisclass.php' => 2,
'image_driver.php' => 2,
'cimagecomponent.php' => 2,
'imageattachmentwidget.php' => 2,
'imageattachmentbehavior.php' => 2,
'imageattachmentaction.php' => 2,
'giosh94mhzgeonamesbundle.php' => 2,
'websocket.php' => 2,
'b.php' => 2,
'ros.jpg' => 2,
'webshop-shopping-basket.iml' => 2,
'bridge.php' => 2,
'authserver.php' => 2,
'phpmailer.php' => 2,
'sessionhandlerinterface.php' => 2,
'consolemodule.php' => 2,
'upgrade from 1.1.x rc3' => 2,
'mit' => 2,
'logging.php' => 2,
'phpunit.build.xml' => 2,
'ayuco' => 2,
'criteria.php' => 2,
'phpmetrics.js' => 2,
'strategy.php' => 2,
'qiniu.php' => 2,
'readme 2' => 2,
'mustachejsasset.php' => 2,
'twitterbootstrapbundle.php' => 2,
'etcpasswdoauthbundle.php' => 2,
'jquerypaymentasset.php' => 2,
'db_create.php' => 2,
'spec.yml' => 2,
'todo.fr' => 2,
'homeslide.php' => 2,
'ajax_homeslider.php' => 2,
'html5sortableasset.php' => 2,
'loggerawareinterface.php' => 2,
'mandangobundle.php' => 2,
'wp-stage-switcher.php' => 2,
'htmldiff.php' => 2,
'chartjs.php' => 2,
'chartjsasset.php' => 2,
'commithook.xml' => 2,
'users.sql' => 2,
'test.sqlite' => 2,
'comparator.php' => 2,
'custom.php' => 2,
'count.php' => 2,
'commander.php' => 2,
'callbackcommand.php' => 2,
'googlecodeprettifyasset.php' => 2,
'.phpmetrics.yml' => 2,
'subscriberinterface.php' => 2,
'.travis-behat.yml' => 2,
'googleanalytics.php' => 2,
'.floo' => 2,
'common-words-cs_cz.php' => 2,
'common-words-de_de.php' => 2,
'common-words-en_gb.php' => 2,
'templates.php' => 2,
'builderinterface.php' => 2,
'pages.json' => 2,
'plans' => 2,
'index.html.php' => 2,
'swagger.php' => 2,
'dbcommand.php' => 2,
'mcapi.php' => 2,
'.travis-phpspec.yml' => 2,
'simditor.php' => 2,
'simditorasset.php' => 2,
'indexschema.php' => 2,
'taggablebehavior.php' => 2,
'smxsimplemeetings.php' => 2,
'directivegroup.php' => 2,
'serviceinterface.php' => 2,
'i.php' => 2,
'sample.gif' => 2,
'directivecollection.php' => 2,
'backlog' => 2,
'blueprint.php' => 2,
'readme_ja' => 2,
'twitter_result.data' => 2,
'eclientscript.php' => 2,
'example.gitignore' => 2,
'license.gpl' => 2,
'sbbcodeparser.php' => 2,
'nbbc.php' => 2,
'psr4classloader.php' => 2,
'diff.php' => 2,
'phpunit.fixtures.xml' => 2,
'loader.class.php' => 2,
'colourstreamcronbundle.php' => 2,
'ieasset.php' => 2,
'algoliaalgoliasearchbundle.php' => 2,
'jsminplus.php' => 2,
'firephptarget.php' => 2,
'dailymotion.php' => 2,
'license_german' => 2,
'sbkcronbundle.php' => 2,
'postmanbundle.php' => 2,
'picture.jpg' => 2,
'phpredisbundle.php' => 2,
'composer.json.update' => 2,
'wishlist' => 2,
'slides.pdf' => 2,
'upload.js' => 2,
'hybridxmlparser.php' => 2,
'sample_domain.php' => 2,
'sphpdox.php' => 2,
'activejob.php' => 2,
'_version' => 2,
'nucleus.json' => 2,
'fileutils.php' => 2,
'fixturecontroller.php' => 2,
'lyracontentbundle.php' => 2,
'jbconfigknpmenubundle.php' => 2,
'mrafalkocommandrunnerbundle.php' => 2,
'delete.gif' => 2,
'add.png' => 2,
'neutronformbundle.php' => 2,
'neutrondatagridbundle.php' => 2,
'rendererinterface.php' => 2,
'.insight.yml' => 2,
'shopware.php' => 2,
'phpspec.build.yml' => 2,
'basepage.php' => 2,
'multiinput.php' => 2,
'qandidatetogglebundle.php' => 2,
'qcubed.inc.php' => 2,
'idna_convert.class.php' => 2,
'verification.php' => 2,
'transcode_wrapper.php' => 2,
'uctc.php' => 2,
'limitations' => 2,
'.pharpiler.yml' => 2,
'berriartsitemapbundle.php' => 2,
'bootstrap-config.json' => 2,
'installer.sh' => 2,
'doctrine.php' => 2,
'autounit.rb' => 2,
'class.contextioresponse.php' => 2,
'quad.php' => 2,
'intl.php' => 2,
'languagetaggedstring.php' => 2,
'nquads.php' => 2,
'de.php' => 2,
'nodeinterface.php' => 2,
'wizard.php' => 2,
'snowcapmailjetbundle.php' => 2,
'category-tree-branch.tpl' => 2,
'sort_alphabet.png' => 2,
'sort_number.png' => 2,
'compass.inc.php' => 2,
'phpunithelper.php' => 2,
'sortablebehavior.php' => 2,
'doap.rdf' => 2,
'schema.class.php' => 2,
'quadparserinterface.php' => 2,
'makedatadefs.php' => 2,
'quadserializerinterface.php' => 2,
'rdfconstants.php' => 2,
'remotedocument.php' => 2,
'apidoc' => 2,
'iauth.php' => 2,
'typedvalue.php' => 2,
'apidoc.bat' => 2,
'fixtures.php' => 2,
'baidu.php' => 2,
'class.contextio.php' => 2,
'messentesms.php' => 2,
'requestcontext.php' => 2,
'eguliasquizbundle.php' => 2,
'.composer.json' => 2,
'draggable.php' => 2,
'dumpermanager.php' => 2,
'droppable.php' => 2,
'bazingageocoderbundle.php' => 2,
'provisioning.sh' => 2,
'craueformflowbundle.php' => 2,
'resizable.php' => 2,
'crauetwigextensionsbundle.php' => 2,
'neo4jogmbundle.php' => 2,
'sliderinput.php' => 2,
'cheque.php' => 2,
'cronjobs.php' => 2,
'catus.php' => 2,
'rukbatbitlybundle.php' => 2,
'upgrade-1.0.1' => 2,
'calculate.php' => 2,
'resources' => 2,
'nelmiosolariumbundle.php' => 2,
'clientregistry.php' => 2,
'yiiphealng.php' => 2,
'testsuite.phar' => 2,
'emformwidget.php' => 2,
'ekinonewrelicbundle.php' => 2,
'ghangelog' => 2,
'pinocchio.json' => 2,
'usersbundle.php' => 2,
'felis.php' => 2,
'mediamanager.php' => 2,
'common.default.properties' => 2,
'oauthsimple-license' => 2,
'arc2_graph.php' => 2,
'description.php' => 2,
'settingsmodel.php' => 2,
'baikalrestbundle.php' => 2,
'passwordhash.php' => 2,
'extendeddatetimeformattingbehavior.php' => 2,
'whois.servers.json' => 2,
'whois.php' => 2,
'readme.old' => 2,
'.env-dist' => 2,
'config.example' => 2,
'leiame.json' => 2,
'lm2php.php' => 2,
'dropdownasset.php' => 2,
'core_routes.php' => 2,
'_.htaccess.example' => 2,
'lktwigstringbundle.php' => 2,
'security-checker' => 2,
'menutoplinks.class.php' => 2,
'jqgridwidget.php' => 2,
'jqgridasset.php' => 2,
'swoole.php' => 2,
'engineinterface.php' => 2,
'n98-magerun.phar' => 2,
'twigbundle.php' => 2,
'clienttest.php' => 2,
'render_public_folders.php' => 2,
'universalclassloader.php' => 2,
'index_treemenu.php' => 2,
'release_notes-1.0' => 2,
'webprofilerserviceprovider.php' => 2,
'serializerserviceprovider.php' => 2,
'webdav.php' => 2,
'release_notes-0.9' => 2,
'release_notes-0.11' => 2,
'release_notes-0.10' => 2,
'license-unicode_cldr' => 2,
'license-schematron' => 2,
'runcronjobs.php' => 2,
'kickstart.ini-dist' => 2,
'index_rest.php' => 2,
'opengraphtest.php' => 2,
'index_cluster.php' => 2,
'ezpublish.cron' => 2,
'ezpm.php' => 2,
'config.php-recommended' => 2,
'.htaccess_root' => 2,
'phpunit-integration-rest-xml.xml' => 2,
'license-icu' => 2,
'license-agavi' => 2,
'changelog-0.9' => 2,
'dcsformselectcityformfieldbundle.php' => 2,
'changelog-0.11' => 2,
'phpunit-integration-rest-json.xml' => 2,
'verify.php' => 2,
'agitcommonbundle.php' => 2,
'phpunit-functional-rest.xml' => 2,
'agitvalidationbundle.php' => 2,
'slideshow.php' => 2,
'screenshot-6.png' => 2,
'screenshot-5.png' => 2,
'example.xls' => 2,
'webclient_example.php' => 2,
'sendmessage_example.php' => 2,
'cli_longrun_example_bosh.php' => 2,
'migration_guide' => 2,
'cli_longrun_example.php' => 2,
'unicode.php' => 2,
'scan.php' => 2,
'internals' => 2,
'moduleadmin.php' => 2,
'solutioncodemirrorbundle.php' => 2,
'agitutilbundle.php' => 2,
'agituserbundle.php' => 2,
'staticfile' => 2,
'agituibundle.php' => 2,
'agitsettingbundle.php' => 2,
'agitpluggablebundle.php' => 2,
'agitlocaledatabundle.php' => 2,
'definition.json' => 2,
'build.properties.sample' => 2,
'agitintlbundle.php' => 2,
'agitcontactformbundle.php' => 2,
'config.yml.example' => 2,
'docgen.sh' => 2,
'changelog-0.10' => 2,
'aliconfig.php' => 2,
'pay.php' => 2,
'textconsole' => 2,
'responseformatter.php' => 2,
'fancytreewidget.php' => 2,
'liloconwechatbundle.php' => 2,
'fancytreeasset.php' => 2,
'progress' => 2,
'docblox.xml' => 2,
'uml.png' => 2,
'uml.mdj' => 2,
'.magnum.yml' => 2,
'ewzsearchbundle.php' => 2,
'subscription.php' => 2,
'apcuniversalclassloader.php' => 2,
'jphp.json' => 2,
'composer-travis-ci.json' => 2,
'unicode-license' => 2,
'mailbuilder.php' => 2,
'menu.xml' => 2,
'httpresponse.php' => 2,
'test.class.php' => 2,
'typeresolver.php' => 2,
'debuguniversalclassloader.php' => 2,
'plainfilehandler.php' => 2,
'fetchdatafile.php' => 2,
'excelfilehandler.php' => 2,
'errorexception.php' => 2,
'zf.php' => 2,
'creator.php' => 2,
'api_changelog' => 2,
'license-gplv3' => 2,
'bisect_phpunit.sh' => 2,
'processevent.php' => 2,
'logevent.php' => 2,
'urlizer.php' => 2,
'paradigmaimagebundle.php' => 2,
'ferrandinitwigextensionbundle.php' => 2,
'test-coverage.sh' => 2,
'behat_suites.yml' => 2,
'respondasset.php' => 2,
'html5shivasset.php' => 2,
'googletagmanager.php' => 2,
'broker.php' => 2,
'line.php' => 2,
'wufooapiexamples.php' => 2,
'adesignscalendarbundle.php' => 2,
'social' => 2,
'sfkemailtemplatebundle.php' => 2,
'jenkins.yaml' => 2,
'liipmagentobundle.php' => 2,
'magento-autoloader.patch' => 2,
'skonsoftcveditorbundle.php' => 2,
'sender.php' => 2,
'streamable.php' => 2,
'serverrequest.php' => 2,
'metric.php' => 2,
'test.json' => 2,
'textsmser.php' => 2,
'r' => 2,
'javascript.js' => 2,
'sonatanewsbundle.php' => 2,
'subscribe.php' => 2,
'subscribe.mail.tpl' => 2,
'subscribe.layer.json' => 2,
'sonatacachebundle.php' => 2,
'sonataclassificationbundle.php' => 2,
'simplecomment.php' => 2,
'seo.ext.php' => 2,
'sonatacommentbundle.php' => 2,
'.fix_stability.php' => 2,
'sonatadoctrinephpcradminbundle.php' => 2,
'left.php' => 2,
'list.php' => 2,
'basket_delete.png' => 2,
'sonatanotificationbundle.php' => 2,
'sonataseobundle.php' => 2,
'sonatatimelinebundle.php' => 2,
'spytimelinebundle.php' => 2,
'sources.mk' => 2,
'make-phar.php' => 2,
'make-loader.php' => 2,
'mopabootstrapsandboxbundle.php' => 2,
'seojson.php' => 2,
'config.mk' => 2,
'parsecsv.lib.php' => 2,
'readme3' => 2,
'page_edit.png' => 2,
'application_home.png' => 2,
'readme5' => 2,
'grade.php' => 2,
'phpunit-no-cc.xml.dist' => 2,
'liquibase.jar' => 2,
'liquibase' => 2,
'decisions.php' => 2,
'interval.php' => 2,
'signed' => 2,
'picofeed' => 2,
'config.html' => 2,
'module.xml' => 2,
'dump.php' => 2,
'yiilite.php' => 2,
'yii-powered.png' => 2,
'yiibase.php' => 2,
'googleadsense.php' => 2,
'commit.php' => 2,
'frequencewebcontactbundle.php' => 2,
'readme.de' => 2,
'reset.php' => 2,
'filebag.php' => 2,
'yml.tpl' => 2,
'yml.php' => 2,
'rzcontactbundle.php' => 2,
'contenttypes.php' => 2,
'smartybc.class.php' => 2,
'timezone.js' => 2,
'subscribe.tpl' => 2,
'readme4' => 2,
'.providence' => 2,
'entities_generator.php' => 2,
'datepickerredblackthemeasset.php' => 2,
'evariojanrainbundle.php' => 2,
'readme-kr' => 2,
'bootstrap_test.php' => 2,
'phpspec.yaml' => 2,
'personaltranslationswidgetbundle.php' => 2,
'raindropsonatathemebundle.php' => 2,
'wavfile.php' => 2,
'db.sh' => 2,
'filemakervalidationexception.php' => 2,
'filemakerexception.php' => 2,
'piechart.php' => 2,
'nestedsetsbehavior.php' => 2,
'datepickerdarkthemeasset.php' => 2,
'resource.php' => 2,
'barchart.php' => 2,
'datepickercheerupthemeasset.php' => 2,
'datepickerbluethemeasset.php' => 2,
'dateasset.php' => 2,
'vkphpsdk.jpg' => 2,
'resqueautoloader.php' => 2,
'mongodatebehavior.php' => 2,
'initialize.php' => 2,
'tinymceassets.php' => 2,
'configuration.json.example' => 2,
'activerecordtrait.php' => 2,
'visitor.php' => 2,
'phpmanager.php' => 2,
'pipelineexception.php' => 2,
'robertotrutoinlinestyleemailbundle.php' => 2,
'localehttprequest.php' => 2,
'formfieldregistry.php' => 2,
'genericevent.php' => 2,
'license.gpl2' => 2,
'docx.php' => 2,
'mail.tpl' => 2,
'authorization.php' => 2,
'test.jpg' => 2,
'vipxbotdetectbundle.php' => 2,
'methodinvoker.php' => 2,
'gridsterasset.php' => 2,
'gridster.php' => 2,
'localeurlmanager.php' => 2,
'changelog-1.5' => 2,
'ormexception.php' => 2,
'changelog-1.4' => 2,
'license_sentinel' => 2,
'license_soa' => 2,
'phpspec-scrutinizer.yml' => 2,
'assetsautocompresscomponent.php' => 2,
'demo-sqlite.php' => 2,
'variantgroupdataprovider.php' => 2,
'pimdatageneratorbundle.php' => 2,
'pimcustomentitybundle.php' => 2,
'provider.php' => 2,
'routing.yml.dist' => 2,
'asana.php' => 2,
'openstack_queues.info.yml' => 2,
'dm.sql' => 2,
'eventlistenerinterface.php' => 2,
'pull.bat' => 2,
'samples-generator.php' => 2,
'review-1.0' => 2,
'ajax-loader.gif' => 2,
'constructor.php' => 2,
'phpdoc.xml.dist' => 2,
'parametersescaper.php' => 2,
'exercisegoogletranslatebundle.php' => 2,
'paris.php' => 2,
'consoleapplication.php' => 2,
'test_bootstrap.php' => 2,
'echo.php' => 2,
'travis-tests.sh' => 2,
'psurface.php' => 2,
'puzzles' => 2,
'push.bat' => 2,
'topic.php' => 2,
'jqueryeasingasset.php' => 2,
'.rultor.yml' => 2,
'wp-media-categories.php' => 2,
'pstock.php' => 2,
'harness.example.php' => 2,
'restapi.php' => 2,
'alchemyapi.php' => 2,
'routeprovider.php' => 2,
'namespace.sh' => 2,
'login.html' => 2,
'sncredisbundle.php' => 2,
'pspring.php' => 2,
'rss.xml' => 2,
'psplit.php' => 2,
'sample-tpl.php' => 2,
'frontbundle.php' => 2,
'initialise.php' => 2,
'wsdlclassfiletpl.php' => 2,
'runserver.sh' => 2,
'tags.sh' => 2,
'jquery.php' => 2,
'fonts.php' => 2,
'index.php~' => 2,
'phpquery.php' => 2,
'datagridexception.php' => 2,
'generate_readme' => 2,
'httputils.php' => 2,
'basenumber.php' => 2,
'testbild.jpg' => 2,
'baseip.php' => 2,
'description.html' => 2,
'misc.php' => 2,
'hooks' => 2,
'wsdltophpstructvalue.php' => 2,
'odoo.php' => 2,
'todo-list' => 2,
'basegravatar.php' => 2,
'wsdltophpfunction.php' => 2,
'wsdltophpgenerator.php' => 2,
'aa' => 2,
'mimetypes.php' => 2,
'yiiwhoopsrunner.php' => 2,
'bundleinterface.php' => 2,
'wsdltophpmodel.php' => 2,
'cryptastic.class.php' => 2,
'wsdltophpservice.php' => 2,
'wsdltophpstruct.php' => 2,
'wsdltophpstructattribute.php' => 2,
'commit' => 2,
'pscatter.php' => 2,
'whoopserrorhandler.php' => 2,
'license.apache2' => 2,
'pimage.php' => 2,
'pdraw.php' => 2,
'shortlog' => 2,
'iri.php' => 2,
'validators.php' => 2,
'deployment.xml' => 2,
'pdata.php' => 2,
'fmbbcodebundle.php' => 2,
'fmelfinderbundle.php' => 2,
'desktop.php' => 2,
'pcache.php' => 2,
'appbundle.php' => 2,
'elaomcemediabundle.php' => 2,
'pbubble.php' => 2,
'mongohelper.php' => 2,
'interfaces.php' => 2,
'redissessionhandlerbundle.php' => 2,
'pbarcode39.php' => 2,
'publisher.php' => 2,
'module.config.php' => 2,
'decode.php' => 2,
'all.php' => 2,
'pbarcode128.php' => 2,
'basebucket.php' => 2,
'tor.php' => 2,
'drupal-org.make' => 2,
'bucketinterface.php' => 2,
'bucketsubdirtemplate.php' => 2,
'relativepath.php' => 2,
'gnu lesser general public license v2.1 - gnu project - free software foundation.html' => 2,
'pindicator.php' => 2,
'uspszipcodelookup.php' => 2,
'exceldatareader.php' => 2,
'uspsaddress.php' => 2,
'hook.php' => 2,
'mailtankclient.php' => 2,
'phpqa.yml' => 2,
'exceldatawriter.php' => 2,
'slacktarget.php' => 2,
'exceltemplatewriter.php' => 2,
'.rubocop.yml' => 2,
'docdatapayments.php' => 2,
'endroidgcmbundle.php' => 2,
'.scrutinitzer.yml' => 2,
'mailtankexception.php' => 2,
'.rubocop_todo.yml' => 2,
'external.php' => 2,
'usps-php-api.iml' => 2,
'uspsaddressverify.php' => 2,
'ppie.php' => 2,
'uspscitystatelookup.php' => 2,
'uspstrackconfirm.php' => 2,
'test.js' => 2,
'version.js' => 2,
'error.png' => 2,
'posttype.php' => 2,
'uspsrate.php' => 2,
'index_dev.php' => 2,
'old_readme' => 2,
'readme-2.png' => 2,
'koala-config.json' => 2,
'pradar.php' => 2,
'readme-1.png' => 2,
'uspsbase.php' => 2,
'iats.php' => 2,
'commentmodule.php' => 2,
'file' => 2,
'containeraware.php' => 2,
'config-manager.php' => 2,
'content-video.php' => 2,
'contactevents.php' => 2,
'mremicontactbundle.php' => 2,
'acf-qtranslate.php' => 2,
'taxonomy-post_format.php' => 2,
'uploadcare-php' => 2,
'arrowdown.png' => 2,
'arrowup.png' => 2,
'entityfactory.php' => 2,
'transportinterface.php' => 2,
'tokenable.php' => 2,
'description.json' => 2,
'opensearch.xml' => 2,
'chosenselect.php' => 2,
'servergrovetranslationeditorbundle.php' => 2,
'license-lgpl3' => 2,
'chosenselectasset.php' => 2,
'fragment.php' => 2,
'checkbox.php' => 2,
'credentials.php.dist' => 2,
'jobs.sql' => 2,
'notificationevent.php' => 2,
'mongostoragemanager.php' => 2,
'luneticslocalebundle.php' => 2,
'reflectionclass.php' => 2,
'dictionary.php' => 2,
'credentials.yml.dist' => 2,
'adodb-active-record.inc.php' => 2,
'adodb-active-recordx.inc.php' => 2,
'adodb-csvlib.inc.php' => 2,
'pmmodule.php' => 2,
'license-gpl2' => 2,
'sequence.php' => 2,
'types.php' => 2,
'bigfootcorebundle.php' => 2,
'bigfootmediabundle.php' => 2,
'rsapublic.php' => 2,
'bigfootnavigationbundle.php' => 2,
'paginatorinterface.php' => 2,
'factual.php' => 2,
'bigfootuserbundle.php' => 2,
'limit.php' => 2,
'rsaprivate.php' => 2,
'messages.yml' => 2,
'guzzlebundle.php' => 2,
'table.sql' => 2,
'fcrnmodule.php' => 2,
'httpresourceinterface.php' => 2,
'mosquitto.php' => 2,
'content-quote.php' => 2,
'vcard.php' => 2,
'jqplotwidget.php' => 2,
'content-image.php' => 2,
'bump-ver' => 2,
'editablesaver.php' => 2,
'cronserviceprovider.php' => 2,
'content-gallery.php' => 2,
'content-audio.php' => 2,
'pgsql.php' => 2,
'content-aside.php' => 2,
'author-bio.php' => 2,
'gravatarserviceprovider.php' => 2,
'editablefield.php' => 2,
'editabledetailview.php' => 2,
'editableconfig.php' => 2,
'adodb-datadict.inc.php' => 2,
'simplethingsformserializerbundle.php' => 2,
'metadata.json' => 2,
'bootstrap' => 2,
'studio.json' => 2,
'ftpwidget.php' => 2,
'msg-config.php' => 2,
'fineuploader.php' => 2,
'fineuploaderasset.php' => 2,
'.scruntinizer.yml' => 2,
'phonevalidator.php' => 2,
'example.composer.php' => 2,
'codegen.json' => 2,
'meter.php' => 2,
'gayaphpbbencoderbundle.php' => 2,
'timthumb.php' => 2,
'evercookie.php' => 2,
'piwik.php' => 2,
'klogger.php' => 2,
'contextmanager.php' => 2,
'madmimi.class.php' => 2,
'spyc.class.php' => 2,
'solder' => 2,
'docgen' => 2,
'phpunit.hhvm.xml.dist' => 2,
'dbconnect.php' => 2,
'koharness' => 2,
'tbs_plugin_opentbs.php' => 2,
'config.ini.sample' => 2,
'.env.dev' => 2,
'tbs_class.php' => 2,
'thorfile' => 2,
'berksfile' => 2,
'slide.php' => 2,
'ftputils.php' => 2,
'removeaction.php' => 2,
'objectstorage.php' => 2,
'funstafftikabundle.php' => 2,
'adodb-error.inc.php' => 2,
'adodb-errorhandler.inc.php' => 2,
'name.php' => 2,
'adodb-errorpear.inc.php' => 2,
'adodb-exceptions.inc.php' => 2,
'adodb-iterator.inc.php' => 2,
'adodb-lib.inc.php' => 2,
'directoryinterface.php' => 2,
'adodb-memcache.lib.inc.php' => 2,
'adodb-pager.inc.php' => 2,
'adodb-pear.inc.php' => 2,
'adodb-perf.inc.php' => 2,
'adodb-php4.inc.php' => 2,
'adodb-time.inc.php' => 2,
'adodb-xmlschema.inc.php' => 2,
'ftpparser.php' => 2,
'tohtml.inc.php' => 2,
'ftpfile.php' => 2,
'ftpcomponent.php' => 2,
'cpfvalidator.php' => 2,
'xmlschema03.dtd' => 2,
'xmlschema.dtd' => 2,
'cnpjvalidator.php' => 2,
'frameworkbundle.php' => 2,
'helloworld' => 2,
'toexport.inc.php' => 2,
'rsfilter.inc.php' => 2,
'pivottable.inc.php' => 2,
'adodb.inc.php' => 2,
'license~' => 2,
'adodb-xmlschema03.inc.php' => 2,
'todo.php' => 2,
'builder.sh' => 2,
'bigfootcontextbundle.php' => 2,
'iterator.php' => 2,
'phpunit.xml~' => 2,
'inlinewidgetsbehavior.php' => 2,
'favorites.php' => 2,
'glob.php' => 2,
'403.html' => 2,
'example-config.json' => 2,
'ajaxsubmitbutton.php' => 2,
'viewserviceprovider.php' => 2,
'guzzleserviceprovider.php' => 2,
'txt.todo' => 2,
'filesessionhandler.php' => 2,
'changelog.rnd' => 2,
'markdown_extended.php' => 2,
'atlassian-ide-plugin.xml' => 2,
'.coveragerc' => 2,
'registry.hh' => 2,
'git_hooks' => 2,
'umeditorasset.php' => 2,
'querystring.php' => 2,
'umeditoraction.php' => 2,
'workflowbundle.php' => 2,
'umeditor.php' => 2,
'tox.ini' => 2,
'layerasset.php' => 2,
'query' => 2,
'.phpmetrics.yml.dist' => 2,
'example.codeception.yml' => 2,
'example.codeception.dist.yml' => 2,
'drone.yml' => 2,
'themeserviceprovider.php' => 2,
'simplenode.php' => 2,
'databasesessionhandler.php' => 2,
'minnelli.php' => 2,
'm.php' => 2,
'batch.php' => 2,
'manual-init.php' => 2,
'readme-fr' => 2,
'screenshot2.png' => 2,
'readme-header.jpg' => 2,
'mathpublisher.php' => 2,
'install_ext.sh' => 2,
'extplorer.php' => 2,
'.local.vimrc' => 2,
'phpunit-unit.xml' => 2,
'mark.php' => 2,
'memoize.php' => 2,
'openskyldapbundle.php' => 2,
'setup.json' => 2,
'elmo' => 2,
'reader.hh' => 2,
'ladder.php' => 2,
'edituser.php' => 2,
'ez_sql_help.htm' => 2,
'csrftoken.php' => 2,
'ez_sql_with_smarty.html' => 2,
'shibbolethbundle.php' => 2,
'smsgateway.php' => 2,
'shorten.php' => 2,
'lists.php' => 2,
'500.php' => 2,
'responder.php' => 2,
'createqueryhelper.php' => 2,
'cookiesessionhandler.php' => 2,
'ipv4.php' => 2,
'guild.php' => 2,
'.scruntizer.yml' => 2,
'filesystemexception.php' => 2,
'raw.php' => 2,
'build.user.xml' => 2,
'build.simpletest.xml' => 2,
'vfconfig.default.php' => 2,
'build.registry.xml' => 2,
'config.default.ini' => 2,
'build.install.xml' => 2,
'shared.php' => 2,
'build.files.xml' => 2,
'zoo.php' => 2,
'kachkaevassetsversionbundle.php' => 2,
'build.features.xml' => 2,
'.build-readme' => 2,
'oembedfacade.php' => 2,
'build.database.xml' => 2,
'callqueuedhandler.php' => 2,
'assetsversionmanager.php' => 2,
'location.php' => 2,
'.exclude' => 2,
'abstractmessage.php' => 2,
'temporary.php' => 2,
'gergelypolonkaismssenderbundle.php' => 2,
'domutils.php' => 2,
'material.php' => 2,
'vars.php' => 2,
'eventserviceprovider.php' => 2,
'accesstoken.php' => 2,
'console.bat' => 2,
'typeextensioninterface.php' => 2,
'build.cron.xml' => 2,
'abstractapi.php' => 2,
'icbasemailbundle.php' => 2,
'example.csv' => 2,
'dict.php' => 2,
'avalertifybundle.php' => 2,
'dbobject.php' => 2,
'ticker.php' => 2,
'mapiterator.php' => 2,
'parsercsv.php' => 2,
'net.php' => 2,
'namespace.php' => 2,
'discount.php' => 2,
'files.php' => 2,
'town.php' => 2,
'helloworld.xml' => 2,
'symlinker.php' => 2,
'pkg_content.xml' => 2,
'scurvy.php' => 2,
'pkg_finder.xml' => 2,
'artist.php' => 2,
'testdox' => 2,
'undefined.php' => 2,
'example.aliases.drushrc.php' => 2,
'stylesheet.css' => 2,
'mockplugin.php' => 2,
'messagebuilder.php' => 2,
'attribute.php' => 2,
'installer' => 2,
'facebookbundle.php' => 2,
'readme_confirm' => 2,
'streaminterface.php' => 2,
'box.phar' => 2,
'index.twig' => 2,
'requires.php' => 2,
'admin.tpl' => 2,
'pkg_media.xml' => 2,
'registrybundle.php' => 2,
'paginationbundle.php' => 2,
'icontainer.php' => 2,
'forgotpassword.php' => 2,
'pdowrapper.php' => 2,
'span.php' => 2,
'subdirective.php' => 2,
'httpkernel_example.php' => 2,
'datetimepickerwidget.php' => 2,
'multiimageasset.php' => 2,
'tex2png.php' => 2,
'repositoryinitializer.php' => 2,
'test_index.php' => 2,
'repositoryinitializerinterface.php' => 2,
'repositorymanager.php' => 2,
'dot.htaccess' => 2,
'_heystack_subsystem' => 2,
'arrays.php' => 2,
'objectwrapper.php' => 2,
'translit.php' => 2,
'unit.bat' => 2,
'sensiyamlguibundle.php' => 2,
'.thinframerc' => 2,
'composer.bat' => 2,
'venomfile' => 2,
'imagex.php' => 2,
'default.png' => 2,
'mopabootstrapbundle.php' => 2,
'bisonlabnoormbundle.php' => 2,
'xsolvebootstrapcrudbundle.php' => 2,
'log.class.php' => 2,
'bisonlabsugarcrmbundle.php' => 2,
'build.cache.xml' => 2,
'jsoneditor.php' => 2,
'multiimage.php' => 2,
'metas.php' => 2,
'hook' => 2,
'travis.setup.php' => 2,
'optiontrait.php' => 2,
'pivotrecord.php' => 2,
'errcode.php' => 2,
'mmsortable.php' => 2,
'galleryasset.php' => 2,
'optionable.php' => 2,
'querybuilderasset.php' => 2,
'smser.php' => 2,
'querybuilderform.php' => 2,
'captchabuilder.php' => 2,
'csrf.php' => 2,
'captchabuilderinterface.php' => 2,
'quickstart' => 2,
'imagefilehandler.php' => 2,
'phrasebuilder.php' => 2,
'errormanager.php' => 2,
'messagetakecontrol.php' => 2,
'markdownasset.php' => 2,
'phpunit.xml.default' => 2,
'yii2fullcalendar.php' => 2,
'imagehandler.php' => 2,
'bootstrapclass.php' => 2,
'gregwarimagebundle.php' => 2,
'gregwarformbundle.php' => 2,
'phrasebuilderinterface.php' => 2,
'postindicator.php' => 2,
'parserexception.php' => 2,
'parserdata.php' => 2,
'restresponse.php' => 2,
'formidable.php' => 2,
'dataform.php' => 2,
'jsoneditorasset.php' => 2,
'sidenavasset.php' => 2,
'controllerexception.php' => 2,
'settings_example.php' => 2,
'driverexception.php' => 2,
'ares.php' => 2,
'contenttype.php' => 2,
'facetquery.php' => 2,
'eselect2.php' => 2,
'phpconfig.php' => 2,
'testhelper.php' => 2,
'bootstrapswitch.php' => 2,
'_toolkit_loader.php' => 2,
'filecache.php' => 2,
'reference' => 2,
'swagger-spec.json' => 2,
'advanced_settings_example.php' => 2,
'parallel.php' => 2,
'functions.inc.php' => 2,
'git-deploy' => 2,
'default' => 2,
'kitpagescmsbundle.php' => 2,
'cloudfiles_http.php' => 2,
'kitpagescmsevents.php' => 2,
'amppdfcrowdbundle.php' => 2,
'cloudfiles_exceptions.php' => 2,
'cloudfiles.php' => 2,
'basket.php' => 2,
'opentbsbundle.php' => 2,
'upgrade2.0' => 2,
'ip2location.php' => 2,
'mediawiki.php' => 2,
'phpcs.phar' => 2,
'test.csv' => 2,
'phpqa' => 2,
'parsedown.php' => 2,
'treewidget.php' => 2,
'abstractvalidator.php' => 2,
'bcrypthasher.php' => 2,
'galleryassets.php' => 2,
'integration.phpunit.xml' => 2,
'translate.sh' => 2,
'vardumper.php' => 2,
'pushover.php' => 2,
'migrate.bat' => 2,
'forbiddenexception.php' => 2,
'html2pdf.class.php' => 2,
'drivernotinstalledexception.php' => 2,
'ntlmsoapclient.php' => 2,
'exchangewebservices.php' => 2,
'ossexample.php' => 2,
'anonym' => 2,
'timehelper.php' => 2,
'phpmetrics.yml.dist' => 2,
'ewstype.php' => 2,
'searchinterface.php' => 2,
'ipdata.php' => 2,
'paymentrequest.php' => 2,
'xmlresponse.php' => 2,
'streamedresponse.php' => 2,
'ewsautodiscover.php' => 2,
'filehelper.php' => 2,
'eventexception.php' => 2,
'hellowidget.php' => 2,
'dynamicrouter.php' => 2,
'ews_exception.php' => 2,
'htmlpurifier.php' => 2,
'all_tests.php' => 2,
'pinyin.php' => 2,
'formasset.php' => 2,
'ftpprotocol.php' => 2,
'localtest.sh' => 2,
'egmapbounds.php' => 2,
'instantiatable.php' => 2,
'validateinterface.php' => 2,
'excerpt.php' => 2,
'500.html' => 2,
'strengthvalidatorasset.php' => 2,
'presets.php' => 2,
'egmapbase.php' => 2,
'configurationmanager.php' => 2,
'sanitizeinterface.php' => 2,
'footer.html' => 2,
'example_base_ruleset.xml' => 2,
'configure.ac' => 2,
'webhook.php' => 2,
'typeaheadbasic.php' => 2,
'crudcontroller.php' => 2,
'tinymcelanguageasset.php' => 2,
'swiftmailercomponent.php' => 2,
'eventmanagerinterface.php' => 2,
'phptemplate.php' => 2,
'keywords.php' => 2,
'debugbundle.php' => 2,
'extend.php' => 2,
'dashboard.html' => 2,
'github.png' => 2,
'egmapapikeylist.php' => 2,
'passwordinput.php' => 2,
'.bashrc' => 2,
'abstractstorage.php' => 2,
'documentup.json' => 2,
'init.php.example' => 2,
'passwordinputasset.php' => 2,
'.scrutinizer' => 2,
'class.jbdump.php' => 2,
'_template.php' => 2,
'performance' => 2,
'example_drupal7_ruleset.xml' => 2,
'bazingajqueryuibundle.php' => 2,
'weixinauth.php' => 2,
'browscapbundle.php' => 2,
'strengthvalidator.php' => 2,
'weiboauth.php' => 2,
'jjsgeonamesbundle.php' => 2,
'testinit.sh' => 2,
'renrenauth.php' => 2,
'go.sh' => 2,
'escapeinterface.php' => 2,
'cartbundle.php' => 2,
'imperaviredactorwidget.php' => 2,
'lang.inc.php' => 2,
'moufla.php' => 2,
'bootstrap.min.js' => 2,
'queryengine' => 2,
'data.inc.php' => 2,
'routedependencyresolvertrait.php' => 2,
'generatorsserviceprovider.php' => 2,
'filealreadyexistsexception.php' => 2,
'switchinput.php' => 2,
'objectcollection.php' => 2,
'template1.tpl' => 2,
'controllergenerator.php' => 2,
'spinnerasset.php' => 2,
'ornicarapcbundle.php' => 2,
'qqauth.php' => 2,
'konsole' => 2,
'chameleon.php' => 2,
'egmappoint.php' => 2,
'invoice.html' => 2,
'pdfdocument.php' => 2,
'template.tpl' => 2,
'template2.tpl' => 2,
'egmapsize.php' => 2,
'zf2-license' => 2,
'dbconnection.php' => 2,
'viewgenerator.php' => 2,
'seedgenerator.php' => 2,
'egmaprectangle.php' => 2,
'negotiator.php' => 2,
'scaffoldgenerator.php' => 2,
'config.php.default' => 2,
'egmapcircle.php' => 2,
'requestgenerator.php' => 2,
'pivotgenerator.php' => 2,
'mailerservicecompilerpass.php' => 2,
'splash.png' => 2,
'renderercompilerpass.php' => 2,
'egmappolylineencoder.php' => 2,
'autocompleteajax.php' => 2,
'egmappolygon.php' => 2,
'wikibasequeryengine.mw.php' => 2,
'template3.tpl' => 2,
'wikibasequeryengine.php' => 2,
'modelgenerator.php' => 2,
'responsefactory.php' => 2,
'phpda.yml.dist' => 2,
'installerplugin.php' => 2,
'cssparse.css' => 2,
'locatorinterface.php' => 2,
'nospam_ajax.php' => 2,
'renderinterface.php' => 2,
'tokeninterface.php' => 2,
'webservicecontext.php' => 2,
'wp-cli.sample.yml' => 2,
'flags.php' => 2,
'wp-cli-ssh.php' => 2,
'groupgridview.php' => 2,
'languageinterface.php' => 2,
'mapinterface.php' => 2,
'databaseinterface.php' => 2,
'laelapsgearmanbundle.php' => 2,
'fields.php' => 2,
'readme-ptbr' => 2,
'cleanup.php' => 2,
'phpthumb.unsharp.php' => 2,
'arrayloader.php' => 2,
'phpthumb.ico.php' => 2,
'phpthumb.gif.php' => 2,
'schemeinterface.php' => 2,
'editablecolumnasset.php' => 2,
'relations.php' => 2,
'cacheiteminterface.php' => 2,
'conditionoperator.php' => 2,
'registryinterface.php' => 2,
'php_errors.log' => 2,
'create.sql' => 2,
'changes 5.7.4' => 2,
'feed.xml' => 2,
'_config.yml' => 2,
'packagemanager.php' => 2,
'baserelation.php' => 2,
'messageinterface.php' => 2,
'lightasset.php' => 2,
'kindeditorassets.php' => 2,
'index.htm' => 2,
'fullpageasset.php' => 2,
'twig-gettext-extractor' => 2,
'pdfresponse.php' => 2,
'filterhelper.php' => 2,
'configmanager.php' => 2,
'viewstash.php' => 2,
'readme.tpl' => 2,
'widgettrait.php' => 2,
'phpthumb.functions.php' => 2,
'badmethodcallexception.php' => 2,
'slick.php' => 2,
'changelog.json' => 2,
'templateinterface.php' => 2,
'maintainer.php' => 2,
'adcomponentbundle.php' => 2,
'avrotranslatorbundle.php' => 2,
'cleantalk.custom.php' => 2,
'htmlformfield.php' => 2,
'soap-wsse.php' => 2,
'jdareclankbundle.php' => 2,
'readme-es' => 2,
'id_rsa.enc' => 2,
'mailerinterface.php' => 2,
'braintreeasset.php' => 2,
'messages.html' => 2,
'browscap.php' => 2,
'new-package.php' => 2,
'styles.less' => 2,
'pickadateasset.php' => 2,
'p.php' => 2,
'egmap.php' => 2,
'ubiquitous-language' => 2,
'shutdown.php' => 2,
'versioninfo' => 2,
'phpthumb.filters.php' => 2,
'avrosupportbundle.php' => 2,
'phpthumb.class.php' => 2,
'.coveralls' => 2,
'phpthumb.bmp.php' => 2,
'taveopolishextensionsbundle.php' => 2,
'phpthumb.php' => 2,
'besimplesoapbundle.php' => 2,
'thelia_inet.fmt' => 2,
'cacheplugin.php' => 2,
'resourceinterface.php' => 2,
'rbacasset.php' => 2,
'themeview.php' => 2,
'rscandir.php' => 2,
'schematic.php' => 2,
'gruntconfig.js' => 2,
'xupload.php' => 2,
'jqueryfiletree.css' => 2,
'jqueryfiletree.js' => 2,
'stack.php' => 2,
'braintreeform.php' => 2,
'wa72jsonrpcbundle.php' => 2,
'downloads.php' => 2,
'switcher.php' => 2,
'consolegenerator.php' => 2,
'standardlist.php' => 2,
'properties' => 2,
'egmapinfobox.php' => 2,
'resolveresponse.php' => 2,
'runtimeexception.php' => 2,
'yamlfileloader.php' => 2,
'c3.php' => 2,
'egmapinfowindow.php' => 2,
'propertyaccess.php' => 2,
'symfony1.php' => 2,
'slack.php' => 2,
'sdk.php' => 2,
'egmapgeocodedaddress.php' => 2,
'dbal.php' => 2,
'commandinterface.php' => 2,
'resolvequery.php' => 2,
'development.config.php.dist' => 2,
'.pre-commit-config.yaml' => 2,
'launcher.php' => 2,
'contentmodule.php' => 2,
'readresponse.php' => 2,
'multiresponse.php' => 2,
'schemaresponse.php' => 2,
'craft' => 2,
'egmapkmlservice.php' => 2,
'app.log' => 2,
'usermodel.php' => 2,
'contextmenuasset.php' => 2,
'linkedin.php' => 2,
'filelogger.php' => 2,
'mrpstripewebhookbundle.php' => 2,
'starratingasset.php' => 2,
'save.php' => 2,
'travis_php.ini' => 2,
'.lvimrc' => 2,
'rangeinput.php' => 2,
'egmapmarkerimage.php' => 2,
'unittest.xml' => 2,
'pnotifyasset.php' => 2,
'wepay.php' => 2,
'canvasblobasset.php' => 2,
'egmapevent.php' => 2,
'egmapgeocodetool.php' => 2,
'symfony-shim.php' => 2,
'envelope.png' => 2,
'issues' => 2,
'fpntagbundle.php' => 2,
'developmentmodecontroller.php' => 2,
'edit.php' => 2,
'phpmd_ruleset.xml' => 2,
'shell' => 2,
'affix.php' => 2,
'array2xml.php' => 2,
'factualfilter.php' => 2,
'factualcolumnschema.php' => 2,
'newscoopfacebooknewscoopbundle.php' => 2,
'iconasset.php' => 2,
'compilerpass.php' => 2,
'egmapmarker.php' => 2,
'ruianuploadifybundle.php' => 2,
'factualplace.php' => 2,
'factualcircle.php' => 2,
'gradlew' => 2,
'gradlew.bat' => 2,
'bigfootcontentbundle.php' => 2,
'lexikfixturesmapperbundle.php' => 2,
'factualapiexception.php' => 2,
'resolverinterface.php' => 2,
'egmaplatloncontrol.php' => 2,
'dataproviderinterface.php' => 2,
'tokens.php' => 2,
'innovaangularuibootstrapbundle.php' => 2,
'geocoderwrapper.php' => 2,
'contentprovider.php' => 2,
'engine.php' => 2,
'httpcache.php' => 2,
'fosmessagebundle.php' => 2,
'depdrop.php' => 2,
'filtergroup.php' => 2,
'fieldfilter.php' => 2,
'ant' => 2,
'example.phpspec.yml' => 2,
'dataset.php' => 2,
'egmapmarkerclusterer.php' => 2,
'urlroute.php' => 2,
'factualtest.php' => 2,
'egmapkeydragzoom.php' => 2,
'riak.proto' => 2,
'factualresponse.php' => 2,
'fosrestbundle.php' => 2,
'fostwitterbundle.php' => 2,
'relaynode.php' => 2,
'colorinput.php' => 2,
'factualquery.php' => 2,
'alertblock.php' => 2,
'datecontrol.php' => 2,
'loglevel.php' => 2,
'flush.php' => 2,
'moduleevent.php' => 2,
'composer-update.sh' => 2,
'egmapcontrolposition.php' => 2,
'fileinfo.php' => 2,
'glial' => 2,
'class.csstidy_print.php' => 2,
'zeroemcurlbundle.php' => 2,
'egmapmarkerwithlabel.php' => 2,
'redirectexception.php' => 2,
'marionette.php' => 2,
'urlparser.php' => 2,
'test2' => 2,
'class.csstidy_optimise.php' => 2,
'class.csstidy.php' => 2,
'semanticresultformats.parser.php' => 2,
'services.json' => 2,
'marionettecollection.php' => 2,
'marionettemodel.php' => 2,
'sample_bootstrap.php' => 2,
'overview.php' => 2,
'resque-scheduler.php' => 2,
'upgradeassets.sh' => 2,
'iconpickerasset.php' => 2,
'semanticresultformats.php' => 2,
'egmapcoord.php' => 2,
'descriptionlist.php' => 2,
'chameleon.i18n.php' => 2,
'smoothscroll.php' => 2,
'doubanauth.php' => 2,
'semanticresultformats.utils.php' => 2,
'scrollablebox.php' => 2,
'scrollspy.php' => 2,
'overlay.php' => 2,
'overflowbox.php' => 2,
'moufla.xml' => 2,
'offcanvas.php' => 2,
'build-release.sh' => 2,
'egmapclient.php' => 2,
'ibrowsnewsletterbundle.php' => 2,
'touchspinasset.php' => 2,
'close.php' => 2,
'addressinterface.php' => 2,
'perl-image-exiftool.spec' => 2,
'css_optimiser.php' => 2,
'maintenancecontroller.php' => 2,
'blockprovidercompilerpass.php' => 2,
'semanticresultformats.settings.php' => 2,
'exiftool' => 2,
'active_record.info' => 2,
'videoconverter.php' => 2,
'gnu-lgpl' => 2,
'report.xml' => 2,
'egmapdirection.php' => 2,
'requestlistener.php' => 2,
'egmapdirectionrenderer.php' => 2,
'login_script_db.sql' => 2,
'sxgeocitymax.dat' => 2,
'egmapdirectionwaypoint.php' => 2,
'egmapelevationinfo.php' => 2,
'pedroteixeiragridbundle.php' => 2,
'migrationinterface.php' => 2,
'oneupuploaderbundle.php' => 2,
'icache.php' => 2,
'active_record.install' => 2,
'active_record.module' => 2,
'fixtures.yaml' => 2,
'demo2.php' => 2,
'.gitchange' => 2,
'dateformatterasset.php' => 2,
'translator' => 2,
'datecontrolasset.php' => 2,
'semanticresultformats.hooks.php' => 2,
'themekrajeeasset.php' => 2,
'semanticresultformats.i18n.magic.php' => 2,
'jnsxhprofbundle.php' => 2,
'rules.php' => 2,
'callout.php' => 2,
'semanticresultformats.i18n.php' => 2,
'rulefactory.php' => 2,
'phploc.xml' => 2,
'build.json' => 2,
'mrcore.php' => 1,
'mqmassetbundle.php' => 1,
'readme.devel' => 1,
'phpmig' => 1,
'streams' => 1,
'upf.php' => 1,
'wikihtml.php' => 1,
'readme_examples' => 1,
'just-backup-btrfs' => 1,
'composer.json.orig' => 1,
'error-0011-in.jsonld' => 1,
'bootstrappresenter.php' => 1,
'micromvc.php' => 1,
'readme_details' => 1,
'caribou.sh' => 1,
'expand-0055-out.jsonld' => 1,
'magento_sales.zip' => 1,
'providers' => 1,
'zfc.php' => 1,
'phpunit.full-urls.xml' => 1,
'phonegapbuildapi.php' => 1,
'classes-generator.php' => 1,
'bbceditorbundle.php' => 1,
'caribou.php' => 1,
'nbbcbundle.php' => 1,
'changelog.sh' => 1,
'error-0009-in.jsonld' => 1,
'error-0012-in.jsonld' => 1,
'ez-jwt.php' => 1,
'error-0010-in.jsonld' => 1,
'mqmpaginationbundle.php' => 1,
'tpmpaymentslimcdbundle.php' => 1,
'mqmsortbundle.php' => 1,
'sqlnet.log' => 1,
'expand-0011-in.jsonld' => 1,
'expand-0056-in.jsonld' => 1,
'expand-0071-out.jsonld' => 1,
'expand-0074-out.jsonld' => 1,
'expand-0074-in.jsonld' => 1,
'expand-0073-out.jsonld' => 1,
'expand-0073-in.jsonld' => 1,
'proxy-start.sh.erb' => 1,
'expand-0072-out.jsonld' => 1,
'generated_sample' => 1,
'mtmpersiandatebundle.php' => 1,
'jobby.php' => 1,
'proxy-config.sh.erb' => 1,
'provision.sh.erb' => 1,
'docker-container-ssh.sh.erb' => 1,
'remove' => 1,
'expand-0072-in.jsonld' => 1,
'vagrantfile.erb' => 1,
'migrationbundle.php' => 1,
'expand-0071-in.jsonld' => 1,
'phpunit.composer.xml' => 1,
'.local-dev-vm-env.dist' => 1,
'fixturehelpercommand.php' => 1,
'po2json.php' => 1,
'contentmodelmetadatagenerator.php' => 1,
'fixturehelperdbfixturemanager.php' => 1,
'ownerbehavior.php' => 1,
'benefits' => 1,
'expand-0070-out.jsonld' => 1,
'compact-0072-in.jsonld' => 1,
'zephyradmincorebundle.php' => 1,
'expand-0070-in.jsonld' => 1,
'expand-0069-out.jsonld' => 1,
'migrationsprovider.php' => 1,
'expand-0075-in.jsonld' => 1,
'expand-0068-out.jsonld' => 1,
'casciiart.php' => 1,
'flatten-0007-in.jsonld' => 1,
'flatten-0006-out.jsonld' => 1,
'flatten-0006-in.jsonld' => 1,
'flatten-0005-out.jsonld' => 1,
'flatten-0005-in.jsonld' => 1,
'compact-0071-in.jsonld' => 1,
'flatten-0004-out.jsonld' => 1,
'flatten-0004-in.jsonld' => 1,
'flatten-0003-out.jsonld' => 1,
'flatten-0003-in.jsonld' => 1,
'flatten-0002-out.jsonld' => 1,
'flatten-0002-in.jsonld' => 1,
'flatten-0001-out.jsonld' => 1,
'compact-0071-out.jsonld' => 1,
'ccache.php' => 1,
'expand-0075-out.jsonld' => 1,
'chttpget.php' => 1,
'flatten-0001-in.jsonld' => 1,
'expand-manifest.jsonld' => 1,
'compact-0072-context.jsonld' => 1,
'expand-0078-out.jsonld' => 1,
'expand-0078-in.jsonld' => 1,
'expand-0077-out.jsonld' => 1,
'expand-0077-in.jsonld' => 1,
'expand-0077-context.jsonld' => 1,
'expand-0076-out.jsonld' => 1,
'cimage.php' => 1,
'cremoteimage.php' => 1,
'cwhitelist.php' => 1,
'expand-0076-in.jsonld' => 1,
'expand-0069-in.jsonld' => 1,
'expand-0068-in.jsonld' => 1,
'expand-0056-out.jsonld' => 1,
'expand-0060-in.jsonld' => 1,
'containerawareruleprovider.php' => 1,
'error-0005-in.jsonld' => 1,
'nucleusbusinessruleenginebundle.php' => 1,
'expand-0063-in.jsonld' => 1,
'expand-0062-out.jsonld' => 1,
'expand-0062-in.jsonld' => 1,
'error-0006-in.jsonld' => 1,
'expand-0061-out.jsonld' => 1,
'drawdrawbundle.php' => 1,
'expand-0061-in.jsonld' => 1,
'drawtesthelperbundle.php' => 1,
'error-0007-in.jsonld' => 1,
'expand-0060-out.jsonld' => 1,
'nucleuscorebundle.php' => 1,
'error-0008-in.jsonld' => 1,
'error-0004-in.jsonld' => 1,
'mplt.php' => 1,
'nucleusconsolebundle.php' => 1,
'oxymeltest.php' => 1,
'nucleusmigrationbundle.php' => 1,
'drawswaggerbundle.php' => 1,
'oxymel.php' => 1,
'run-unit-tests.php' => 1,
'expand-0059-out.jsonld' => 1,
'expand-0059-in.jsonld' => 1,
'expand-0058-out.jsonld' => 1,
'expand-0058-in.jsonld' => 1,
'expand-0057-out.jsonld' => 1,
'expand-0057-in.jsonld' => 1,
'jmsserializerlistener.php' => 1,
'nucleusbinderbundle.php' => 1,
'checksums' => 1,
'expand-0067-out.jsonld' => 1,
'twitterwidgetbundle.php' => 1,
'pagebundle.php' => 1,
'unity.php' => 1,
'tiimber' => 1,
'publish-gh-pages.rb' => 1,
'compact-0072-out.jsonld' => 1,
'compact-manifest.jsonld' => 1,
'error-0001-in.jsonld' => 1,
'simpletreeview.php' => 1,
'expand-0067-in.jsonld' => 1,
'ncelephantiobundle.php' => 1,
'expand-0066-out.jsonld' => 1,
'awl.yml' => 1,
'fixntest' => 1,
'metrics' => 1,
'expand-0066-in.jsonld' => 1,
'error-0003-in.jsonld' => 1,
'expand-0065-out.jsonld' => 1,
'expand-0065-in.jsonld' => 1,
'wikiphp.php' => 1,
'jeandejeanapiparisbundle.php' => 1,
'berksfile.lock' => 1,
'error-0002-in.jsonld' => 1,
'consoleapp.php' => 1,
'parse_loop_example.php' => 1,
'error-0003-ctx.jsonld' => 1,
'parse_serialize_example.php' => 1,
'expand-0064-out.jsonld' => 1,
'expand-0064-in.jsonld' => 1,
'phpspec-code_coverage.yml' => 1,
'expand-0063-out.jsonld' => 1,
'expand-0055-in.jsonld' => 1,
'expand-0040-out.jsonld' => 1,
'error-0013-in.jsonld' => 1,
'stringgeneratorbundle.php' => 1,
'nahoyimportbundle.php' => 1,
'kashflow.php' => 1,
'expand-0020-out.jsonld' => 1,
'license_mit' => 1,
'error-0039-in.jsonld' => 1,
'dbpatcherbundle.php' => 1,
'testutilitybundle.php' => 1,
'error-0041-in.jsonld' => 1,
'namshiutilitybundle.php' => 1,
'error-0038-in.jsonld' => 1,
'namshivoyeurbundle.php' => 1,
'example_validator.php' => 1,
'assetloader.php' => 1,
'expand-0021-in.jsonld' => 1,
'error-0037-in.jsonld' => 1,
'error-0040-in.jsonld' => 1,
'expand-0020-in.jsonld' => 1,
'error-0036-in.jsonld' => 1,
'expand-0018-in.jsonld' => 1,
'expand-0016-out.jsonld' => 1,
'expand-0017-in.jsonld' => 1,
'mvrhovdoctrineextensionsbundle.php' => 1,
'datadotgovadminapi_sdk.php' => 1,
'plugin_template.php' => 1,
'readme.cakephp' => 1,
'expand-0017-out.jsonld' => 1,
'phpmd-tests.xml' => 1,
'hezarfendenetmenbundle.php' => 1,
'error-0042-context.jsonld' => 1,
'expand-0018-out.jsonld' => 1,
'expand-0019-in.jsonld' => 1,
'quebolu.sql' => 1,
'expand-0019-out.jsonld' => 1,
'qb.php' => 1,
'social-counter-class.php' => 1,
'expand-0021-out.jsonld' => 1,
'expand-0022-in.jsonld' => 1,
'uml.xmi' => 1,
'treeimage.php' => 1,
'expand-0026-out.jsonld' => 1,
'expand-0027-in.jsonld' => 1,
'adoptableroutinginterface.php' => 1,
'routeentity.php' => 1,
'expand-0027-out.jsonld' => 1,
'routefield.php' => 1,
'sonataadminbundle.php' => 1,
'instagramstrategy.php' => 1,
'expand-0026-in.jsonld' => 1,
'webicon.ico' => 1,
'routinginterface.php' => 1,
'mpcatalogbundle.php' => 1,
'error-0035-in.jsonld' => 1,
'segment.php' => 1,
'expand-0028-in.jsonld' => 1,
'expand-0028-out.jsonld' => 1,
'phycachebundle.php' => 1,
'githook.php' => 1,
'expand-0022-out.jsonld' => 1,
'expand-0025-in.jsonld' => 1,
'credentials.inc.php' => 1,
'pwstrengthasset.php' => 1,
'expand-0023-in.jsonld' => 1,
'expand-0023-out.jsonld' => 1,
'expand-0024-in.jsonld' => 1,
'nano.rocks' => 1,
'expand-0024-out.jsonld' => 1,
'messenger.php' => 1,
'index-cancel.php' => 1,
'elfindervolumeflysystemext.php' => 1,
'pwstrength.php' => 1,
'expand-0025-out.jsonld' => 1,
'naonedoaipmhserverbundle.php' => 1,
'pkr.php' => 1,
'index-sendpayment.php' => 1,
'index-query.php' => 1,
'mvrhovresourcebundle.php' => 1,
'nzedbbase.php' => 1,
'customerio.php' => 1,
'jqueryfileuploadbundle.php' => 1,
'expand-0009-in.jsonld' => 1,
'expand-0008-out.jsonld' => 1,
'expand-0008-in.jsonld' => 1,
'17monipdb.dat' => 1,
'expand-0007-out.jsonld' => 1,
'expand-0014-out.jsonld' => 1,
'expand-0015-in.jsonld' => 1,
'expand-0009-out.jsonld' => 1,
'expand-0007-in.jsonld' => 1,
'client.class.php' => 1,
'api.class.php' => 1,
'version.xml' => 1,
'expand-0006-out.jsonld' => 1,
'expand-0006-in.jsonld' => 1,
'menuhelper.php' => 1,
'travis_init.sh' => 1,
'expand-0014-in.jsonld' => 1,
'expand-0005-out.jsonld' => 1,
'commitlog' => 1,
'expand-0012-in.jsonld' => 1,
'ssdbsession.php' => 1,
'expand-0012-out.jsonld' => 1,
'rock.php' => 1,
'expand-0010-out.jsonld' => 1,
'plugin_manager.php' => 1,
'config.new.php' => 1,
'expand-0010-in.jsonld' => 1,
'expand-0013-out.jsonld' => 1,
'function_mock.php' => 1,
'pdfmerger.php' => 1,
'hamark.com' => 1,
'myxaxafilesearchbundle.php' => 1,
'run-demo' => 1,
'dropdownlte.php' => 1,
'expand-0013-in.jsonld' => 1,
'wkhtmltopdf' => 1,
'expand-0005-in.jsonld' => 1,
'upcommand.php' => 1,
'n1c0officialtextbundle.php' => 1,
'expand-0001-in.jsonld' => 1,
'error-manifest.jsonld' => 1,
'mwtagadminbundle.php' => 1,
'passwordgenerator.inc.php' => 1,
'yahoo_business_browser.php' => 1,
'n1c0dissertationbundle.php' => 1,
'n1c0lessonbundle.php' => 1,
'expand-0015-out.jsonld' => 1,
'semanticbundle.php' => 1,
'n1c0quotebundle.php' => 1,
'mwshortcodebundle.php' => 1,
'expand-0016-in.jsonld' => 1,
'yajit.php' => 1,
'error-0043-in.jsonld' => 1,
'error-0042-in.jsonld' => 1,
'up.php' => 1,
'uagent.php' => 1,
'conductor' => 1,
'expand-0004-out.jsonld' => 1,
'mybuildercronosbundle.php' => 1,
'expand-0004-in.jsonld' => 1,
'expand-0003-out.jsonld' => 1,
'navlte.php' => 1,
'abstractsoapclient.php' => 1,
'wkhtmltoimage' => 1,
'domainstatus.php' => 1,
'expand-0003-in.jsonld' => 1,
'soapclientinterface.php' => 1,
'nscontactbundle.php' => 1,
'expand-0002-out.jsonld' => 1,
'usernamestatus.php' => 1,
'expand-0002-in.jsonld' => 1,
'c' => 1,
'conductor-logo.png' => 1,
't' => 1,
'expand-0001-out.jsonld' => 1,
'narogasearchbundle.php' => 1,
'expand-0029-in.jsonld' => 1,
'expand-0054-out.jsonld' => 1,
'recipexport.php' => 1,
'expand-0043-in.jsonld' => 1,
'expand-0043-out.jsonld' => 1,
'expand-0044-in.jsonld' => 1,
'expand-0044-out.jsonld' => 1,
'error-0016-in.jsonld' => 1,
'phpunit-shutdown.php' => 1,
'authdatasample.ini' => 1,
'error-0018-in.jsonld' => 1,
'error-0015-in.jsonld' => 1,
'expand-0045-in.jsonld' => 1,
'expand-0045-out.jsonld' => 1,
'user.properties' => 1,
'expand-0046-in.jsonld' => 1,
'mrt.sh' => 1,
'expand-0046-out.jsonld' => 1,
'error-0017-in.jsonld' => 1,
'error-0019-in.jsonld' => 1,
'expand-0047-out.jsonld' => 1,
'expand-0040-in.jsonld' => 1,
'error-0024-in.jsonld' => 1,
'globalstatedb.php' => 1,
'dbbatch.php' => 1,
'expand-0038-out.jsonld' => 1,
'error-0023-in.jsonld' => 1,
'expand-0039-in.jsonld' => 1,
'expand-0039-out.jsonld' => 1,
'expand-0011-out.jsonld' => 1,
'error-0020-in.jsonld' => 1,
'expand-0041-in.jsonld' => 1,
'expand-0041-out.jsonld' => 1,
'expand-0042-in.jsonld' => 1,
'expand-0042-out.jsonld' => 1,
'cwr.bat' => 1,
'error-0022-in.jsonld' => 1,
'error-0021-in.jsonld' => 1,
'expand-0047-in.jsonld' => 1,
'db-sync.phar' => 1,
'globalstateform.php' => 1,
'mremiurlshortenerbundle.php' => 1,
'keystone.php' => 1,
'expand-0052-out.jsonld' => 1,
'httpconnection.php' => 1,
'mssql.php' => 1,
'dbalinterface.php' => 1,
'expand-0053-in.jsonld' => 1,
'apiinterface.php' => 1,
'expand-0053-out.jsonld' => 1,
'nativeconnection.php' => 1,
'mremitemplatingextrabundle.php' => 1,
'mremidolistbundle.php' => 1,
'mremibootstrapbundle.php' => 1,
'csvtabletest.php' => 1,
'csvtable.php' => 1,
'graph.gif' => 1,
'expand-0054-in.jsonld' => 1,
'keystoneinterface.php' => 1,
'guest.php' => 1,
'autobahn.json' => 1,
'expand-0050-out.jsonld' => 1,
'error-0014-in.jsonld' => 1,
'expand-0048-in.jsonld' => 1,
'expand-0048-out.jsonld' => 1,
'mssqlstore.php' => 1,
'expand-0049-in.jsonld' => 1,
'expand-0049-out.jsonld' => 1,
'expand-0050-in.jsonld' => 1,
'expand-0051-in.jsonld' => 1,
'loginterface.php' => 1,
'mongostore.php' => 1,
'reqs' => 1,
'phrets.php' => 1,
'expand-0051-out.jsonld' => 1,
'apigen.config' => 1,
'dbstore.php' => 1,
'other.php' => 1,
'globalstatefile.php' => 1,
'gridbundle.php' => 1,
'error-0034-in.jsonld' => 1,
'auntyentity.php' => 1,
'mongojson.php' => 1,
'imdb_charts.class.php' => 1,
'element.json' => 1,
'expand-0032-out.jsonld' => 1,
'error-0032-in.jsonld' => 1,
'newscred.php' => 1,
'expand-0033-in.jsonld' => 1,
'imdb_movielist.class.php' => 1,
'expand-0031-out.jsonld' => 1,
'imdb_nowplaying.class.php' => 1,
'yiiaws.php' => 1,
'less.js' => 1,
'error-0031-in.jsonld' => 1,
'error-0030-in.jsonld' => 1,
'imdb_person.class.php' => 1,
'error-0029-in.jsonld' => 1,
'expand-0032-in.jsonld' => 1,
'expand-0031-in.jsonld' => 1,
'bootstrapper.min.less' => 1,
'expand-0029-out.jsonld' => 1,
'nass600cosmbundle.php' => 1,
'nass600lyricsbundle.php' => 1,
'ucnode.inc.php' => 1,
'sysconfig.inc.php' => 1,
'supports' => 1,
'nass600mediainfobundle.php' => 1,
'license.commercial' => 1,
'oai.php' => 1,
'error-0033-in.jsonld' => 1,
'expand-0030-in.jsonld' => 1,
'browseremulator.class.php' => 1,
'imdbxml.php' => 1,
'imdb_budget.class.php' => 1,
'chatserver.php' => 1,
'expand-0030-out.jsonld' => 1,
'muchomasfacilformbyemailbundle.php' => 1,
'imdb_trailers.class.php' => 1,
'bootstrapper.html' => 1,
'expand-0037-out.jsonld' => 1,
'sitemapinterface.php' => 1,
's3streamwrapper.php' => 1,
'pouyasoftdatebundle.php' => 1,
'expand-0035-out.jsonld' => 1,
'test_config.dist.json' => 1,
'openexchangeratesbundle.php' => 1,
'expand-0036-in.jsonld' => 1,
'pilot.class.php' => 1,
'expand-0036-out.jsonld' => 1,
'expand-0035-in.jsonld' => 1,
'pilot_person.class.php' => 1,
'mdashfilter.php' => 1,
'pilotsearch.class.php' => 1,
'mdash.php' => 1,
'cwr' => 1,
'globalstateinterface.php' => 1,
'expand-0037-in.jsonld' => 1,
'abstractgenerator.php' => 1,
'expand-0034-out.jsonld' => 1,
'imdbsearch.class.php' => 1,
'movie.php' => 1,
'mdb_base.class.php' => 1,
'mdb_config.class.php' => 1,
'error-0028-in.jsonld' => 1,
'error-0027-in.jsonld' => 1,
'mdb_request.class.php' => 1,
'error-0026-in.jsonld' => 1,
'msulistijophpseclibbundle.php' => 1,
'gulpfile.babel.js' => 1,
'resourcebag.php' => 1,
'movie_base.class.php' => 1,
'error-0025-in.jsonld' => 1,
'movieposterdb.class.php' => 1,
'person_base.class.php' => 1,
'expand-0033-out.jsonld' => 1,
'expand-0034-in.jsonld' => 1,
'google-api' => 1,
'expand-0052-in.jsonld' => 1,
'metatag.module' => 1,
'license_gplv3' => 1,
'reinstall_e.sh' => 1,
'json-patch-tests' => 1,
'normalize-0033-in.jsonld' => 1,
'normalize-0033-out.nq' => 1,
'normalize-0034-in.jsonld' => 1,
'normalize-0034-out.nq' => 1,
'.rock.yml' => 1,
'normalize-0035-in.jsonld' => 1,
'masterbaker.gemspec' => 1,
'syncdocs.sh' => 1,
'repackage.sh' => 1,
'package.xml.base' => 1,
'run_tests.php' => 1,
'build.xml.new' => 1,
'php_compiler.class.php' => 1,
'normalize-0035-out.nq' => 1,
'update-all' => 1,
'apidocvim' => 1,
'xreturnable.php' => 1,
'normalize-0036-in.jsonld' => 1,
'normalize-0036-out.nq' => 1,
'xcrudcontroller.php' => 1,
'normalize-0037-in.jsonld' => 1,
'normalize-0037-out.nq' => 1,
'local_tests.json' => 1,
'normalize-0032-out.nq' => 1,
'normalize-0038-in.jsonld' => 1,
'normalize-0028-in.jsonld' => 1,
'google_tag.libraries.yml' => 1,
'google_tag.install' => 1,
'google_tag.info.yml' => 1,
'normalize-0026-in.jsonld' => 1,
'sendemail.php' => 1,
'dateintervalvalidator.php' => 1,
'headerparamauth.php' => 1,
'normalize-0026-out.nq' => 1,
'normalize-0027-in.jsonld' => 1,
'normalize-0027-out.nq' => 1,
'normalize-0028-out.nq' => 1,
'normalize-0032-in.jsonld' => 1,
'x11-license' => 1,
'efullcalendar.php' => 1,
'mikemeierphpnodebridgebundle.php' => 1,
'mikemeiereasyauthbundle.php' => 1,
'simplexml_tests.json' => 1,
'normalize-0029-in.jsonld' => 1,
'normalize-0029-out.nq' => 1,
'normalize-0030-in.jsonld' => 1,
'normalize-0030-out.nq' => 1,
'normalize-0031-in.jsonld' => 1,
'normalize-0031-out.nq' => 1,
'translatable.php' => 1,
'normalize-0038-out.nq' => 1,
'google_tag.module' => 1,
'mzmailchimpbundle.php' => 1,
'msserializerbundle.php' => 1,
'sereal_spec.pod' => 1,
'readme.pod' => 1,
'rpcexception.php' => 1,
'msrpcbundle.php' => 1,
'msdoctrinetypesbundle.php' => 1,
'namespacing.php' => 1,
'mscachebundle.php' => 1,
'odin' => 1,
'mzpostmarkbundle.php' => 1,
'doctrinefixturesautonumberresetbundle.php' => 1,
'documenthash.php' => 1,
'std.include.php' => 1,
'normalize-0043-out.nq' => 1,
'travis_trigger' => 1,
'rdfmapper.php' => 1,
'normalize-0044-in.jsonld' => 1,
'normalize-0044-out.nq' => 1,
'normalize-0045-in.jsonld' => 1,
'normalize-0045-out.nq' => 1,
'normalize-0046-in.jsonld' => 1,
'normalize-0046-out.nq' => 1,
'normalize-0047-in.jsonld' => 1,
'mstestbundle.php' => 1,
'readabillity.php' => 1,
'wkhtmltopdf.php' => 1,
'normalize-0040-in.jsonld' => 1,
'pdfable.php' => 1,
'pdffile.php' => 1,
'packagescommand.php' => 1,
'packagecompressor.php' => 1,
'normalize-0039-in.jsonld' => 1,
'flushabledependency.php' => 1,
'attributedefaultspersister.php' => 1,
'rsa.php' => 1,
'noddy' => 1,
'normalize-0039-out.nq' => 1,
'normalize-0040-out.nq' => 1,
'mapgoogleasset.php' => 1,
'normalize-0041-in.jsonld' => 1,
'g2s' => 1,
'third-party' => 1,
'normalize-0041-out.nq' => 1,
'config-example.json' => 1,
'sshv' => 1,
'.scruitnizer.yml' => 1,
'normalize-0042-in.jsonld' => 1,
'normalize-0042-out.nq' => 1,
'mapyandexasset.php' => 1,
'normalize-0043-in.jsonld' => 1,
'google_tag.links.menu.yml' => 1,
'google_tag.permissions.yml' => 1,
'normalize-0048-in.jsonld' => 1,
'vsymfopaymentegopaybundle.php' => 1,
'xdebugtraceextension.php' => 1,
'xdebugtrace.php' => 1,
'normalize-0009-out.nq' => 1,
'typeconverter.php' => 1,
'normalize-0010-in.jsonld' => 1,
'normalize-0010-out.nq' => 1,
'vsymfopaymentperfectmoneybundle.php' => 1,
'normalize-0011-in.jsonld' => 1,
'vsymfopaymentpayeerbundle.php' => 1,
'vsymfopaymentokpaybundle.php' => 1,
'vsymfopaymentblockchainbundle.php' => 1,
'normalize-0009-in.jsonld' => 1,
'normalize-0011-out.nq' => 1,
'rapidsitemap.xml' => 1,
'normalize-0012-in.jsonld' => 1,
'normalize-0012-out.nq' => 1,
'normalize-0013-in.jsonld' => 1,
'rapidimage.xml' => 1,
'normalize-0013-out.nq' => 1,
'rapidimage.php' => 1,
'nginx.conf.default' => 1,
'normalize-0014-in.jsonld' => 1,
'token.tokens.inc' => 1,
'content.latte' => 1,
'error.latte' => 1,
'normalize-0014-out.nq' => 1,
'mg-events.php' => 1,
'normalize-0006-in.jsonld' => 1,
'firephp.php' => 1,
'blogwidget.php' => 1,
'normalize-0006-out.nq' => 1,
'unbox-logo.png' => 1,
'normalize-0007-in.jsonld' => 1,
'composer_path.func.php' => 1,
'integrated.json' => 1,
'normalize-0007-out.nq' => 1,
'style-guide' => 1,
'mgeventsrequirements.php' => 1,
'normalize-0008-out.nq' => 1,
'mg-cache.php' => 1,
'mgcacherouting.php' => 1,
'mgcacherequirements.php' => 1,
'convert-os.php' => 1,
'convert-engine.php' => 1,
'convert-devices.php' => 1,
'convert-browser.php' => 1,
'normalize-0008-in.jsonld' => 1,
'manual.en' => 1,
'manual.cs' => 1,
'aliasexpander.php' => 1,
'token.services.yml' => 1,
'normalize-0015-in.jsonld' => 1,
'google_tag.routing.yml' => 1,
'.travis-after-before-script.sh' => 1,
'redirect.info.yml' => 1,
'redirect.generate.inc' => 1,
'normalize-0021-in.jsonld' => 1,
'normalize-0021-out.nq' => 1,
'normalize-0022-in.jsonld' => 1,
'normalize-0022-out.nq' => 1,
'normalize-0023-in.jsonld' => 1,
'normalize-0023-out.nq' => 1,
'redirect.drush.inc' => 1,
'redirect.api.php' => 1,
'metatag.services.yml' => 1,
'redirect.install' => 1,
'metatag.routing.yml' => 1,
'metatag.permissions.yml' => 1,
'normalize-0024-in.jsonld' => 1,
'normalize-0024-out.nq' => 1,
'metatag.links.menu.yml' => 1,
'metatag.links.action.yml' => 1,
'normalize-0025-in.jsonld' => 1,
'metatag.install' => 1,
'normalize-0025-out.nq' => 1,
'metatag.info.yml' => 1,
'google_tag.services.yml' => 1,
'normalize-0020-out.nq' => 1,
'redirect.links.action.yml' => 1,
'normalize-0015-out.nq' => 1,
'token.libraries.yml' => 1,
'normalize-0016-in.jsonld' => 1,
'normalize-0016-out.nq' => 1,
'normalize-0017-in.jsonld' => 1,
'normalize-0017-out.nq' => 1,
'token.routing.yml' => 1,
'token.pages.inc' => 1,
'normalize-0018-in.jsonld' => 1,
'normalize-0018-out.nq' => 1,
'normalize-0019-in.jsonld' => 1,
'token.module' => 1,
'token.links.task.yml' => 1,
'token.install' => 1,
'normalize-0020-in.jsonld' => 1,
'token.info.yml' => 1,
'token.drush.inc' => 1,
'arrow-right.png' => 1,
'arrow-down.png' => 1,
'redirect.services.yml' => 1,
'redirect.routing.yml' => 1,
'redirect.permissions.yml' => 1,
'redirect.module' => 1,
'normalize-0019-out.nq' => 1,
'redirect.links.task.yml' => 1,
'redirect.links.menu.yml' => 1,
'normalize-0047-out.nq' => 1,
'normalize-0048-out.nq' => 1,
'normalize-0005-out.nq' => 1,
'deep_json_decode.php' => 1,
'tordf-0010-out.nq' => 1,
'search_json_index.php' => 1,
'tordf-0011-in.jsonld' => 1,
'rrmdir.php' => 1,
'read_file_lines.php' => 1,
'goto_dir.php' => 1,
'get_modified_files_since.php' => 1,
'get_json_index.php' => 1,
'get_json.php' => 1,
'get_directory_last_modified.php' => 1,
'tordf-0011-out.nq' => 1,
'set_json_index.php' => 1,
'tordf-0012-in.jsonld' => 1,
'copy_dir.php' => 1,
'tordf-0012-out.nq' => 1,
'tordf-0013-in.jsonld' => 1,
'tordf-0013-out.nq' => 1,
'tordf-0014-in.jsonld' => 1,
'tordf-0014-out.nq' => 1,
'tordf-0015-in.jsonld' => 1,
'platform-docker' => 1,
'drupalorg' => 1,
'tordf-0015-out.nq' => 1,
'set_json.php' => 1,
'sfile_get_contents.php' => 1,
'tordf-0016-out.nq' => 1,
'tordf-0007-in.jsonld' => 1,
'mseventdatabundle.php' => 1,
'phpunit-generator.php' => 1,
'tordf-0004-out.nq' => 1,
'geodb.sqlite' => 1,
'update.py' => 1,
'tordf-0005-in.jsonld' => 1,
'tordf-0005-out.nq' => 1,
'tordf-0006-in.jsonld' => 1,
'checker.py' => 1,
'tordf-0006-out.nq' => 1,
'tordf-0007-out.nq' => 1,
'sfile_put_contents.php' => 1,
'mhujerfioapibundle.php' => 1,
'tordf-0008-in.jsonld' => 1,
'mhormediainfobundle.php' => 1,
'tordf-0008-out.nq' => 1,
'diacriticsremover.php' => 1,
'secret_envs.sh.enc' => 1,
'tordf-0009-in.jsonld' => 1,
'composers.json' => 1,
'tordf-0009-out.nq' => 1,
'tordf-0010-in.jsonld' => 1,
'unzip.php' => 1,
'tordf-0016-in.jsonld' => 1,
'pushnotificationmanager.php' => 1,
'edible.yaml' => 1,
'tordf-0025-out.nq' => 1,
'tordf-0024-out.nq' => 1,
'castnumbertostringvalidator.php' => 1,
'jqueryserializeobjectasset.php' => 1,
'tordf-0025-in.jsonld' => 1,
'intllocaleasset.php' => 1,
'intlasset.php' => 1,
'disablecsrfvalidationfilter.php' => 1,
'httpexecute.php' => 1,
'run-single-test.sh' => 1,
'wrecker.yml' => 1,
'scratchpad' => 1,
'tordf-0024-in.jsonld' => 1,
'tordf-0026-in.jsonld' => 1,
'mzzbundle.php' => 1,
'jtimepickerasset.php' => 1,
'proto.php' => 1,
'tordf-0026-out.nq' => 1,
'e2e-test.bats' => 1,
'metrobundle.php' => 1,
'tordf-0027-in.jsonld' => 1,
'commandintegrator.php' => 1,
'tordf-0027-out.nq' => 1,
'tordf-0028-in.jsonld' => 1,
'euvatnumbervalidator.php' => 1,
'ibanvalidator.php' => 1,
'tordf-0017-in.jsonld' => 1,
'tordf-0019-in.jsonld' => 1,
'manticorapushnotificationbundle.php' => 1,
'manticorarestextrabundle.php' => 1,
'tordf-0017-out.nq' => 1,
'manticoraoauthbundle.php' => 1,
'manticoragooglefederatedloginbundle.php' => 1,
'tordf-0018-in.jsonld' => 1,
'tordf-0018-out.nq' => 1,
'manticoracmsbundle.php' => 1,
'mgiclassifiedsbundle.php' => 1,
'mgiblogbundle.php' => 1,
'lyraadminbundle.php' => 1,
'tordf-0023-out.nq' => 1,
'tordf-0019-out.nq' => 1,
'mgdebugbundle.php' => 1,
'mgblockbundle.php' => 1,
'tordf-0020-in.jsonld' => 1,
'jqgrid.png' => 1,
'tordf-0020-out.nq' => 1,
'mgpesmodelbundle.php' => 1,
'tordf-0022-in.jsonld' => 1,
'tordf-0022-out.nq' => 1,
'sfmducksboardbundle.php' => 1,
'tordf-0023-in.jsonld' => 1,
'msfrontcontrollersecuritybundle.php' => 1,
'tordf-0004-in.jsonld' => 1,
'normalize-0049-in.jsonld' => 1,
'normalize-0057-out.nq' => 1,
'normalize-0055-out.nq' => 1,
'normalize-0056-in.jsonld' => 1,
'dasliderasset.php' => 1,
'normalize-0056-out.nq' => 1,
'deletemultipleaction.php' => 1,
'actionbarasset.php' => 1,
'amwhoopsbundle.php' => 1,
'mickadoobasedatabundle.php' => 1,
'mickadooyamlapidocannotationbundle.php' => 1,
'normalize-0057-in.jsonld' => 1,
'normalize-manifest.jsonld' => 1,
'prowlclient.php' => 1,
'weedstorage.php' => 1,
'remote-doc-0001-in.jsonld' => 1,
'remote-doc-0001-out.jsonld' => 1,
'weedmanager.php' => 1,
'micjohnsonweedphpbundle.php' => 1,
'rbaccontroller.php' => 1,
'rbacconsolebootstrap.php' => 1,
'dutyconsole.php' => 1,
'remote-doc-0002-in.json' => 1,
'dutybootstrap.php' => 1,
'qr.php' => 1,
'micronaxprowlbundle.php' => 1,
'checkout.php' => 1,
'qrbundle.php' => 1,
'phpcs.php' => 1,
'mgdschema.php' => 1,
'normalize-0049-out.nq' => 1,
'application.yml' => 1,
'normalize-0050-in.jsonld' => 1,
'normalize-0050-out.nq' => 1,
'normalize-0051-in.jsonld' => 1,
'normalize-0051-out.nq' => 1,
'normalize-0052-in.jsonld' => 1,
'normalize-0052-out.nq' => 1,
'normalize-0053-in.jsonld' => 1,
'normalize-0053-out.nq' => 1,
'clean.php' => 1,
'text_page.php' => 1,
'template_settings.php' => 1,
'normalize-0054-in.jsonld' => 1,
'template_settings.css' => 1,
'mw_sql_restore.sql' => 1,
'normalize-0054-out.nq' => 1,
'mw_default_content.zip' => 1,
'inner.php' => 1,
'normalize-0055-in.jsonld' => 1,
'header_options.php' => 1,
'contacts.php' => 1,
'remote-doc-0002-out.jsonld' => 1,
'commerce_profile.profile' => 1,
'cmap' => 1,
'tordf-0001-out.nq' => 1,
'remote-doc-0011-out.jsonld' => 1,
'remote-doc-0012-context1.jsonld' => 1,
'remote-doc-0012-context2.jsonld' => 1,
'remote-doc-0012-in.json' => 1,
'forumnode.php' => 1,
'catnode.php' => 1,
'cathierarchy.php' => 1,
'remote-doc-manifest.jsonld' => 1,
'tordf-0001-in.jsonld' => 1,
'blacklist' => 1,
'tordf-0002-in.jsonld' => 1,
'remote-doc-0011-context.jsonld' => 1,
'phpunit.cov.xml' => 1,
'xmlrepeater.php' => 1,
'tordf-0002-out.nq' => 1,
'xmldecoratorinterface.php' => 1,
'documentation_guideline' => 1,
'tordf-0003-in.jsonld' => 1,
'tordf-0003-out.nq' => 1,
'admin-page-framework-loader.php' => 1,
'aretusaflashbundle.php' => 1,
'.remarkrc' => 1,
'cmap.php' => 1,
'remote-doc-0011-in.jldt' => 1,
'hierarchynode.php' => 1,
'commerce_profile.links.menu.yml' => 1,
'bccmyrrixbundle.php' => 1,
'commerce_profile.install' => 1,
'remote-doc-0003-in.jldt' => 1,
'remote-doc-0003-out.jsonld' => 1,
'remote-doc-0004-in.jldte' => 1,
'commerce_profile.info.yml' => 1,
'remote-doc-0009-context.jsonld' => 1,
'michelvdoctrinecachesweeperbundle.php' => 1,
'cachesweeper.php' => 1,
'cachesweepableinterface.php' => 1,
'remote-doc-0009-in.jsonld' => 1,
'myrrix.jar' => 1,
'bccextratoolsbundle.php' => 1,
'ihierarchynode.php' => 1,
'remote-doc-0009-out.jsonld' => 1,
'remote-doc-0010-context.jsonld' => 1,
'remote-doc-0010-in.json' => 1,
'remote-doc-0010-out.jsonld' => 1,
'bccautomapperbundle.php' => 1,
'epsjqgridbundle.php' => 1,
'betterdd_example.png' => 1,
'teamcity-clover.php' => 1,
'teamcity-clover' => 1,
'oauth2servermongodbbundle.php' => 1,
'git.aws-push.php' => 1,
'symfonycommands.php' => 1,
'normalize-0005-in.jsonld' => 1,
'cform.php' => 1,
'frame-0001-in.jsonld' => 1,
'flatten-0044-context.jsonld' => 1,
'flatten-0044-in.jsonld' => 1,
'flatten-0044-out.jsonld' => 1,
'flatten-0045-in.jsonld' => 1,
'flatten-0045-out.jsonld' => 1,
'flatten-0046-in.jsonld' => 1,
'flatten-0046-out.jsonld' => 1,
'flatten-manifest.jsonld' => 1,
'frame-0001-frame.jsonld' => 1,
'spring.jpg' => 1,
'pdatepicker.js' => 1,
'summer.jpg' => 1,
'frame-0001-out.jsonld' => 1,
'frame-0002-frame.jsonld' => 1,
'frame-0002-in.jsonld' => 1,
'frame-0002-out.jsonld' => 1,
'frame-0003-frame.jsonld' => 1,
'frame-0003-in.jsonld' => 1,
'frame-0003-out.jsonld' => 1,
'frame-0004-frame.jsonld' => 1,
'frame-0004-in.jsonld' => 1,
'frame-0004-out.jsonld' => 1,
'pdatepicker.css' => 1,
'flatten-0043-out.jsonld' => 1,
'winter.jpg' => 1,
'frame-0005-frame.jsonld' => 1,
'flatten-0040-in.jsonld' => 1,
'flatten-0038-out.jsonld' => 1,
'dssmarty.php' => 1,
'smarty_compiler.class.php' => 1,
'config_file.class.php' => 1,
'test-json.php' => 1,
'harbour' => 1,
'phake.zsh-completion' => 1,
'flatten-0039-in.jsonld' => 1,
'flatten-0039-out.jsonld' => 1,
'phake' => 1,
'basgeneratorbundle.php' => 1,
'tst' => 1,
'fixturesgeneratorbundle.php' => 1,
'flatten-0040-out.jsonld' => 1,
'flatten-0041-in.jsonld' => 1,
'flatten-0041-out.jsonld' => 1,
'flatten-0042-in.jsonld' => 1,
'flatten-0042-out.jsonld' => 1,
'mohebifardatetimebundle.php' => 1,
'mohebifarcalendarbundle.php' => 1,
'meisaratingbundle.php' => 1,
'flatten-0043-in.jsonld' => 1,
'meisamenubundle.php' => 1,
'autumn.jpg' => 1,
'jqueryticker.js' => 1,
'xmlfeed.php' => 1,
'moderaconfigbundle.php' => 1,
'moderalanguagesbundle.php' => 1,
'moderafoundationbundle.php' => 1,
'moderafileuploaderbundle.php' => 1,
'moderafilerepositorybundle.php' => 1,
'moderadynamicallyconfigurablemjrbundle.php' => 1,
'frame-0007-frame.jsonld' => 1,
'moderadynamicallyconfigurableappbundle.php' => 1,
'frame-0007-in.jsonld' => 1,
'kernelconfig.php' => 1,
'moderadirectbundle.php' => 1,
'moderabackendtranslationstoolbundle.php' => 1,
'moderamjrsecurityintegrationbundle.php' => 1,
'moderabackendtoolssettingsbundle.php' => 1,
'frame-0007-out.jsonld' => 1,
'frame-0008-frame.jsonld' => 1,
'frame-0008-in.jsonld' => 1,
'frame-0008-out.jsonld' => 1,
'moderabackendtoolsbundle.php' => 1,
'moderabackendtoolsactivitylogbundle.php' => 1,
'moderabackendsecuritybundle.php' => 1,
'moderabackendonsteroidsbundle.php' => 1,
'moderabackendmodulebundle.php' => 1,
'frame-0009-frame.jsonld' => 1,
'moderamjrcacheawareclassloaderbundle.php' => 1,
'moderamjrthemeintegrationbundle.php' => 1,
'specshapercalendarbundle.php' => 1,
'circleci.modx.config.xml' => 1,
'necktie-v0.4-alpha.jpg' => 1,
'frame-0005-in.jsonld' => 1,
'frame-0005-out.jsonld' => 1,
'widgetsbundle.php' => 1,
'passthroughnamingstrategy.php' => 1,
'frame-0006-frame.jsonld' => 1,
'trinitynotificationbundle.php' => 1,
'frame-0006-in.jsonld' => 1,
'frame-0006-out.jsonld' => 1,
'loggerbundle.php' => 1,
'modernfactoryresourcesbundle.php' => 1,
'moderamjrintegrationbundle.php' => 1,
'mcloud.yml' => 1,
'mf-upgrade-3.0' => 1,
'.mcignore' => 1,
'versions.json' => 1,
'moderaupgradebundle.php' => 1,
'moderatranslationsbundle.php' => 1,
'moderaservercrudbundle.php' => 1,
'moderasecuritybundle.php' => 1,
'moderaroutingbundle.php' => 1,
'moderanotificationbundle.php' => 1,
'moderamodulebundle.php' => 1,
'basexmlpipe.php' => 1,
'mongrate' => 1,
'moderabackendlanguagesbundle.php' => 1,
'flatten-0019-out.jsonld' => 1,
'class.ooyalaapiconfig.php' => 1,
'flatten-0016-in.jsonld' => 1,
'flatten-0016-out.jsonld' => 1,
'disqus.yml' => 1,
'flatten-0017-in.jsonld' => 1,
'morbicerconverterbundle.php' => 1,
'flatten-0017-out.jsonld' => 1,
'flatten-0018-in.jsonld' => 1,
'flatten-0018-out.jsonld' => 1,
'flatten-0019-in.jsonld' => 1,
'flatten-0020-in.jsonld' => 1,
'class.ooyaladownloader.php' => 1,
'flatten-0020-out.jsonld' => 1,
'flatten-0021-in.jsonld' => 1,
'flatten-0021-out.jsonld' => 1,
'flatten-0022-in.jsonld' => 1,
'flatten-0022-out.jsonld' => 1,
'skybot.php' => 1,
'flatten-0023-in.jsonld' => 1,
'flatten-0023-out.jsonld' => 1,
'config.yml.sample' => 1,
'flatten-0024-in.jsonld' => 1,
'flatten-0024-out.jsonld' => 1,
'flatten-0015-out.jsonld' => 1,
'sdk' => 1,
'flatten-0025-out.jsonld' => 1,
'flatten-0012-in.jsonld' => 1,
'morusacceticbundle.php' => 1,
'flatten-0007-out.jsonld' => 1,
'flatten-0008-in.jsonld' => 1,
'flatten-0008-out.jsonld' => 1,
'flatten-0009-in.jsonld' => 1,
'flatten-0009-out.jsonld' => 1,
'flatten-0010-in.jsonld' => 1,
'flatten-0010-out.jsonld' => 1,
'flatten-0011-in.jsonld' => 1,
'flatten-0011-out.jsonld' => 1,
'bootstrap.php.example' => 1,
'morkibouncebundle.php' => 1,
'flatten-0012-out.jsonld' => 1,
'example.build.properties' => 1,
'flatten-0013-in.jsonld' => 1,
'flatten-0013-out.jsonld' => 1,
'build.base.properties' => 1,
'flatten-0014-in.jsonld' => 1,
'genericselect.php' => 1,
'genericlibevent.php' => 1,
'flatten-0014-out.jsonld' => 1,
'mttdoctrinetoemberbundle.php' => 1,
'flatten-0015-in.jsonld' => 1,
'flatten-0025-in.jsonld' => 1,
'async.php' => 1,
'advanced_html_dom.php' => 1,
'monstrumsymfonycropboxbundle.php' => 1,
'flatten-0032-out.jsonld' => 1,
'flatten-0033-in.jsonld' => 1,
'flatten-0033-out.jsonld' => 1,
'.travis.dist.yml' => 1,
'bvtestbundle.php' => 1,
'flatten-0034-in.jsonld' => 1,
'flatten-0034-out.jsonld' => 1,
'monstrumsymfonyjcropbundle.php' => 1,
'monstrumsymfonydropzonebundle.php' => 1,
'flatten-0035-in.jsonld' => 1,
'flatten-0035-out.jsonld' => 1,
'autogrow.php' => 1,
'flatten-0036-in.jsonld' => 1,
'mechantsimplemailerbundle.php' => 1,
'flatten-0036-out.jsonld' => 1,
'flatten-0037-in.jsonld' => 1,
'envy.json' => 1,
'gentry' => 1,
'sinyamazonproductadvertisingapibundle.php' => 1,
'flatten-0037-out.jsonld' => 1,
'phpuri.php' => 1,
'pgbrowser.php' => 1,
'flatten-0038-in.jsonld' => 1,
'flatten-0032-in.jsonld' => 1,
'autogrowinput.php' => 1,
'amtelcomusersbundle.php' => 1,
'mops1kapibundle.php' => 1,
'flatten-0026-in.jsonld' => 1,
'flatten-0026-out.jsonld' => 1,
'flatten-0027-in.jsonld' => 1,
'mops1ktwbsbundle.php' => 1,
'flatten-0027-out.jsonld' => 1,
'jmdsettingsbundle.php' => 1,
'flatten-0028-in.jsonld' => 1,
'flatten-0028-out.jsonld' => 1,
'security.yml.dist' => 1,
'amtelcomloginbundle.php' => 1,
'flatten-0029-in.jsonld' => 1,
'flatten-0029-out.jsonld' => 1,
'flatten-0031-out.jsonld' => 1,
'apiservice.yml.dist' => 1,
'compact-0043-context.jsonld' => 1,
'flatten-0030-out.jsonld' => 1,
'jmdrestbundle.php' => 1,
'optimisticlockvalidator.php' => 1,
'flatten-0031-in.jsonld' => 1,
'slughelper.php' => 1,
'typeaheadplugin.php' => 1,
'datepickerplugin.php' => 1,
'basepicker.php' => 1,
'autogrowplugin.php' => 1,
'frame-0009-in.jsonld' => 1,
'frame-0009-out.jsonld' => 1,
'normalize-0004-out.nq' => 1,
'.phpmd-ruleset.xml' => 1,
'multibehavior.php' => 1,
'multiasset.php' => 1,
'addrowaction.php' => 1,
'pinba.png' => 1,
'ko-package' => 1,
'ko' => 1,
'misteiocloudinarybundle.php' => 1,
'fromrdf-0008-out.jsonld' => 1,
'fromrdf-0009-in.nq' => 1,
'fromrdf-0009-out.jsonld' => 1,
'bootstrap.netteforms.js' => 1,
'fromrdf-0008-in.nq' => 1,
'fromrdf-0010-in.nq' => 1,
'stylemanager.php' => 1,
'scriptmanager.php' => 1,
'fromrdf-0010-out.jsonld' => 1,
'fromrdf-0011-in.nq' => 1,
'istylemanager.php' => 1,
'iscriptmanager.php' => 1,
'@styles.latte' => 1,
'@scripts.latte' => 1,
'sheet.php' => 1,
'iextractor.php' => 1,
'jpark.komodoproject' => 1,
'amchart.php' => 1,
'fromrdf-0011-out.jsonld' => 1,
'example-cli-formats.php' => 1,
'fromrdf-0005-out.jsonld' => 1,
'fromrdf-0006-in.nq' => 1,
'alipaywapconfig.php' => 1,
'alipaywap.php' => 1,
'xlsxwriter.class.php' => 1,
'fromrdf-0006-out.jsonld' => 1,
'fromrdf-0007-in.nq' => 1,
'example-cli.php' => 1,
'example-cli-merge-cells.php' => 1,
'example-cli-load.php' => 1,
'filenamer.php' => 1,
'ammap.php' => 1,
'config_file_breadcrumbs.php' => 1,
'codesniffer_git_install.sh' => 1,
'loggerawaretrait.php' => 1,
'loggerawarebundle.php' => 1,
'hotfix.php' => 1,
'polymer.php' => 1,
'basepolymer.php' => 1,
'regionasset.php' => 1,
'leancloud.php' => 1,
'fromrdf-0007-out.jsonld' => 1,
'ammapasset.php' => 1,
'grouper.php' => 1,
'fromrdf-0012-in.nq' => 1,
'kdtclient.php' => 1,
'sg_ical.php' => 1,
'fromrdf-0020-in.nq' => 1,
'fromrdf-0020-out.jsonld' => 1,
'fromrdf-0021-in.nq' => 1,
'fromrdf-0021-out.jsonld' => 1,
'fromrdf-0022-in.nq' => 1,
'fromrdf-0022-out.jsonld' => 1,
'metaactiverecord.php' => 1,
'fromrdf-manifest.jsonld' => 1,
'doctrine_inflector.php' => 1,
'smartthink.php' => 1,
'normalize-0001-in.jsonld' => 1,
'fromrdf-0019-in.nq' => 1,
'normalize-0001-out.nq' => 1,
'normalize-0002-in.jsonld' => 1,
'normalize-0002-out.nq' => 1,
'phpjasperxmlsubreport.inc.php' => 1,
'phpjasperxml.inc.php' => 1,
'potter-orm.iml' => 1,
'minima-php.iml' => 1,
'normalize-0003-in.jsonld' => 1,
'normalize-0003-out.nq' => 1,
'normalize-0004-in.jsonld' => 1,
'recaptcha.png' => 1,
'fromrdf-0019-out.jsonld' => 1,
'fromrdf-0018-out.jsonld' => 1,
'misdravenbundle.php' => 1,
'md.sh' => 1,
'projectlightbundle.php' => 1,
'misdphonenumberbundle.php' => 1,
'fromrdf-0012-out.jsonld' => 1,
'fromrdf-0013-in.nq' => 1,
'misdmockravenservicebundle.php' => 1,
'misdlinkifybundle.php' => 1,
'fromrdf-0013-out.jsonld' => 1,
'misdhighchartsbundle.php' => 1,
'phpunit.vagrant.sh' => 1,
'autoloadtest.php' => 1,
'permissions' => 1,
'fromrdf-0018-in.nq' => 1,
'fromrdf-0014-in.nq' => 1,
'fromrdf-0014-out.jsonld' => 1,
'my.php' => 1,
'mmigration.php' => 1,
'threadunit' => 1,
'fromrdf-0015-in.nq' => 1,
'fromrdf-0015-out.jsonld' => 1,
'fromrdf-0016-in.nq' => 1,
'fromrdf-0016-out.jsonld' => 1,
'fromrdf-0017-in.nq' => 1,
'fromrdf-0017-out.jsonld' => 1,
'jsapi.php' => 1,
'fromrdf-0005-in.nq' => 1,
'frame-0010-frame.jsonld' => 1,
'mjmkrumobundle.php' => 1,
'frame-0014-out.jsonld' => 1,
'paging-demo.php' => 1,
'screen.gif' => 1,
'srfdatadogstatsdbundle.php' => 1,
'srfezlegacydebugbundle.php' => 1,
'srfcloudstackclientbundle.php' => 1,
'mysqlpdohelper.php' => 1,
'logginghelper.php' => 1,
'frame-0015-frame.jsonld' => 1,
'frame-0015-in.jsonld' => 1,
'dtcgridbundle.php' => 1,
'frame-0014-frame.jsonld' => 1,
'dependentbundleinterface.php' => 1,
'cachedbundledependenciesresolver.php' => 1,
'bundlestacknotcacheableexception.php' => 1,
'bundledependenciesresolver.php' => 1,
'httpheadersbundle.php' => 1,
'spotifyapibundle.php' => 1,
'rsqueueevents.php' => 1,
'rsqueuebundle.php' => 1,
'upgrade-3' => 1,
'formfillerbundle.php' => 1,
'frame-0015-out.jsonld' => 1,
'frame-0014-in.jsonld' => 1,
'frame-0013-out.jsonld' => 1,
'cacheflushevents.php' => 1,
'file-created-after-1.0.0-tagged-already' => 1,
'moderabackendgoogleanalyticsconfigbundle.php' => 1,
'frame-0010-in.jsonld' => 1,
'moderabackendgoogleanalyticsbundle.php' => 1,
'frame-0010-out.jsonld' => 1,
'moderabackenddashboardbundle.php' => 1,
'frame-0011-frame.jsonld' => 1,
'frame-0011-in.jsonld' => 1,
'moderabackendconfigutilsbundle.php' => 1,
'moderaactivityloggerbundle.php' => 1,
'frame-0011-out.jsonld' => 1,
'persistentpest.php' => 1,
'frame-0013-in.jsonld' => 1,
'frame-0012-frame.jsonld' => 1,
'example_form.html' => 1,
'example_balance.php' => 1,
'frame-0012-in.jsonld' => 1,
'mobilecarthwioauthbundle.php' => 1,
'frame-0012-out.jsonld' => 1,
'mobilecartelasticsearch17bundle.php' => 1,
'mobilecartcorebundle.php' => 1,
'frame-0013-frame.jsonld' => 1,
'mobilecartdummypaymentbundle.php' => 1,
'moactionjsonrpcbundle.php' => 1,
'controllerextrabundle.php' => 1,
'frame-0016-frame.jsonld' => 1,
'fromrdf-0004-out.jsonld' => 1,
'frame-0021-in.jsonld' => 1,
'frame-0019-out.jsonld' => 1,
'frame-0020-frame.jsonld' => 1,
'readme_pt-br' => 1,
'palantyr.php.zip' => 1,
'frame-0020-in.jsonld' => 1,
'completer.php' => 1,
'sc-bootstrap.php' => 1,
'frame-0020-out.jsonld' => 1,
'colorsystems.php' => 1,
'frame-0021-frame.jsonld' => 1,
'frame-0021-out.jsonld' => 1,
'analyze.xml' => 1,
'frame-manifest.jsonld' => 1,
'fromrdf-0001-in.nq' => 1,
'fromrdf-0001-out.jsonld' => 1,
'fromrdf-0002-in.nq' => 1,
'fromrdf-0002-out.jsonld' => 1,
'dataurlhandler.php' => 1,
'fromrdf-0003-in.nq' => 1,
'fromrdf-0003-out.jsonld' => 1,
'fromrdf-0004-in.nq' => 1,
'phplinq.php' => 1,
'missing_types.hhi' => 1,
'crane' => 1,
'composer-mini.xml' => 1,
'cacheflushbundle.php' => 1,
'mmanos-laravel' => 1,
'shim.php' => 1,
'screenshots' => 1,
'frame-0016-in.jsonld' => 1,
'licencia' => 1,
'textareatokensasset.php' => 1,
'textareatokens.php' => 1,
'frame-0016-out.jsonld' => 1,
'frame-0017-frame.jsonld' => 1,
'smartimagefieldasset.php' => 1,
'smartimagefield.php' => 1,
'imageuploadaction.php' => 1,
'ip-lib.php' => 1,
'frame-0019-in.jsonld' => 1,
'frame-0017-in.jsonld' => 1,
'frame-0017-out.jsonld' => 1,
'mloconsolebundle.php' => 1,
'frame-0018-frame.jsonld' => 1,
'validate-commit' => 1,
'frame-0018-in.jsonld' => 1,
'validate.xml' => 1,
'frame-0018-out.jsonld' => 1,
'frame-0019-frame.jsonld' => 1,
'symfony.xml' => 1,
'phpant.xml' => 1,
'expand-0038-in.jsonld' => 1,
'remainingcharacters.php' => 1,
'compact-0071-context.jsonld' => 1,
'adminbundle.php' => 1,
'build.sample.xml' => 1,
'floicon.php' => 1,
'jimicon.php' => 1,
'build_extensions.php' => 1,
'blob.php' => 1,
'baseconfighelper.php' => 1,
'config_sample.php' => 1,
'accountbundle.php' => 1,
'oidnuswalletbundle.php' => 1,
'oidnusadminthemebundle.php' => 1,
'ol.js' => 1,
'phpunit-test-checker.json' => 1,
'ol.css' => 1,
'bundlecontainer.php' => 1,
'ol-debug.js' => 1,
'.htmlhintrc' => 1,
'.html-minifier.conf' => 1,
'sample_print.png' => 1,
'dbawareinterface.php' => 1,
'dbawaretrait.php' => 1,
'filesystemawareinterface.php' => 1,
'filesystemawaretrait.php' => 1,
'phpunit-test-checker.php' => 1,
'homesteader' => 1,
'phonehelper.php' => 1,
'menuwidget.php' => 1,
'juliusrefererbundle.php' => 1,
'ocs_init.php' => 1,
'bootstrap.inc' => 1,
'migraine.yml.dist' => 1,
'fs.inc' => 1,
'alicephpmodule.php' => 1,
'frontendcontentbundle.php' => 1,
'sliderwidget.php' => 1,
'testconfig.php' => 1,
'callback-queue-example.php' => 1,
'levelwidget.php' => 1,
'cron.yaml' => 1,
'axismodule.php' => 1,
'clip' => 1,
'example.di.php' => 1,
'example.silex.php' => 1,
'okapondoctrinesettypebundle.php' => 1,
'sniff.sh' => 1,
'timeago.inc.php' => 1,
'openjournalsoftwarebibtexbundle.php' => 1,
'westsworld.datetime.class.php' => 1,
'queue.yaml' => 1,
'requestawareinterface.php' => 1,
'clear-cache-for-timber.php' => 1,
'juliusboilerplatebundle.php' => 1,
'cat.tpl' => 1,
'position.php' => 1,
'menu.json' => 1,
'run.php.default' => 1,
'xlsxreader.php' => 1,
'mark.tpl' => 1,
'find.tpl' => 1,
'filters.tpl' => 1,
'filters.layer.json' => 1,
'extend.tpl' => 1,
'catalog.layer.json' => 1,
'test_intset.php' => 1,
'position.tpl' => 1,
'schema.mysql.sql' => 1,
'ripcord_server.php' => 1,
'ripcord_client.php' => 1,
'ripcord.php' => 1,
'test_map_string_int.php' => 1,
'test_map_timeuuid_boolean.php' => 1,
'test_map_uuid_string.php' => 1,
'rabbit' => 1,
'odiseoprojectbundle.php' => 1,
'odiseobackendbundle.php' => 1,
'sample-nginx.conf' => 1,
'sample-apache.htaccess' => 1,
'ogiencodpwdcommandbundle.php' => 1,
'search.tpl' => 1,
'requestawaretrait.php' => 1,
'gshoppingcontent.php' => 1,
'deckard.yml.dist' => 1,
'routeawareinterface.php' => 1,
'routeawaretrait.php' => 1,
'deckard' => 1,
'httpapplication.php' => 1,
'objectmanagerawareinterface.php' => 1,
'stat.tpl' => 1,
'seo.json' => 1,
'rubrics.tpl' => 1,
'nousite.sh' => 1,
'objectmanagerawaretrait.php' => 1,
'rubrics.php' => 1,
'restfulbundle.php' => 1,
'producers.tpl' => 1,
'producers.schema.json' => 1,
'jit.php' => 1,
'jjanviercrowdinbundle.php' => 1,
'routes_cached.php' => 1,
'producers.php' => 1,
'ext.slow_page_logger.php' => 1,
'exemple.conf' => 1,
'juliusframeworkextrabundle.php' => 1,
'nokogiri.php' => 1,
'.nikki.yml' => 1,
'hybridauth.readme' => 1,
'treedropdownlist.php' => 1,
'drupalbase.routing.yml' => 1,
'treearrayhelper.php' => 1,
'listgroupwidget.php' => 1,
'drupalbase.services.yml' => 1,
'drupalbase.themehook.yml' => 1,
'listgroupasset.php' => 1,
'drupalbase.themesuggestions.yml' => 1,
'screenshotmachine.class.php' => 1,
'calculate' => 1,
'list_files.php' => 1,
'drupalbase.module' => 1,
'onceitraygunbundle.php' => 1,
'yz.php' => 1,
'vagrant.yaml.dist' => 1,
'admintinymceasset.php' => 1,
'skiprowexception.php' => 1,
'interruptimportexception.php' => 1,
'importform.php' => 1,
'phpstorm_reference_card.pdf' => 1,
'batchimportaction.php' => 1,
'validationform.php' => 1,
'treenamecolumn.php' => 1,
'drupalbase.info.yml' => 1,
'phpstorm_workshop.pptx' => 1,
'askme-compose.json' => 1,
'jessedevcartcomponentbundle.php' => 1,
'scheduler.sh.example' => 1,
'magicutils.php' => 1,
'magicutilstraits.php' => 1,
'ongair.php' => 1,
'manual.php' => 1,
'logrotate.sh' => 1,
'activator.php' => 1,
'.env.template' => 1,
'maigcutilstest.php' => 1,
'adiboxcachebundle.php' => 1,
'php_compat.php' => 1,
'classyfile' => 1,
'bencode.php' => 1,
'baseapibundle.php' => 1,
'servable.php' => 1,
'bencodetest.php' => 1,
'valiantasset.php' => 1,
'phonewidget.php' => 1,
'treeorderwidgetasset.php' => 1,
'jsontest.php' => 1,
'treeorderwidget.php' => 1,
'treeordermodeltrait.php' => 1,
'phpstorm_workshop.pdf' => 1,
'geobehavior.php' => 1,
'olarabbitmqadmintoolkitbundle.php' => 1,
'yona-cms.sql' => 1,
'ohcolorpickertypebundle.php' => 1,
'olix21calendarbundle.php' => 1,
'o80-i18n.iml' => 1,
'guerriatmetricsbundle.php' => 1,
'gmapbundle.php' => 1,
'headers-json.php' => 1,
'git-submodule.sh' => 1,
'm150929_122401_settings.php' => 1,
'settingscomponent.php' => 1,
'proplogic.class.php' => 1,
'thanks.php' => 1,
'ohemojibundle.php' => 1,
'proudfieldfacebookbundle.php' => 1,
'sample_loca.php' => 1,
'ostsensiobuzzprofilerbundle.php' => 1,
'osterrorbundle.php' => 1,
'report-sample.php' => 1,
'vhosthandler.php' => 1,
'permutation.sublime-project' => 1,
'permutation.sublime-workspace' => 1,
'jiabinholterbundle.php' => 1,
'vhostconfiguration.php' => 1,
'ohdateextravalidatorbundle.php' => 1,
'ohgooglemapformtypebundle.php' => 1,
'stam.yml' => 1,
'patterneventsprovider.php' => 1,
'jfdlformbundle.php' => 1,
'schedulecontroller.php' => 1,
'callbackevent.php' => 1,
'phonenumbervalidator.php' => 1,
'phonenumberbehavior.php' => 1,
'momentlanguageasset.php' => 1,
'manymanyrelationbehavior.php' => 1,
'filetrait.php' => 1,
'gmap.php' => 1,
'prefixmethodfinder.php' => 1,
'daterangepickerbootstrap3asset.php' => 1,
'berttimezonebundle.php' => 1,
'daterangepickerbootstrap2asset.php' => 1,
'icons.php' => 1,
'phpunit_travis.xml' => 1,
'create_test_reports.sh' => 1,
'tpuserbundle.php' => 1,
'taosistemasajaxgridbundle.php' => 1,
'gizmo.phar' => 1,
'gizmo' => 1,
'.jsbeautifyrc' => 1,
'faker' => 1,
'license-3rd-party' => 1,
'phpunit-notifications.sh' => 1,
'test_stringset.php' => 1,
'ongrconnectionsbundle.php' => 1,
'gearman_test_client.php' => 1,
'routing.json' => 1,
'amukanaplvalidatorbundle.php' => 1,
'nyrodevutilitybundle.php' => 1,
'ventureoaklabsfavicongeneratorbundle.php' => 1,
'nyrodevnyrocmsbundle.php' => 1,
'ventureoaklabswsdl2phpgeneratorclibundle.php' => 1,
'simplecache-htaccess' => 1,
'frontend-cache.php' => 1,
'caches.conf.sample.php' => 1,
'cache-main-auth.php' => 1,
'gearman_runner.php' => 1,
'minifyplugin.php' => 1,
'careerjet_api.php' => 1,
'datagridvector.php' => 1,
'crowdtilt.php' => 1,
'nvboosterphpcrassetsbundle.php' => 1,
'update_ruckusing_database.php' => 1,
'swiftmessageutils.php' => 1,
'banister.php' => 1,
'memcachedtool' => 1,
'heatmap.php' => 1,
'nuxiamailstoragebundle.php' => 1,
'docker-compose.env.dist' => 1,
'seomaticplugin.php' => 1,
'morgenstillevisualheatmapbundle.php' => 1,
'abstractparser.php' => 1,
'ivanvolkovsearchfilesbycontentbundle.php' => 1,
'jlmawsbundle.php' => 1,
'jlmserializerexpressionbundle.php' => 1,
'projectlint.yml' => 1,
'commandprocess.php' => 1,
'commandformatter.php' => 1,
'.package.tag' => 1,
'.package.split' => 1,
'soko.yml' => 1,
'httppersister.php' => 1,
'jmikolaautologinbundle.php' => 1,
'scaffolder' => 1,
'cqlclient.php' => 1,
'literals.php' => 1,
'cqlpersister.php' => 1,
'persister.php' => 1,
'jmikolainsecureroutesbundle.php' => 1,
'criteriaparser.php' => 1,
'jmikolajsassetshelperbundle.php' => 1,
'jmikolawildcardeventdispatcherbundle.php' => 1,
'mojosonatauibundle.php' => 1,
'doctrineormpersister.php' => 1,
'osmeasyrestbundle.php' => 1,
'parameterbaginterface.php' => 1,
'abstractcli.sublime-project' => 1,
'tpboot.php' => 1,
'embedgithub.php' => 1,
'factorysequence.php' => 1,
'factorygirl.php' => 1,
'extended-template-parts.php' => 1,
'photoswipe.css' => 1,
'extended-widgets.php' => 1,
'query-monitor.php' => 1,
'user-switching.php' => 1,
'mycal.ics' => 1,
'class.icalreader.php' => 1,
'captcha-login.php' => 1,
'talandewebb.php' => 1,
'extended-cpts.php' => 1,
'[email protected]' => 1,
'kml.class.php' => 1,
'icons.png' => 1,
'error.gif' => 1,
'kmlcircle.php' => 1,
'code.photoswipe.jquery-3.0.5.min.js' => 1,
'kmlcsv.jar' => 1,
'redbox-scan.php' => 1,
'help-me-help-you.php' => 1,
'hmhy.js' => 1,
'extended-taxos.php' => 1,
'googlenews.php' => 1,
'jogaramreactphpbundle.php' => 1,
'jsmysqlndbundle.php' => 1,
'push.php' => 1,
'nurolophersummernotebundle.php' => 1,
'nurikabestarratingbundle.php' => 1,
'twitterapiinterface.php' => 1,
'scytaledatabaseconfigurationbundle.php' => 1,
'autoloader.php~' => 1,
'memory::' => 1,
'arkoqueuemanagerbundle.php' => 1,
'queuemanagerinterface.php' => 1,
'test.html~' => 1,
'phpunit_travis_mysql.xml' => 1,
'android.class.php' => 1,
'wf.php' => 1,
'run_poste.sh' => 1,
'track.sh' => 1,
'test-one-file.sh' => 1,
'codeoasiscurlbundle.php' => 1,
'jbzfetchbundle.php' => 1,
'robots.php' => 1,
'x.bat' => 1,
'notification.class.php' => 1,
'ios.class.php' => 1,
'jbzimapbundle.php' => 1,
'l.php' => 1,
'yiidbhttptokensession.php' => 1,
'dbcon.php' => 1,
'cronqueue.php' => 1,
'jlbsadminbundle.php' => 1,
'jlbsadminfosuserbundle.php' => 1,
'tusk.json' => 1,
'mobiledemo.php' => 1,
'seleniumrcdemo.php' => 1,
'webdriverdemo.php' => 1,
'webdriverdemoshootout.php' => 1,
'webdriverfileuploaddemo.php' => 1,
'webdrivernologinlinkdemo.php' => 1,
'kirk.jpg' => 1,
'cronjob.php' => 1,
'jaitecclickbundle.php' => 1,
'cronconnector.php' => 1,
'sauce_api_test.php' => 1,
'jlmaskbundle.php' => 1,
'jlmbootstrapbundle.php' => 1,
'jlmcommercebundle.php' => 1,
'jlmcommerceevents.php' => 1,
'jlmcondominiumbundle.php' => 1,
'jlmcontactbundle.php' => 1,
'jlmcontractbundle.php' => 1,
'walkerinterface.php' => 1,
'jlasozimbrasoapapibundle.php' => 1,
'translationsapibundle.php' => 1,
'octavabranchingbundle.php' => 1,
'mpdfextended.php' => 1,
'odeskphystrixbundle.php' => 1,
'designbundle.php' => 1,
'qrreaderasset.php' => 1,
'comoempezar.pdf' => 1,
'qrreader.php' => 1,
'prueba.sql' => 1,
'dockerremote.php' => 1,
'profilinginstructions' => 1,
'measurement.ods' => 1,
'bracket.php' => 1,
'jlasojsoneditorbundle.php' => 1,
'sample.csv' => 1,
'jlasoapidocbundle.php' => 1,
'consoleargs.php' => 1,
'memorycache.php' => 1,
'halcyonserviceprovider.php' => 1,
'php-tools.php' => 1,
'sessionstoragebundle.php' => 1,
'jlasositemapbundle.php' => 1,
'commands.ini.dist' => 1,
'servers.ini.dist' => 1,
'config.ini.dis' => 1,
'csv2po.php' => 1,
'geggs.yml' => 1,
'jlmcontractevents.php' => 1,
'remainingcharactersasset.php' => 1,
'installtaotask.php' => 1,
'jlmmodelbundle.php' => 1,
'jlmmodelevents.php' => 1,
'jlmofficebundle.php' => 1,
'getfile.php' => 1,
'tools.xml' => 1,
'compilejscss.xml' => 1,
'taodbconfig.php' => 1,
'jlmproductbundle.php' => 1,
'taoconfig.php' => 1,
'restoredbtask.php' => 1,
'gitdifftask.php' => 1,
'composer.json_' => 1,
'generisconfig.php' => 1,
'createdbtask.php' => 1,
'jlmproductevents.php' => 1,
'backupdbtask.php' => 1,
'fdl-1.3' => 1,
'test2.json' => 1,
'jlmstatebundle.php' => 1,
'silk.log' => 1,
'jlmtransmitterbundle.php' => 1,
'jlmuserbundle.php' => 1,
'protobuf.php' => 1,
'composer.json__' => 1,
'octanteupsapibundle.php' => 1,
'httpauth-recipe.rb' => 1,
'jlmcorebundle.php' => 1,
'jlmdailybundle.php' => 1,
'octantenatsbundle.php' => 1,
'octantemarvelapibundle.php' => 1,
'jlmdailyevents.php' => 1,
'dockercomposebundle.php' => 1,
'parameters.dist.yml' => 1,
'opcache-recipe.rb' => 1,
'modman-recipe.rb' => 1,
'magento-recipe.rb' => 1,
'jlmdefaultbundle.php' => 1,
'logtailminutes.php' => 1,
'croogo-recipe.rb' => 1,
'composer-recipe.rb' => 1,
'cakephp2x-recipe.rb' => 1,
'cakephp1x-recipe.rb' => 1,
'backupdatabase-recipe.rb' => 1,
'apc-recipe.rb' => 1,
'obtaohtml2pdfbundle.php' => 1,
'jlmfeebundle.php' => 1,
'obtaoamazonwebservicesbundle.php' => 1,
'jlmfollowbundle.php' => 1,
'jlminstallationbundle.php' => 1,
'service.template' => 1,
'ongrcontentbundle.php' => 1,
'vandelay.php' => 1,
'mysql_wrapper.class.php' => 1,
'setflash.iml' => 1,
'crowi.php' => 1,
'puffer.sublime-project' => 1,
'puffer-logo.png' => 1,
'tests-api-token.txt.sample' => 1,
'osimek1articlesbundle.php' => 1,
'php.log' => 1,
'lastfmbundle.php' => 1,
'osbekrocommentsbundle.php' => 1,
'middlewares.php' => 1,
'upgrade-1.8.3' => 1,
'outlandishrestbundle.php' => 1,
'upgrade-1.10' => 1,
'ororequirejsbundle.php' => 1,
'orocrmmagentocontactusbundle.php' => 1,
'orokernel.php' => 1,
'orodistributionbundle.php' => 1,
'oroconfigbundle.php' => 1,
'cumulativeresourcemanager.php' => 1,
'cumulativeresourceinfo.php' => 1,
'cumulativeresource.php' => 1,
'ornjmarkdownbundle.php' => 1,
'example-report.php' => 1,
'outlandishroutemasterbundle.php' => 1,
'ornicarmessagebundle.php' => 1,
'evalnametoken.php' => 1,
'spellchecker' => 1,
'simple-ru' => 1,
'minimum-requirements.php' => 1,
'rat_exclude' => 1,
'overblogwsclientbundle.php' => 1,
'overblogthriftbundle.php' => 1,
'leafsimple.php' => 1,
'leafpre.php' => 1,
'jcrollfoursquareapibundle.php' => 1,
'leafparagraph.php' => 1,
'leafheading.php' => 1,
'overblogactivemqbundle.php' => 1,
'branchlistunordered.php' => 1,
'branchlistordered.php' => 1,
'itoken.php' => 1,
'branchlistitem.php' => 1,
'branchlist.php' => 1,
'nametoken.php' => 1,
'templategenerator.php' => 1,
'templatemanager.php' => 1,
'branch.php' => 1,
'overbloggraphqlbundle.php' => 1,
'overblogembedlybundle.php' => 1,
'ornjarchivebundle.php' => 1,
'orkestrawebservicebundle.php' => 1,
'simple-contact-forms.php' => 1,
'jdecoolmonologextrabundle.php' => 1,
'subvert.php' => 1,
'cachedecorator.php' => 1,
'jdecoolexceptionhelpbundle.php' => 1,
'cachablequeryserviceprovider.php' => 1,
'policy.php' => 1,
'authorizationserviceprovider.php' => 1,
'resourcemirrorfactory.php' => 1,
'resourcemirror.php' => 1,
'imageworkshopbundle.php' => 1,
'orbtstylemirrorbundle.php' => 1,
'orbtresourcemirrorbundle.php' => 1,
'hashidserviceprovider.php' => 1,
'covers-validator' => 1,
'jdecooltwigconstantaccessorbundle.php' => 1,
'opwocoforecastbundle.php' => 1,
'opwocoxeditablebundle.php' => 1,
'opwocobootstrapbundle.php' => 1,
'reactasset.php' => 1,
'jsxtransformerasset.php' => 1,
'jdecosterroutingextrabundle.php' => 1,
'shortify.php' => 1,
'cert.pem' => 1,
'formrequest.php' => 1,
'replacementmanager2.php' => 1,
'orkestratransactorbundle.php' => 1,
'abstractreport.php' => 1,
'reportinterface.php' => 1,
'reportfactory.php' => 1,
'presenterinterface.php' => 1,
'tokendef.php' => 1,
'tokentype.php' => 1,
'basecodehandler.php' => 1,
'basiccodepattern.php' => 1,
'codeformatter.php' => 1,
'presentation.php' => 1,
'orkestrareportbundle.php' => 1,
'codepattern.php' => 1,
'commandserviceprovider.php' => 1,
'orkestrapdfbundle.php' => 1,
'guzzle.php' => 1,
'orkestraapplicationbundle.php' => 1,
'bootils.php' => 1,
'delimitedcodepattern.php' => 1,
'replacementmanager.php' => 1,
'origammiblocksbundle.php' => 1,
'blockscontainer.php' => 1,
'fullcasset.php' => 1,
'fullcall.php' => 1,
'middlewareserviceprovider.php' => 1,
'validity.php' => 1,
'acf-page-builder.php' => 1,
'oauth2clientbundle.php' => 1,
'pagarme.php' => 1,
'jbsearchbundle.php' => 1,
'jbtagcloudbundle.php' => 1,
'corsslim.php' => 1,
'jbsimplepagebundle.php' => 1,
'send' => 1,
'response' => 1,
'civicrm.php' => 1,
'request' => 1,
'consoletarget.php' => 1,
'paggyboletobundle.php' => 1,
'gpgalleryasset.php' => 1,
'slimnocache.php' => 1,
'bigtype.html' => 1,
'gpgallery.php' => 1,
'bluesatellite.html' => 1,
'bootstrapped.html' => 1,
'elefant' => 1,
'abstractplace.php' => 1,
'workbench' => 1,
'inflicted.html' => 1,
'inflicted.png' => 1,
'refactor.php' => 1,
'jbdatenavigationbundle.php' => 1,
'angular' => 1,
'optionbag.php' => 1,
'pdo-debug.sql' => 1,
'cli_facebook.php' => 1,
'.gdbinit' => 1,
'edifactbundle.php' => 1,
'linksextractor.php' => 1,
'language' => 1,
'adapters' => 1,
'dynamicobject.php' => 1,
'dynamicobject' => 1,
'chequer.php' => 1,
'mydbvc.yaml' => 1,
'pdo-debug.php' => 1,
'angular.zip' => 1,
'jbfileuploaderbundle.php' => 1,
'startserver' => 1,
'gear.php' => 1,
'loaderexception.php' => 1,
'auto.php' => 1,
'jbphumborbundle.php' => 1,
'datenavigationgenerator.php' => 1,
'sqlinterface.php' => 1,
'datenavigationprovider.php' => 1,
'sqlabstract.php' => 1,
'cachedi.php' => 1,
'pablodipmodulebundle.php' => 1,
'pablodipadminmodulebundle.php' => 1,
'wufoohtmlwrapper.php' => 1,
'yepsuacommonsbundle.php' => 1,
'siteparser.php' => 1,
'sitelinks.php' => 1,
'check_minecraft.php' => 1,
'phpunit-travis.xml.dist' => 1,
'yepsuathemebundle.php' => 1,
'yepsuasmartwigbundle.php' => 1,
'unit_tests.xml' => 1,
'yepsuaradbundle.php' => 1,
'yepsuamenubundle.php' => 1,
'yepsuageneratorbundle.php' => 1,
'tutorial4' => 1,
'p1r0generatorbundle.php' => 1,
'tutorial3' => 1,
'tutorial2' => 1,
'savvycontactbundle.php' => 1,
'kengai.png' => 1,
'mediafactory.php' => 1,
'smiletrainingbundle.php' => 1,
'pre-commit.phpeach' => 1,
'phpeach.conf.dist' => 1,
'phpeach' => 1,
'build.ini.dist' => 1,
'integration_tests.xml' => 1,
'previewtheme.php' => 1,
'literati.html' => 1,
'phkapa.readme' => 1,
'elefant_icon.png' => 1,
'adminsession.php' => 1,
'montreal.html' => 1,
'quick-user-guide-phkondo-pt' => 1,
'quick-user-guide-phkondo-en' => 1,
'raleway.html' => 1,
'saasy.html' => 1,
'simplement.html' => 1,
'bright_squares.png' => 1,
'subtlesquared.html' => 1,
'urlify.php' => 1,
'isgdhelpers.php' => 1,
'installation_instructions' => 1,
'init.ph7' => 1,
'ph7.license' => 1,
'ph7.copyright' => 1,
'help_us' => 1,
'subdivx' => 1,
'washi.html' => 1,
'washi.png' => 1,
'changelog-0.2' => 1,
'uuidhelpers.php' => 1,
'readme ramsey uuid' => 1,
'ivalidator.php' => 1,
'userroles.php' => 1,
'ongrmagentoconnectorbundle.php' => 1,
'jseimagecropbundle.php' => 1,
'ui-multiselect-transfer.html' => 1,
'ui-multiselect-transfer.js' => 1,
'jerivecontainerexplorerbundle.php' => 1,
'security-exchanges.json' => 1,
'exchanges.json' => 1,
'algorithms.json' => 1,
'jerivefileprocessingbundle.php' => 1,
'jeriveworkflowbundle.php' => 1,
'jseamfbundle.php' => 1,
'jseemgeneratorbundle.php' => 1,
'kloutapibundle.php' => 1,
'demo.js' => 1,
'jseblockgeneratorbundle.php' => 1,
'todo.textile' => 1,
'as3-signals.as3proj' => 1,
'package-descriptions.xml' => 1,
'sdk.properties' => 1,
'openpay.php' => 1,
'sculpingistembedbundle.php' => 1,
'jeroendeslooveregeolocationbundle.php' => 1,
'jeroendeslooverevcardbundle.php' => 1,
'jvdhasseticcachebustingbundle.php' => 1,
'ticket_create_example.php' => 1,
'udf_query_example.php' => 1,
'twitterstrategy.php' => 1,
'openrootcronjobbundle.php' => 1,
'opensoftdoctrineadditionsbundle.php' => 1,
'log4php.dist.xml' => 1,
'add-site.php' => 1,
'openskyruntimeconfigbundle.php' => 1,
'crawl' => 1,
'asf-license-2.0' => 1,
'openroothttpcontextbundle.php' => 1,
'apache_license_v2' => 1,
'pdepend.xml' => 1,
'schedulermodule.php' => 1,
'openrootclientcontextbundle.php' => 1,
'exclude' => 1,
'jmabbundle.php' => 1,
'jmbalancedpaymentbundle.php' => 1,
'jmcrmbundle.php' => 1,
'demo.css' => 1,
'calculator.php' => 1,
'lss_version.php' => 1,
'openifyproductbundle.php' => 1,
'openifyjqgridbundle.php' => 1,
'openifycustomerbundle.php' => 1,
'openifyconfigurationbundle.php' => 1,
'openifyaws2bundle.php' => 1,
'sculpincontentgeneratorbundle.php' => 1,
'identifier_request.html' => 1,
'freeagentworkflowbundle.php' => 1,
'ongrrouterbundle.php' => 1,
'imagickext.php' => 1,
'onmotionasset.php' => 1,
'sendmail-wrapper.php' => 1,
'larareposerviceprovider.php' => 1,
'sendmail-throttle.php' => 1,
'prepend.php' => 1,
'onlimeexceptionreportbundle.php' => 1,
'quality.sh' => 1,
'ongrtranslationsbundle.php' => 1,
'ongrsettingsbundle.php' => 1,
'ongrmonitoringbundle.php' => 1,
'oodlekrumobundle.php' => 1,
'serializableinterface.php' => 1,
'ongrfiltermanagerbundle.php' => 1,
'ongrelasticsearchbundle.php' => 1,
'ongrcurrencyexchangebundle.php' => 1,
'ongrcookiesbundle.php' => 1,
'ongrapibundle.php' => 1,
'ongrtestingbundle.php' => 1,
'ongrtaskmessengerbundle.php' => 1,
'ongrpagerbundle.php' => 1,
'ongroxidconnectorbundle.php' => 1,
'onpubapi.php' => 1,
'canaltpscrumboarditbundle.php' => 1,
'cachebustingworker.php' => 1,
'baseexporter.php' => 1,
'serializedtype.php' => 1,
'unserializer.php' => 1,
'unserializerinterface.php' => 1,
'openidstrategy.php' => 1,
'livestrategy.php' => 1,
'jvdhtwigrelativecachekeybundle.php' => 1,
'linkedinstrategy.php' => 1,
'githubstrategy.php' => 1,
'debugserviceprovider.php' => 1,
'travis-ci.xml' => 1,
'wordpress-nav-menus-improved.php' => 1,
'jsonexporter.php' => 1,
'sharedcount.php' => 1,
'excelexporter.php' => 1,
'wp-svn.pl' => 1,
'oomph-plugin-notes.php' => 1,
'oomph-plugin-notes.js' => 1,
'google-places.php' => 1,
'google_oauth.routing.yml' => 1,
'google_oauth.links.menu.yml' => 1,
'google_oauth.info.yml' => 1,
'wp-forms-api.php' => 1,
'finally.jpg' => 1,
'opensofteplbundle.php' => 1,
'godaddy_wildwestdomainsapi.php' => 1,
'iuser.php' => 1,
'memcachedbridge.php' => 1,
'et_client.php' => 1,
'ievent.php' => 1,
'jdphpprojectanalyzerbundle.php' => 1,
'istatement.php' => 1,
'ppaindex.png' => 1,
'idriver.php' => 1,
'iconnection.php' => 1,
'statuscodes.php' => 1,
'codecoverage.php' => 1,
'redisbridge.php' => 1,
'wechatbundle.php' => 1,
'avrogeneratorbundle.php' => 1,
'icachebridge.php' => 1,
'coordinatesdistancebundle.php' => 1,
'filebridge.php' => 1,
'arraybridge.php' => 1,
'ilazybootstrapper.php' => 1,
'ibootstrapperregistry.php' => 1,
'openfirebundle.php' => 1,
'bootstrapperregistry.php' => 1,
'config.module.config.php' => 1,
'jira.dist.yml' => 1,
'token.json' => 1,
'invalidcsrftokenexception.php' => 1,
'iauthenticationcontext.php' => 1,
'invalidqueryexception.php' => 1,
'guestuser.php' => 1,
'avroblogbundle.php' => 1,
'avrocasebundle.php' => 1,
'isession.php' => 1,
'routeexception.php' => 1,
'avrocsvbundle.php' => 1,
'updatequery.php' => 1,
'avroimagebundle.php' => 1,
'avrolocationbundle.php' => 1,
'selectquery.php' => 1,
'insertquery.php' => 1,
'iocexception.php' => 1,
'avroratingbundle.php' => 1,
'avrostripebundle.php' => 1,
'deletequery.php' => 1,
'conditionalquerybuilder.php' => 1,
'augmentingquerybuilder.php' => 1,
'ipipeline.php' => 1,
'iunitofwork.php' => 1,
'ientityregistry.php' => 1,
'ientity.php' => 1,
'entitystates.php' => 1,
'entityregistry.php' => 1,
'applicationbinder.php' => 1,
'readme-php' => 1,
'apc.ini' => 1,
'ligneinstance.php' => 1,
'project.xml' => 1,
'todo_release' => 1,
'upgrade-to-2.0' => 1,
'doc-en' => 1,
'de_ch.csv' => 1,
'doc-fr' => 1,
'mindfireexpiryfieldbundle.php' => 1,
'thirdparty' => 1,
'cnx.php' => 1,
'dbrm.php' => 1,
'vue.php' => 1,
'developing' => 1,
'datas.php' => 1,
'groupe.php' => 1,
'jsonrpcclient.php' => 1,
'jsonrpcexception.php' => 1,
'minify-options.php.dist' => 1,
'opensoftsimpleserializerbundle.php' => 1,
'opensoftrolloutbundle.php' => 1,
'jsonrpcserver.php' => 1,
'optimus' => 1,
'custompoststatus.php' => 1,
'application.init.php' => 1,
'dzangocartbundle.php' => 1,
'autogen.sh' => 1,
'travis-ci.enc' => 1,
'entitytypes.php' => 1,
'1.travis.yml' => 1,
'jekaimagebundle.php' => 1,
'authenticationstatustypes.php' => 1,
'authenticationcontext.php' => 1,
'email_reader.php' => 1,
'email_parser.php' => 1,
'jekaqiwibundle.php' => 1,
'.jelix-scripts.ini' => 1,
'optilolapibundle.php' => 1,
'payment.sql' => 1,
'dzangocartsubscriptionbundle.php' => 1,
'inc_setup_form.php' => 1,
'inc_sample.php' => 1,
'inc_index.php' => 1,
'inc_add_form.php' => 1,
'inc_add_conf.php' => 1,
'colibri' => 1,
'test_services.json.dist' => 1,
'uamamazonsearchbundle.php' => 1,
'uamdatatablesbundle.php' => 1,
'uamawsecsbundle.php' => 1,
'uamawsbundle.php' => 1,
'verily.php' => 1,
'code.photoswipe.jquery-3.0.5.js' => 1,
'compact-0070-out.jsonld' => 1,
'mergerfactory.php' => 1,
'compact-0023-out.jsonld' => 1,
'ocipdolobstreamwrapper.php' => 1,
'ocipdoadapter.php' => 1,
'compact-0024-context.jsonld' => 1,
'compact-0024-in.jsonld' => 1,
'ocidbconnection.php' => 1,
'compact-0024-out.jsonld' => 1,
'transformerinterface.php' => 1,
'compact-0025-context.jsonld' => 1,
'compact-0025-in.jsonld' => 1,
'merger.php' => 1,
'ocipdostatementadapter.php' => 1,
'compact-0025-out.jsonld' => 1,
'compact-0026-context.jsonld' => 1,
'compact-0026-in.jsonld' => 1,
'compact-0026-out.jsonld' => 1,
'compact-0027-context.jsonld' => 1,
'compact-0027-in.jsonld' => 1,
'compact-0027-out.jsonld' => 1,
'compact-0028-context.jsonld' => 1,
'compact-0028-in.jsonld' => 1,
'compact-0028-out.jsonld' => 1,
'compact-0023-in.jsonld' => 1,
'string2stream.php' => 1,
'compact-0029-in.jsonld' => 1,
'correiosshipping.php' => 1,
'compact-0021-context.jsonld' => 1,
'compact-0021-in.jsonld' => 1,
'newscoopgoogleeventspluginbundle.php' => 1,
'nsmtwigextensionsbundle.php' => 1,
'compact-0021-out.jsonld' => 1,
'nsmemojibundle.php' => 1,
'compact-0022-context.jsonld' => 1,
'nsmdatetimebundle.php' => 1,
'jcrop.php' => 1,
'compact-0022-in.jsonld' => 1,
'compact-0022-out.jsonld' => 1,
'neutroncomponentbundle.php' => 1,
'd' => 1,
'phpunit.travis.xml.dist' => 1,
'compact-0023-context.jsonld' => 1,
'phpunit-hhvm.xml' => 1,
'hhvm.properties' => 1,
'coverage.db' => 1,
'webkitcontentblocker.php' => 1,
'easylistparser.php' => 1,
'.travis-generate-docs.sh' => 1,
'reademe.md' => 1,
'compact-0029-context.jsonld' => 1,
'compact-0029-out.jsonld' => 1,
'compact-0020-in.jsonld' => 1,
'compact-0037-in.jsonld' => 1,
'compact-0036-in.jsonld' => 1,
'selenium-server-standalone-2.46.0.jar' => 1,
'generate-api-docs.php' => 1,
'netvliesformbundle.php' => 1,
'netvliesbolopenapibundle.php' => 1,
'netvliesbasecampbundle.php' => 1,
'compact-0036-out.jsonld' => 1,
'compact-0037-context.jsonld' => 1,
'netvliesdoctrinebridgebundle.php' => 1,
'nettobrdwbundle.php' => 1,
'rsslib.php' => 1,
'compact-0035-out.jsonld' => 1,
'compact-0037-out.jsonld' => 1,
'compact-0038-context.jsonld' => 1,
'compact-0038-in.jsonld' => 1,
'compact-0038-out.jsonld' => 1,
'compact-0039-context.jsonld' => 1,
'compact-0039-in.jsonld' => 1,
'compact-0039-out.jsonld' => 1,
'compact-0040-context.jsonld' => 1,
'compact-0040-in.jsonld' => 1,
'compact-0040-out.jsonld' => 1,
'compact-0036-context.jsonld' => 1,
'selenium-server-standalone.jar' => 1,
'compact-0030-context.jsonld' => 1,
'js.jar' => 1,
'compact-0030-in.jsonld' => 1,
'compact-0030-out.jsonld' => 1,
'compact-0031-context.jsonld' => 1,
'compact-0031-in.jsonld' => 1,
'compact-0031-out.jsonld' => 1,
'compact-0032-context.jsonld' => 1,
'compact-0032-in.jsonld' => 1,
'fieldregistry.php' => 1,
'zepto.min.js' => 1,
'zepto.js' => 1,
'compact-0032-out.jsonld' => 1,
'compact-0035-in.jsonld' => 1,
'compact-0033-context.jsonld' => 1,
'compact-0033-in.jsonld' => 1,
'mysql-connector-java-5.1.26-bin.jar' => 1,
'compact-0033-out.jsonld' => 1,
'jslint.js' => 1,
'compact-0034-context.jsonld' => 1,
'compact-0034-in.jsonld' => 1,
'compact-0034-out.jsonld' => 1,
'compact-0035-context.jsonld' => 1,
'netzmacht.main.xml' => 1,
'simplexmlrpc.php' => 1,
'compact-0020-out.jsonld' => 1,
'newscoopinstagrampluginbundle.php' => 1,
'compact-0041-in.jsonld' => 1,
'compact-0012-in.jsonld' => 1,
'mongosession.php' => 1,
'resume.xml' => 1,
'custom-style.css' => 1,
'nickprocdnbundle.php' => 1,
'bootstrap.json' => 1,
'start-server.bat' => 1,
'start-server-visible.bat' => 1,
'propel.xml.dist' => 1,
'compact-0011-out.jsonld' => 1,
'compact-0012-context.jsonld' => 1,
'propel.xml' => 1,
'compact-0011-in.jsonld' => 1,
'propel-config.php' => 1,
'compact-0012-out.jsonld' => 1,
'compact-0013-context.jsonld' => 1,
'appbox' => 1,
'compact-0013-in.jsonld' => 1,
'compact-0013-out.jsonld' => 1,
'pinboard-archive' => 1,
'compact-0014-context.jsonld' => 1,
'compact-0014-in.jsonld' => 1,
'compact-0014-out.jsonld' => 1,
'nicokaagqueueingbundle.php' => 1,
'compact-0011-context.jsonld' => 1,
'compact-0015-in.jsonld' => 1,
'header_no_display.php' => 1,
'ndewezwebhomeauthapibundle.php' => 1,
'compact-0006-out.jsonld' => 1,
'compact-0007-context.jsonld' => 1,
'xh_types.php' => 1,
'xh_formalertemail.php' => 1,
'compact-0007-in.jsonld' => 1,
'compact-0007-out.jsonld' => 1,
'compact-0008-context.jsonld' => 1,
'compact-0008-in.jsonld' => 1,
'compact-0008-out.jsonld' => 1,
'footer_no_display.php' => 1,
'compact-0010-out.jsonld' => 1,
'bootup.shim.php' => 1,
'compact-0009-context.jsonld' => 1,
'postfix_log_bounces.sql' => 1,
'bootup.logger.php' => 1,
'form_helper.php' => 1,
'nbprestacmsthemestarterbundle.php' => 1,
'compact-0009-in.jsonld' => 1,
'compact-0009-out.jsonld' => 1,
'nbprestacmslinkbundle.php' => 1,
'compact-0010-context.jsonld' => 1,
'compact-0010-in.jsonld' => 1,
'compact-0015-context.jsonld' => 1,
'kellersoundexfrbundle.php' => 1,
'compact-0020-context.jsonld' => 1,
'newscooppaywallbundle.php' => 1,
'readme.md.ready' => 1,
'silkworm.php' => 1,
'readme[zh]' => 1,
'readme[jp]' => 1,
'newup' => 1,
'newup.php' => 1,
'newscoopprintissuemanagerbundle.php' => 1,
'newscoopsendfeedbackbundle.php' => 1,
'compact-0018-out.jsonld' => 1,
'newscooppublishingplatformspluginbundle.php' => 1,
'newscoopnewsletterpluginbundle.php' => 1,
'example_dns01.php' => 1,
'newscoopexamplepluginbundle.php' => 1,
'newscoopcommentlistsbundle.php' => 1,
'compact-0019-context.jsonld' => 1,
'newscoopcitizenreporterpluginbundle.php' => 1,
'compact-0019-in.jsonld' => 1,
'compact-0019-out.jsonld' => 1,
'newscooparticlescalendarbundle.php' => 1,
'newscooparticlerecommendationbundle.php' => 1,
'pluginsinstaller.php' => 1,
'newscoop-instagram-plugin-bundle-0.0.1.zip' => 1,
'compact-0018-in.jsonld' => 1,
'example_http01.php' => 1,
'convertrangemessage.php' => 1,
'lyst.php' => 1,
'salvapdfjsbundle.php' => 1,
'compact-0015-out.jsonld' => 1,
'pdfjs license' => 1,
'salvajshrinkbundle.php' => 1,
'serverip.php' => 1,
'compact-0016-context.jsonld' => 1,
'jssdk.php' => 1,
'compact-0016-in.jsonld' => 1,
'altoroutertest.php' => 1,
'lystinterface.php' => 1,
'immutablelyst.php' => 1,
'compact-0018-context.jsonld' => 1,
'entityproviderinterface.php' => 1,
'actor.php' => 1,
'compact-0016-out.jsonld' => 1,
'db-migrate.phar' => 1,
'compact-0017-context.jsonld' => 1,
'readmecomplete' => 1,
'minifw' => 1,
'compact-0017-in.jsonld' => 1,
'tritoqshippingbundle.php' => 1,
'tritoqmanagerboletobundle.php' => 1,
'compact-0017-out.jsonld' => 1,
'compact-0041-context.jsonld' => 1,
'compact-0041-out.jsonld' => 1,
'compact-0006-context.jsonld' => 1,
'compact-0062-out.jsonld' => 1,
'dbus.c' => 1,
'neogen.yml' => 1,
'neogen.cypher' => 1,
'graphenedb_info.yml' => 1,
'coding_rules.xml' => 1,
'phpunit.xml.dist ' => 1,
'cayetanosorianokarmacracybundle.php' => 1,
'cayetanosorianohashidsbundle.php' => 1,
'compact-0062-in.jsonld' => 1,
'cakefile' => 1,
'releasehelpers.sh' => 1,
'print.jpg' => 1,
'filterstabilityflags.php' => 1,
'composermanifestmerger.php' => 1,
'ioniconsbundle.php' => 1,
'docker-compose-local.yml' => 1,
'readme.es' => 1,
'compact-0063-context.jsonld' => 1,
'compact-0063-in.jsonld' => 1,
'compact-0063-out.jsonld' => 1,
'physalis.bat' => 1,
'install-sendtoafriend' => 1,
'introspect.c' => 1,
'introspect.h' => 1,
'eicaptcha.php' => 1,
'compact-0059-out.jsonld' => 1,
'compact-0057-out.jsonld' => 1,
'loghelperplugin.php' => 1,
'customlogviewerplugin.php' => 1,
'ner0ticfoursquarebundle.php' => 1,
'landmarxbundle.php' => 1,
'compact-0058-context.jsonld' => 1,
'compact-0058-in.jsonld' => 1,
'compact-0058-out.jsonld' => 1,
'compact-0059-context.jsonld' => 1,
'compact-0059-in.jsonld' => 1,
'ner0ticjqueryplusbundle.php' => 1,
'compact-0062-context.jsonld' => 1,
'ddnetfoursquarebundle.php' => 1,
'compact-0060-context.jsonld' => 1,
'compact-0060-in.jsonld' => 1,
'compact-0060-out.jsonld' => 1,
'compact-0061-context.jsonld' => 1,
'compact-0061-in.jsonld' => 1,
'filemessageimporter.php' => 1,
'compact-0061-out.jsonld' => 1,
'dbmessageimporter.php' => 1,
'basis.php' => 1,
'php_dbus.h' => 1,
'install-productcomments' => 1,
'compact-0064-context.jsonld' => 1,
'compact-0057-in.jsonld' => 1,
'nejotwigextensionsbundle.php' => 1,
'compact-0068-out.jsonld' => 1,
'compact-0069-context.jsonld' => 1,
'ismscprovider.php' => 1,
'esmscprovider.php' => 1,
'esmscexception.php' => 1,
'compact-0069-in.jsonld' => 1,
'compact-0069-out.jsonld' => 1,
'compact-0070-context.jsonld' => 1,
'esmsc.php' => 1,
'econsolecommand.php' => 1,
'.coach.log' => 1,
'compact-0068-context.jsonld' => 1,
'.coach.dist.json' => 1,
'phraseappdescription.json' => 1,
'phraseappbundle.php' => 1,
'nuditydetector.php' => 1,
'compact-0070-in.jsonld' => 1,
'codeception.yml.erb' => 1,
'_set-codeception-group-args.sh' => 1,
'_before-test.sh' => 1,
'web-start.sh.erb' => 1,
'web-config.sh.erb' => 1,
'compact-0068-in.jsonld' => 1,
'compact-0067-out.jsonld' => 1,
'compact-0064-in.jsonld' => 1,
'logs.php' => 1,
'compact-0064-out.jsonld' => 1,
'eicaptcha-ajax.php' => 1,
'compact-0065-context.jsonld' => 1,
'twitter-essentials.php.dist' => 1,
'select2jsbundle.php' => 1,
'compact-0065-in.jsonld' => 1,
'foundationbundle.php' => 1,
'fontawesomebundle.php' => 1,
'compact-0065-out.jsonld' => 1,
'd3jsbundle.php' => 1,
'compact-0066-context.jsonld' => 1,
'nelmiocorsbundle.php' => 1,
'compact-0066-in.jsonld' => 1,
'activities.php' => 1,
'votes.php' => 1,
'fetch.php' => 1,
'apigen.yml.obsolete' => 1,
'reactserversiderendererbundle.php' => 1,
'compact-0066-out.jsonld' => 1,
'compact-0067-context.jsonld' => 1,
'compact-0067-in.jsonld' => 1,
'nelmiojsloggerbundle.php' => 1,
'nelmioesidebugbundle.php' => 1,
'schematic_amnavplugin.php' => 1,
'bild' => 1,
'imageedit.php' => 1,
'onescript.json' => 1,
'netinfluencesecuredisplaybundle.php' => 1,
'netinfluenceuploadbundle.php' => 1,
'compact-0046-context.jsonld' => 1,
'compact-0046-in.jsonld' => 1,
'compact-0046-out.jsonld' => 1,
'compact-0047-context.jsonld' => 1,
'compact-0047-in.jsonld' => 1,
'compact-0047-out.jsonld' => 1,
'compact-0048-context.jsonld' => 1,
'compact-0048-in.jsonld' => 1,
'netgustoparametertouchbundle.php' => 1,
'authorizerbehavior.php' => 1,
'netgustohmvcbundle.php' => 1,
'netgustodynamicsubdomainbundle.php' => 1,
'netgustodistributionbundle.php' => 1,
'netgustodeviationbundle.php' => 1,
'compact-0048-out.jsonld' => 1,
'netgustodevserverbundle.php' => 1,
'netgustobootcampbundle.php' => 1,
'netgustoautoroutebundle.php' => 1,
'compact-0049-context.jsonld' => 1,
'baikalwellknownbundle.php' => 1,
'authmanagertrait.php' => 1,
'authorizerquerybehavior.php' => 1,
'baikalmodelbundle.php' => 1,
'compact-0044-context.jsonld' => 1,
'imageclass.php' => 1,
'compact-0042-context.jsonld' => 1,
'imageadd_form.php' => 1,
'compact-0042-in.jsonld' => 1,
'compact-0042-out.jsonld' => 1,
'tordf-0028-out.nq' => 1,
'compact-0043-in.jsonld' => 1,
'compact-0043-out.jsonld' => 1,
'imageadd.php' => 1,
'comment_form.php' => 1,
'nmnmultiuserbundle.php' => 1,
'compact-0045-out.jsonld' => 1,
'compact-0044-in.jsonld' => 1,
'compact-0044-out.jsonld' => 1,
'netlabssmsgatewaybundle.php' => 1,
'netlabsadminextensionsbundle.php' => 1,
'safenet.php' => 1,
'safenet.c' => 1,
'php_safenet.h' => 1,
'compact-0045-context.jsonld' => 1,
'compact-0045-in.jsonld' => 1,
'traceableauthmanager.php' => 1,
'relationsrule.php' => 1,
'compact-0049-in.jsonld' => 1,
'compact-0049-out.jsonld' => 1,
'compact-0057-context.jsonld' => 1,
'compact-0053-in.jsonld' => 1,
'apiregistercontroller.php' => 1,
'sidebar' => 1,
'maisum' => 1,
'compact-0052-out.jsonld' => 1,
'johann' => 1,
'netdudesjstreebundle.php' => 1,
'netdudesdatasourcerybundle.php' => 1,
'compact-0053-context.jsonld' => 1,
'netboxdashboardbundle.php' => 1,
'app.groovy' => 1,
'compact-0053-out.jsonld' => 1,
'exceptionattributes.php' => 1,
'compact-0054-context.jsonld' => 1,
'compact-0054-in.jsonld' => 1,
'compact-0054-out.jsonld' => 1,
'compact-0055-context.jsonld' => 1,
'compact-0055-in.jsonld' => 1,
'compact-0055-out.jsonld' => 1,
'namecheap' => 1,
'compact-0056-context.jsonld' => 1,
'compact-0056-in.jsonld' => 1,
'compact-0056-out.jsonld' => 1,
'ioserviceprovider.php' => 1,
'compact-0052-in.jsonld' => 1,
'baikalkernelbundle.php' => 1,
'tagsserviceawaretrait.php' => 1,
'compact-0050-context.jsonld' => 1,
'compact-0050-in.jsonld' => 1,
'compact-0050-out.jsonld' => 1,
'compact-0051-context.jsonld' => 1,
'compact-0051-in.jsonld' => 1,
'compact-0051-out.jsonld' => 1,
'baikaldavservicesbundle.php' => 1,
'netgensearchandfilterbundle.php' => 1,
'ezpublish_readme' => 1,
'ezpublish_install' => 1,
'tagsserviceawareinterface.php' => 1,
'num.php' => 1,
'netgentagsbundle.php' => 1,
'netgenopengraphbundle.php' => 1,
'netgenezsyliusbundle.php' => 1,
'netgenezformsbundle.php' => 1,
'netgenenhancedselectionbundle.php' => 1,
'netgencontenttypelistbundle.php' => 1,
'netgenbirthdaybundle.php' => 1,
'compact-0052-context.jsonld' => 1,
'netgenhybridapproachbundle.php' => 1,
'netgenhtmlpdfapibundle.php' => 1,
'htmlpdfapi.php' => 1,
'compact-0006-in.jsonld' => 1,
'compact-0005-out.jsonld' => 1,
'wp-fos-export.php' => 1,
'job' => 1,
'packager.xml' => 1,
'docman.php' => 1,
'form_validator_props.php' => 1,
'form_admin.css' => 1,
'fileman_admin.css' => 1,
'fileman.php' => 1,
'docman.xml' => 1,
'install.script.php' => 1,
'web' => 1,
'bitapp.yml.dist' => 1,
'peclcmd.php' => 1,
'legacy.xml.dist' => 1,
'pkg_catcher.xml' => 1,
'pkg_categories.xml' => 1,
'pearcmd.php' => 1,
'mdb2.php' => 1,
'nomayasocialbundle.php' => 1,
'nosectionsconfigparserinterface.php' => 1,
'nosectionsconfigparser.php' => 1,
'configparserinterface.php' => 1,
'configparser.php' => 1,
'baseconfigparser.php' => 1,
'packager.test.xml' => 1,
'iblock.php' => 1,
'noiselabscountrybundle.php' => 1,
'server_off.html' => 1,
'vote_tools.php' => 1,
'vote_admin.css' => 1,
'keepvoting.php' => 1,
'translate_tools.php' => 1,
'herokutarget.php' => 1,
'.env.enc' => 1,
'jonlilckfinderbundle.php' => 1,
'.scss-lint.yml' => 1,
'translate_admin.css' => 1,
'options_user_settings_1.php' => 1,
'spread.php' => 1,
'wp-sane-setup.php' => 1,
'save_colors.php' => 1,
'option_triggers.php' => 1,
'jscore.php' => 1,
'filter_tools.php' => 1,
'coding_guidelines' => 1,
'test-requirements' => 1,
'checklist_structure.php' => 1,
'bx_root.php' => 1,
'ajax_tools.php' => 1,
'.director.yml' => 1,
'director' => 1,
'noiselabsnusoapbundle.php' => 1,
'countrymanager.php' => 1,
'edgarezcdnbundle.php' => 1,
'useragentobject.php' => 1,
'kunena.php' => 1,
'kunena.xml' => 1,
'nnmerutilsbundle.php' => 1,
'nnmerpushnotificationbundle.php' => 1,
'doorman.php' => 1,
'rephpd.sh' => 1,
'makefile.ini' => 1,
'useragentparser.php' => 1,
'remository.php' => 1,
'remository.xml' => 1,
'bootstrappbundle.php' => 1,
'sdl' => 1,
'default_transcoder.php' => 1,
'connstr.php' => 1,
'couchbaseviewquery.class.php' => 1,
'zoo.xml' => 1,
'couchbasen1qlquery.class.php' => 1,
'couchbaseclustermanager.class.php' => 1,
'jordillonchcrudgeneratorbundle.php' => 1,
'jordillonchdeploybundle.php' => 1,
'couchbasecluster.class.php' => 1,
'couchbasebucketmanager.class.php' => 1,
'readme-0.1.x' => 1,
'komento.xml' => 1,
'readme-pixiv' => 1,
'nodrewembedlybundle.php' => 1,
'readme-aozora' => 1,
'easydiscuss.php' => 1,
'easydiscuss.xml' => 1,
'bootstrap.phpunit.php' => 1,
'noetixtractionbundle.php' => 1,
'parameters.ini.dist' => 1,
'simpleorm.class.php' => 1,
'nodrewexceptionalbundle.php' => 1,
'jevents.php' => 1,
'jevents.xml' => 1,
'marvin' => 1,
'wm.api' => 1,
'k2.php' => 1,
'traits.twig' => 1,
'namespaces.twig' => 1,
'k2.xml' => 1,
'namespace.twig' => 1,
'interfaces.twig' => 1,
'doc-index.twig' => 1,
'classes.twig' => 1,
'komento.php' => 1,
'class.twig' => 1,
'phormat' => 1,
'template.json.dist' => 1,
'edgarezqrcodebundle.php' => 1,
'wtfcartbundle.php' => 1,
'noylecorpdoctrineextrasbundle.php' => 1,
'travisci-install.sh' => 1,
'phpiredis.ini' => 1,
'jomi' => 1,
'jomi.php' => 1,
'googleauthenticatorbundle.php' => 1,
'.config.env.sample' => 1,
'.config.env' => 1,
'php5-image.png' => 1,
'ajaxyasset.php' => 1,
'ajaxy.php' => 1,
'sunrise.php' => 1,
'nescartbundle.php' => 1,
'novuso-wp-common.php' => 1,
'novuscomcmfuserbundle.php' => 1,
'numeratormasker.php' => 1,
'numerator.php' => 1,
'flex_config.php' => 1,
'templatetrait.php' => 1,
'flexiblegrid.php' => 1,
'flexibleform.php' => 1,
'collapsablefield.php' => 1,
'phpqrcodebundle.php' => 1,
'servicesadminbundle.php' => 1,
'multiactiverecord.php' => 1,
'novawayfilemanagementbundle.php' => 1,
'mediaelementasset.php' => 1,
'wp-fos-import.php' => 1,
'options-admin.php' => 1,
'code.photoswipe-3.0.5.min.js' => 1,
'code.photoswipe-3.0.5.js' => 1,
'intercom.php' => 1,
'nutoolboxfoundationbundle.php' => 1,
'wyf_bootstrap.php' => 1,
'nthrootenhancedimagebundle.php' => 1,
'xzjg.xml' => 1,
'chartsredactorpluginasset.php' => 1,
'options-user.php' => 1,
'info.plist' => 1,
'shibboleth-mu.php' => 1,
'mediaelement.php' => 1,
'apachetikabundle.php' => 1,
'ntscorecalculatorbundle.php' => 1,
'gifexceptionbundle.php' => 1,
'jscrollpanewidget.php' => 1,
'intllessslugbehavior.php' => 1,
'nscpsformbundle.php' => 1,
'jolitypobundle.php' => 1,
'nscpsbrazilformbundle.php' => 1,
'kocart.sql' => 1,
'novawayopengraphbundle.php' => 1,
'nova' => 1,
'logger-example.php' => 1,
'jsoner.php' => 1,
'construct' => 1,
'balloufactory.php' => 1,
'project.sublime-workspace' => 1,
'jgibillogrambundle.php' => 1,
'project.sublime-project' => 1,
'sentrytarget.php' => 1,
'jgideadmanssnitchbundle.php' => 1,
'jgiswedishdatesbundle.php' => 1,
'agents-list.png' => 1,
'norzechowiczaceeditorbundle.php' => 1,
'jsoner.i18n.magic.php' => 1,
'campfirefactory.php' => 1,
'jsoner.hooks.php' => 1,
'noregressiontestbundle.php' => 1,
'nsactiverecord.php' => 1,
'airplane-mode.php' => 1,
'uploadform.php' => 1,
'pipes.php' => 1,
'pkg_todo.xml' => 1,
'basicauth.xml' => 1,
'basicauth.php' => 1,
'mysqli_etc.php' => 1,
'ballougateway.php' => 1,
'campfiregateway.php' => 1,
'yogateway.php' => 1,
'twiliofactory.php' => 1,
'registry-bundle.iml' => 1,
'tcpdfbundle.php' => 1,
'acf_pages_by_template.php' => 1,
'acf_pages_by_template_v4.php' => 1,
'acf_pages_by_template_v5.php' => 1,
'yofactory.php' => 1,
'jbibrowscapbundle.php' => 1,
'webhookgateway.php' => 1,
'webhookfactory.php' => 1,
'twiliogateway.php' => 1,
'slackgateway.php' => 1,
'notifymefactory.php' => 1,
'slackfactory.php' => 1,
'pushovergateway.php' => 1,
'pushoverfactory.php' => 1,
'pagerdutygateway.php' => 1,
'pagerdutyfactory.php' => 1,
'notifymemanager.php' => 1,
'gatewaytrait.php' => 1,
'hipchatgateway.php' => 1,
'hipchatfactory.php' => 1,
'gittergateway.php' => 1,
'gitterfactory.php' => 1,
'hyperion' => 1,
'couchbasebucket.class.php' => 1,
'compact-0005-in.jsonld' => 1,
'admin.settings.load.php' => 1,
'constants.inc.php' => 1,
'favico.ico' => 1,
'duo.load.php' => 1,
'apache-default.conf' => 1,
'modifiers.inc.php' => 1,
'tdnpilotbundle.php' => 1,
'admin.settings_duo.php' => 1,
'admin.settings_categories.php' => 1,
'admin.settings_api.php' => 1,
'admin.settings.php' => 1,
'csvexport.php' => 1,
'jrkdynamicpopupbundle.php' => 1,
'php_todo_finder.yml.sample' => 1,
'php_forbidden_function.yml.sample' => 1,
'php_forbidden_function.yml' => 1,
'sphinx.conf' => 1,
'mahana.sql' => 1,
'movies.sql' => 1,
'westest.php' => 1,
'mahana_address.php' => 1,
'after_build.sh' => 1,
'myfile' => 1,
'jrklevenshteinbundle.php' => 1,
'jrkadminatombundle.php' => 1,
'tests_config.sample' => 1,
'joypasswd.php' => 1,
'transit.php' => 1,
'kb.load.php' => 1,
'jotform.php' => 1,
'status.log' => 1,
'amazons3.php' => 1,
'items.php' => 1,
'items.offline.php' => 1,
'items.load.php' => 1,
'items.import.php' => 1,
'items.export.php' => 1,
'home.load.php' => 1,
'jrkpaymentsipsbundle.php' => 1,
'folders.php' => 1,
'mogreet.php' => 1,
'exploringfileutilitybundle.php' => 1,
'exploringstatusbundle.php' => 1,
'jpierrontapibatchbundle.php' => 1,
'changelog-0.0.0' => 1,
'hclabsmodelmanagerbundle.php' => 1,
'folders.load.php' => 1,
'jrkeasypaginationbundle.php' => 1,
'jrkfoobundle.php' => 1,
'find.load.php' => 1,
'nazkaaccesstokensecuritybundle.php' => 1,
'example.tpl' => 1,
'kb.php' => 1,
'satisbundle.php' => 1,
'install_mecab_php-mecab.sh' => 1,
'nighonweixinevents.php' => 1,
'nighonweixinbundle.php' => 1,
'nietonfirraygunbundle.php' => 1,
'compact-0002-in.jsonld' => 1,
'compact-0002-out.jsonld' => 1,
'compact-0003-context.jsonld' => 1,
'nietonfirgooglerecaptchabundle.php' => 1,
'googlerecaptcha.sublime-project' => 1,
'icebreadcrumbsbundle.php' => 1,
'nkuserbundle.php' => 1,
'compact-0001-out.jsonld' => 1,
'nkadminbundle.php' => 1,
'compact-0003-in.jsonld' => 1,
'compact-0003-out.jsonld' => 1,
'nicotecdoctrineautobundle.php' => 1,
'nmureencryptorbundle.php' => 1,
'ndewezwebhomecalendarapibundle.php' => 1,
'compact-0004-context.jsonld' => 1,
'compact-0004-in.jsonld' => 1,
'compact-0004-out.jsonld' => 1,
'compact-0005-context.jsonld' => 1,
'compact-0002-context.jsonld' => 1,
'compact-0001-in.jsonld' => 1,
'div.php' => 1,
'nazkaobjectmanagerbundle.php' => 1,
'div.html' => 1,
'dissalowed.php' => 1,
'dissalowedwomensnameslist_el_gr' => 1,
'dissalowedusernameslist' => 1,
'dissalowedpornsiteslist' => 1,
'dissalowedmannameslist_el_gr' => 1,
'nazkaattachmentbundle.php' => 1,
'dissalowedbadwordslist_en_us' => 1,
'dissalowedbadwordslist_el_gr' => 1,
'nazkalocationbundle.php' => 1,
'fastroute.hhi' => 1,
'compact-0001-context.jsonld' => 1,
'nazkapayablebundle.php' => 1,
'lazyloader.php' => 1,
'o.php' => 1,
'.csscomb.json' => 1,
'gitlab-ci.yml' => 1,
'md-ruleset.xml' => 1,
'travis-php-mecab.sh' => 1,
'xdebughelper.php' => 1,
'xdebug-helper.tab.phtml' => 1,
'oocurl.php' => 1,
'limelight_console' => 1,
'scandb.php' => 1,
'otv.php' => 1,
'migration.tpl' => 1,
'build.watchdog.xml' => 1,
'amazonproductlink.php' => 1,
'amazonconfig.php' => 1,
'dtpspybundle.php' => 1,
'colourpicker.png' => 1,
'usrmodule.php' => 1,
'nfymodule.php' => 1,
'build.download.xml' => 1,
'exportaction.php' => 1,
'eactivefinder.php' => 1,
'build.maintenance.xml' => 1,
'clay.php' => 1,
'iptoamazon.data' => 1,
'fhpostcodeapinubundle.php' => 1,
'elinkcolumn.php' => 1,
'egridcolumn.php' => 1,
'eeditablecolumn.php' => 1,
'joschi127doctrineentityoverridebundle.php' => 1,
'edatatables.php' => 1,
'phptimer.php' => 1,
'scrapermorefaster.php' => 1,
'smf_tester.php' => 1,
'edatacolumn.php' => 1,
'amazonstatic.php' => 1,
'iframeresizer.php' => 1,
'edtpagination.php' => 1,
'phplint' => 1,
'mogilefs.php' => 1,
'linkpagesizer.php' => 1,
'userinfointerface.php' => 1,
'consoleerrorhandler.php' => 1,
'localeconverter.php' => 1,
'yiiwhoopsinspector.php' => 1,
'behat.example.yml' => 1,
'dbsteward.php' => 1,
'vhost.conf' => 1,
'.config.properties' => 1,
'phpspecgen.php' => 1,
'iframeresizerasset.php' => 1,
'doap.php' => 1,
'sass.php' => 1,
'less.php' => 1,
'nixillaapiloggerbundle.php' => 1,
'mailrustrategy.php' => 1,
'nwlog.php' => 1,
'nwfileoperations.php' => 1,
'nwdatabase.php' => 1,
'nitrathemebundle.php' => 1,
'prettyphotoasset.php' => 1,
'prettyphoto.php' => 1,
'edtsort.php' => 1,
'echeckboxcolumn.php' => 1,
'createtables.sql' => 1,
'minion.example.yml' => 1,
'adminserviceprovider.php' => 1,
'twbs3serviceprovider.php' => 1,
'twbs3jumbonarrowserviceprovider.php' => 1,
'seed.csv' => 1,
'docs.pdf' => 1,
'adminlteserviceprovider.php' => 1,
'snapshot.php' => 1,
'notifyasset.php' => 1,
'bugtracker.php' => 1,
'ryzom_extra.php' => 1,
'runit.php' => 1,
'packagelist.php' => 1,
'views_logs.php' => 1,
'views_logs.load.php' => 1,
'views_database.php' => 1,
'views_database.load.php' => 1,
'views.load.php' => 1,
'users.load.php' => 1,
'suggestion.php' => 1,
'suggestion.load.php' => 1,
'cron' => 1,
'roles.load.php' => 1,
'dotenvstore.php' => 1,
'readme_sample' => 1,
'ebuttoncolumn.php' => 1,
'logserviceprovider.php' => 1,
'diceware.wordlist' => 1,
'diceware.pl.wordlist' => 1,
'diceware.php' => 1,
'jjbformutilsbundle.php' => 1,
'qqfileuploader.php' => 1,
'uploadsaveaction.php' => 1,
'uploaddeleteaction.php' => 1,
'eajaxuploadaction.php' => 1,
'eajaxupload.php' => 1,
'togglecomposer' => 1,
'wikiserviceprovider.php' => 1,
'codemitteforcetoolkitbundle.php' => 1,
'meerkat.php' => 1,
'mysqlidb.php' => 1,
'simpleboardserviceprovider.php' => 1,
'shopserviceprovider.php' => 1,
'dbobject' => 1,
'qnaserviceprovider.php' => 1,
'pageserviceprovider.php' => 1,
'productflatchangelogtest.php' => 1,
'classrewriter.php' => 1,
'pathresolver.php' => 1,
'mage-includes.php' => 1,
'flatten-0030-in.jsonld' => 1,
'abstracteloquentstatisticsprovider.php' => 1,
'rabbit-setup' => 1,
'select2_locale_cs.js' => 1,
'select2_locale_et.js' => 1,
'application_form.png' => 1,
'select2_locale_es.js' => 1,
'select2_locale_en.js.template' => 1,
'application_form_add.png' => 1,
'application_form_delete.png' => 1,
'select2_locale_el.js' => 1,
'select2_locale_de.js' => 1,
'select2_locale_da.js' => 1,
'application_form_edit.png' => 1,
'application_form_magnify.png' => 1,
'select2_locale_fa.js' => 1,
'select2_locale_ca.js' => 1,
'select2_locale_bg.js' => 1,
'select2_locale_az.js' => 1,
'select2_locale_ar.js' => 1,
'select2.png' => 1,
'select2.min.js' => 1,
'select2.js' => 1,
'select2.jquery.json' => 1,
'select2.css' => 1,
'application_get.png' => 1,
'select2_locale_eu.js' => 1,
'select2_locale_fi.js' => 1,
'application_go.png' => 1,
'select2_locale_he.js' => 1,
'select2_locale_ka.js' => 1,
'densa-lang-en.js' => 1,
'extensible-lang-en.js' => 1,
'select2_locale_ja.js' => 1,
'error.js' => 1,
'select2_locale_it.js' => 1,
'select2_locale_is.js' => 1,
'select2_locale_id.js' => 1,
'select2_locale_hu.js' => 1,
'select2_locale_hr.js' => 1,
'select2_locale_gl.js' => 1,
'application_error.png' => 1,
'ext-lang-en.js' => 1,
'pie.htc' => 1,
'accept.png' => 1,
'anchor.png' => 1,
'application.png' => 1,
'application_add.png' => 1,
'application_cascade.png' => 1,
'select2_locale_fr.js' => 1,
'application_delete.png' => 1,
'application_double.png' => 1,
'application_edit.png' => 1,
'select2-spinner.gif' => 1,
'select2-bootstrap.css' => 1,
'select2_locale_lt.js' => 1,
'kernelexceptionlistener.php' => 1,
'2014-08-01-15.json' => 1,
'application_view_list.png' => 1,
'example-user-config.yml' => 1,
'kwattroneo4jbundle.php' => 1,
'application_view_tile.png' => 1,
'application_xp.png' => 1,
'application_xp_terminal.png' => 1,
'arrow_branch.png' => 1,
'kutnytracybundle.php' => 1,
'arrow_divide.png' => 1,
'templateresolver.php' => 1,
'routerserviceprovider.php' => 1,
'kutnynobundlecontrollersbundle.php' => 1,
'arrow_down.png' => 1,
'findcontrollerservicescompilerpass.php' => 1,
'arrow_in.png' => 1,
'arrow_inout.png' => 1,
'arrow_join.png' => 1,
'kutnyfixturesbundle.php' => 1,
'kutnyautowiringbundle.php' => 1,
'autowiringcompilerpass.php' => 1,
'kustovvitalikmaintenancebundle.php' => 1,
'httpserviceprovider.php' => 1,
'arc2_testhandler.php' => 1,
'application_key.png' => 1,
'highmaps.js' => 1,
'application_lightning.png' => 1,
'application_link.png' => 1,
'application_osx.png' => 1,
'kwizerpdfbundle.php' => 1,
'highstock.src.js' => 1,
'highstock.js' => 1,
'application_osx_terminal.png' => 1,
'application_put.png' => 1,
'highstock-all.js' => 1,
'highmaps.src.js' => 1,
'application_side_boxes.png' => 1,
'application_view_icons.png' => 1,
'application_side_contract.png' => 1,
'application_side_expand.png' => 1,
'application_side_list.png' => 1,
'application_side_tree.png' => 1,
'application_split.png' => 1,
'application_tile_horizontal.png' => 1,
'todo.mkd' => 1,
'application_tile_vertical.png' => 1,
'application_view_columns.png' => 1,
'application_view_detail.png' => 1,
'application_view_gallery.png' => 1,
'select2_locale_ko.js' => 1,
'select2_locale_lv.js' => 1,
'arrow_merge.png' => 1,
'rgraphrose.php' => 1,
'naturaltime.php' => 1,
'logclient.php' => 1,
'phpunitawaretrait.php' => 1,
'phpunitawareinterface.php' => 1,
'phpunitaware.php' => 1,
'transmissionbundle.php' => 1,
'lifetime.php' => 1,
'labzonegitbundle.php' => 1,
'rgraphrscatter.php' => 1,
'rgraphradar.php' => 1,
'rgraphwaterfall.php' => 1,
'l10nbundle.php' => 1,
'rgraphwidget.php' => 1,
'package_builder.php' => 1,
'seosacommentbundle.php' => 1,
'seosafeedbackbundle.php' => 1,
'phpfastimage' => 1,
'seosaimaginebundle.php' => 1,
'kasonataadminjmstranslationbundle.php' => 1,
'doctrineprefixrbundle.php' => 1,
'feedreader.php' => 1,
'phpsesame.php' => 1,
'adobecampaignclientbundle.php' => 1,
'rgraphpie.php' => 1,
'jquery.jsplumb.min.js' => 1,
'rgraphgantt.php' => 1,
'wizresquebundle.php' => 1,
'constant.php' => 1,
'wizpaymentgatewaybundle.php' => 1,
'settingslib.php' => 1,
'rgraphbar.php' => 1,
'block_mhaairs_util.php' => 1,
'block_mhaairs_info.php' => 1,
'block_mhaairs_action.php' => 1,
'block_mhaairs.php' => 1,
'robot' => 1,
'fr_fr.script.csv' => 1,
'lafourchettebreadcrumbsbundle.php' => 1,
'rgraphhbar.php' => 1,
'fr_fr.missing.csv' => 1,
'rgraphhprogress.php' => 1,
'rgraphled.php' => 1,
'transpile' => 1,
'hack_test_bootstrap.php' => 1,
'talendclientbundle.php' => 1,
'rgraphline.php' => 1,
'switchuserstatelessbundle.php' => 1,
'pagerdutybundleexception.php' => 1,
'lafourchettepagerdutybundle.php' => 1,
'limitedtextarea.php' => 1,
'jquery.jsplumb.js' => 1,
'select2_locale_mk.js' => 1,
'select2_locale_ru.js' => 1,
'select2_locale_zh-tw.js' => 1,
'select2_locale_zh-cn.js' => 1,
'select2_locale_vi.js' => 1,
'select2_locale_uk.js' => 1,
'select2_locale_tr.js' => 1,
'select2_locale_th.js' => 1,
'compress.bat' => 1,
'select2_locale_sv.js' => 1,
'dump.bat' => 1,
'select2_locale_sk.js' => 1,
'select2_locale_rs.js' => 1,
'kwnrecognizeimbundle.php' => 1,
'select2_locale_ro.js' => 1,
'select2_locale_pt-pt.js' => 1,
'select2_locale_pt-br.js' => 1,
'yamato' => 1,
'hlp.xml' => 1,
'select2_locale_pl.js' => 1,
'field.js' => 1,
'select2_locale_no.js' => 1,
'select2_locale_nl.js' => 1,
'select2_locale_ms.js' => 1,
'select2x2.png' => 1,
'smssendercomponent.php' => 1,
'dom.jsplumb.min.js' => 1,
'sbp.php' => 1,
'hateoasbundle.php' => 1,
'dom.jsplumb.js' => 1,
'php-cg' => 1,
'slowdb' => 1,
'slowdb.jpg' => 1,
'markdown-spec.html' => 1,
'readme.skel' => 1,
'unknownformatexception.php' => 1,
'testcases' => 1,
'magelink.py' => 1,
'sbp' => 1,
'phpunit.xml.report' => 1,
'backendltebundle.php' => 1,
'cmd.bat' => 1,
'kcmediabundle.php' => 1,
'symfony-console' => 1,
'knorthfieldspresssass.php' => 1,
'sassminify.php' => 1,
'knorthfieldspressslugify.php' => 1,
'knoxgurunsbundle.php' => 1,
'knpuguardbundle.php' => 1,
'knpuoauth2clientbundle.php' => 1,
'kmap.php' => 1,
'arrow_left.png' => 1,
'arrow_out.png' => 1,
'jsnapcommander.php' => 1,
'building_add.png' => 1,
'bug_add.png' => 1,
'bug_delete.png' => 1,
'bug_edit.png' => 1,
'bug_error.png' => 1,
'bug_go.png' => 1,
'bug_link.png' => 1,
'building.png' => 1,
'ioniconsasset.php' => 1,
'adminltewidgettrait.php' => 1,
'kotiktestbundle.php' => 1,
'building_delete.png' => 1,
'briefcase.png' => 1,
'yiifotoramawidget.php' => 1,
'shortid.php' => 1,
'smartersalesforcebundle.php' => 1,
'labelwidget.php' => 1,
'info.jpg' => 1,
'building_edit.png' => 1,
'korneiljtmpasseticfilterbundle.php' => 1,
'building_error.png' => 1,
'logentriestarget.php' => 1,
'conditionalvalidator.php' => 1,
'bug.png' => 1,
'bricks.png' => 1,
'building_go.png' => 1,
'jquery.nivo.slider.js' => 1,
'box.png' => 1,
'kreaitfirebasebundle.php' => 1,
'permissions.jpg' => 1,
'brick.png' => 1,
'brick_add.png' => 1,
'play.html' => 1,
'cinemr.php' => 1,
'nivoslider.jquery.json' => 1,
'nivo-slider.css' => 1,
'jquery.nivo.slider.pack.js' => 1,
'stpredactorbundle.php' => 1,
'brick_link.png' => 1,
'stubs.php' => 1,
'brick_delete.png' => 1,
'brick_edit.png' => 1,
'brick_error.png' => 1,
'php_jitfu.h' => 1,
'jitfu.c' => 1,
'brick_go.png' => 1,
'renderer' => 1,
'relcopyasset.php' => 1,
'kpicazagoogleanalyticsbundle.php' => 1,
'codehighlightbundle.php' => 1,
'k1.php' => 1,
'k1.bat' => 1,
'kretacorebundle.php' => 1,
'bullet_error.png' => 1,
'bullet_black.png' => 1,
'eee' => 1,
'ddd' => 1,
'bullet_blue.png' => 1,
'ccc' => 1,
'bbb' => 1,
'altax.phar' => 1,
'bullet_delete.png' => 1,
'adminer.png' => 1,
'bullet_disk.png' => 1,
'kodifysimplecrudbundle.php' => 1,
'skcmsadminbundle.php' => 1,
'kodifydownloaderbundle.php' => 1,
'kodazzi' => 1,
'bullet_feed.png' => 1,
'ys' => 1,
'bullet_go.png' => 1,
'example-mailhide.php' => 1,
'example-captcha.php' => 1,
'swfupload.js' => 1,
'swfupload license' => 1,
'core changelog' => 1,
'http' => 1,
'bullet_arrow_up.png' => 1,
'k1' => 1,
'unteist.services.yml' => 1,
'building_key.png' => 1,
'konkretnyphpnewsletter.class.php' => 1,
'sendpush.php' => 1,
'building_link.png' => 1,
'bullet_add.png' => 1,
'bullet_arrow_bottom.png' => 1,
'konkretnygcm.class.php' => 1,
'konduto.php' => 1,
'bullet_arrow_down.png' => 1,
'unteist.yml' => 1,
'config-sample.yml' => 1,
'skcmsckfinderbundle.php' => 1,
'auth' => 1,
'kolbaassetsinstallextendedbundle.php' => 1,
'bullet_arrow_top.png' => 1,
'skcmsuserbundle.php' => 1,
'skcmstrashbinbundle.php' => 1,
'skcmstrackingbundle.php' => 1,
'skcmsshopbundle.php' => 1,
'skcmslocalebundle.php' => 1,
'skcmsfrontbundle.php' => 1,
'skcmscorebundle.php' => 1,
'skcmscontactbundle.php' => 1,
'checkboxtree.php' => 1,
'kretaissuebundle.php' => 1,
'arrow_redo.png' => 1,
'award_star_silver_1.png' => 1,
'smartmenusasset.php' => 1,
'award_star_bronze_1.png' => 1,
'award_star_bronze_2.png' => 1,
'award_star_bronze_3.png' => 1,
'award_star_delete.png' => 1,
'materializeinitasset.php' => 1,
'award_star_gold_1.png' => 1,
'upload.htaccess' => 1,
'award_star_gold_2.png' => 1,
'award_star_gold_3.png' => 1,
'award_star_silver_2.png' => 1,
'kuborghcsvbundle.php' => 1,
'award_star_silver_3.png' => 1,
'kcfindertextinput.php' => 1,
'kt_init.inc.php' => 1,
'basket.png' => 1,
'basket_add.png' => 1,
'rfcvalidator.php' => 1,
'curpvalidator.php' => 1,
'agilezenapi.php' => 1,
'numeroaletra.php' => 1,
'acknowledgements' => 1,
'award_star_add.png' => 1,
'datatransferbundle.php' => 1,
'phcompile.min.js' => 1,
'arrow_turn_right.png' => 1,
'taginputasset.php' => 1,
'taginput.php' => 1,
'arrow_refresh.png' => 1,
'followersocial.php' => 1,
'arrow_refresh_small.png' => 1,
'arrow_right.png' => 1,
'arrow_rotate_anticlockwise.png' => 1,
'arrow_rotate_clockwise.png' => 1,
'arrow_switch.png' => 1,
'arrow_turn_left.png' => 1,
'arrow_undo.png' => 1,
'kuborghqueuebundle.php' => 1,
'arrow_up.png' => 1,
'asterisk_orange.png' => 1,
'crear_phps.sh' => 1,
'asterisk_yellow.png' => 1,
'attach.png' => 1,
'doc_php_beautifier.ini' => 1,
'beautifier.php' => 1,
'kukulililabsfeaturetogglebundle.php' => 1,
'menu-icons-icomoon.php' => 1,
'icomoon.php' => 1,
'icomoon-ip.php' => 1,
'ksn135htpasswdbundle.php' => 1,
'basket_edit.png' => 1,
'kretamediabundle.php' => 1,
'gridviewassets.php' => 1,
'book_edit.png' => 1,
'book_error.png' => 1,
'book_go.png' => 1,
'book_key.png' => 1,
'book_link.png' => 1,
'skinasset.php' => 1,
'beyondasset.php' => 1,
'mageboy.png' => 1,
'book_next.png' => 1,
'blade-foundation.sublime-project' => 1,
'activetreeprovider.php' => 1,
'book_delete.png' => 1,
'referencebuilder.php' => 1,
'outputparser.php' => 1,
'diatheke.php' => 1,
'cogstupidmqbundle.php' => 1,
'kretaworkflowbundle.php' => 1,
'kretauserbundle.php' => 1,
'kretaprojectbundle.php' => 1,
'kretanotificationbundle.php' => 1,
'book_open.png' => 1,
'book_previous.png' => 1,
'kristofvclistbundle.php' => 1,
'book_addresses.png' => 1,
'phcompile.js' => 1,
'bell_go.png' => 1,
'basket_error.png' => 1,
'basket_go.png' => 1,
'tests_config.php' => 1,
'basket_put.png' => 1,
'basket_remove.png' => 1,
'bell.png' => 1,
'bell_add.png' => 1,
'bell_delete.png' => 1,
'bell_error.png' => 1,
'db_latest.sql' => 1,
'bell_link.png' => 1,
'book_add.png' => 1,
'bin.png' => 1,
'bin_closed.png' => 1,
'api-key.php.enc' => 1,
'bin_empty.png' => 1,
'api-key.php' => 1,
'smpp.php' => 1,
'kronassmppclientbundle.php' => 1,
'kronasrollbarbundle.php' => 1,
'krocosfileuploadbundle.php' => 1,
'bomb.png' => 1,
'book.png' => 1,
'hostnameseek.php' => 1,
'jsnaphelpers.php' => 1,
'swfobject.js' => 1,
'breadcrumbspanel.php' => 1,
'external.json.dist' => 1,
'256colors.php' => 1,
'ktwdatabasemenubundle.php' => 1,
'fvd.php' => 1,
'readme.mt' => 1,
'filetest.php' => 1,
'baseplugin.php' => 1,
'changelogsplugin.php' => 1,
'uploads3.php' => 1,
'amazonses.php' => 1,
'imageajax.php' => 1,
'parserconstants.php' => 1,
'jsonform.php' => 1,
'lastpage.php' => 1,
'panelcount.php' => 1,
'pluploadjuiasset.php' => 1,
'verticalmenu.php' => 1,
'basegateway.php' => 1,
'zclipbtn.php' => 1,
'jsonattributebehavior.php' => 1,
'flintlabsh5bpbundle.php' => 1,
'generatorasset.php' => 1,
'composer copy.json' => 1,
'xhubsignature.php' => 1,
'uspsratepackage.php' => 1,
'leapti18nbundle.php' => 1,
'leekgitdebugbundle.php' => 1,
'.scrutinizer-ci.phpunit.xml.dist' => 1,
'phptutorialslib.php' => 1,
'lazy_vs_strict.php' => 1,
'services_openstreetmap-0.0.1.tgz' => 1,
'tpsutilbundle.php' => 1,
'tpspaypalbundle.php' => 1,
'dndfileuploadbundle.php' => 1,
'errorvalidationpicker.php' => 1,
'leaptimbundle.php' => 1,
'leaptelasticabundle.php' => 1,
'jqueryajaxbundle.php' => 1,
'leaptcorebundle.php' => 1,
'leaptcachebundle.php' => 1,
'leaptbootstrapbundle.php' => 1,
'leaptadminbundle.php' => 1,
'taggablequerybehavior.php' => 1,
'csp-report.php' => 1,
'php_cs' => 1,
'brench.php' => 1,
'plug.php' => 1,
'classicmodels.dump' => 1,
'sagittarius.zip' => 1,
'ziparchivefilesystem.php' => 1,
'uspsxmlparser.php' => 1,
'dump_r.php' => 1,
'mysqldatetimebehavior.php' => 1,
'crisistextlineuserprofilebundle.php' => 1,
'beaver.php' => 1,
'readme.ko' => 1,
'imgtext.php' => 1,
'ooapc.php' => 1,
'imagetest.php' => 1,
'phprandom.php' => 1,
'pinboard-api.php' => 1,
'ary.php' => 1,
'arytest.php' => 1,
'rackspacefilesystem.php' => 1,
'nodetype_piwik.png' => 1,
'qiniufilesystem.php' => 1,
'nullfilesystem.php' => 1,
'localfilesystem.php' => 1,
'leapscache.php' => 1,
'gridfsfilesystem.php' => 1,
'ftpfilesystem.php' => 1,
'dropboxfilesystem.php' => 1,
'relatedbehavior.php' => 1,
'copyfilesystem.php' => 1,
'azurefilesystem.php' => 1,
'multilanguageserviceprovider.php' => 1,
'module_piwik.png' => 1,
'potx.admin.inc' => 1,
'eyecare' => 1,
'potx.drush.inc' => 1,
'potx.inc' => 1,
'potx.info.yml' => 1,
'potx.local.inc' => 1,
'potx.module' => 1,
'kgpagerbundle.php' => 1,
'kgweinrebundle.php' => 1,
'divlooperinboxbundle.php' => 1,
'cashnpay.php' => 1,
'cashnpaygatewayfactory.php' => 1,
'interactiveconsolebundle.php' => 1,
'nodetype_calendar_list.png' => 1,
'khepindrupaltransliteratorbundle.php' => 1,
'transliterator.php' => 1,
'khepinyamlfixturesbundle.php' => 1,
'runkit.php' => 1,
'khergeuuidbundle.php' => 1,
'redsysapi.php' => 1,
'redsyswdg.php' => 1,
'wp-vc-template-manager.php' => 1,
'webdavfilesystem.php' => 1,
'module_calendar.png' => 1,
'sftpfilesystem.php' => 1,
'route66.php' => 1,
'font_delete.png' => 1,
'aliossfilesystem.php' => 1,
'llssqsbundle.php' => 1,
'zenstruckobjectroutingbundle.php' => 1,
'zenstruckresourcebundle.php' => 1,
'multicraftapi.php' => 1,
'imperaviassets.php' => 1,
'fileapiadvanced.php' => 1,
'fileapi.php' => 1,
'barcodevalidator.php' => 1,
'barcodechecksum.php' => 1,
'barcodeasset.php' => 1,
'barcodeabstracttype.php' => 1,
'llsmonologextrabundle.php' => 1,
'zenstruckmobilebundle.php' => 1,
'llsdynamodbbundle.php' => 1,
'zenstruckslugifybundle.php' => 1,
'llsawsbundle.php' => 1,
'l3yincubatorsearchbundle.php' => 1,
'zenstruckversionbundle.php' => 1,
'webhookbundle.php' => 1,
'kdconsolealiasbundle.php' => 1,
'cronworker.php' => 1,
'webcroncontroller.php' => 1,
'webcronserviceprovider.php' => 1,
'routecontext.php' => 1,
'zenstruckmigrationsbundle.php' => 1,
'dotenvfillerserviceprovider.php' => 1,
'leohtajaxsearchbundle.php' => 1,
'gelfconfig.php' => 1,
'beanstalklr.php' => 1,
'opcoes.php' => 1,
'metodos.php' => 1,
'manutencao.php' => 1,
'historia' => 1,
'gera.php' => 1,
'creditos.php' => 1,
'classgenerator_2013-02-25.sql' => 1,
'zippy.inc.php' => 1,
'zenstruckdashboardbundle.php' => 1,
'zenstruckmediabundle.php' => 1,
'paginatedgrid.php' => 1,
'leogoutpaginatorbundle.php' => 1,
'zenstruckdatagridbundle.php' => 1,
'leogoutgallerybundle.php' => 1,
'leogoutbasebundle.php' => 1,
'unit.xml' => 1,
'integration.xml' => 1,
'bb.jpg' => 1,
'zenstruckformbundle.php' => 1,
'zenstruckimagineextrabundle.php' => 1,
'botdetectorinterface.php' => 1,
'dotenvfillercommand.php' => 1,
'encryptable.php' => 1,
'daterange.php' => 1,
'make_currencies.php' => 1,
'todayrange.php' => 1,
'statisticsproviderinterface.php' => 1,
'statisticsprovidercollection.php' => 1,
'logo2-96.png' => 1,
'statisticshelper.php' => 1,
'rangehelper.php' => 1,
'providershelper.php' => 1,
'monthrange.php' => 1,
'logo2.png' => 1,
'keesscheperspostcodenlapibundle.php' => 1,
'octoberplugintestcase.php' => 1,
'logo2-48.png' => 1,
'sipdoctrineextensionsbundle.php' => 1,
'kejwmenwhoopsbundle.php' => 1,
'kinwaebootstrapbundle.php' => 1,
'kinwaeuserbundle.php' => 1,
'lastyearrange.php' => 1,
'lastweekrange.php' => 1,
'lastmonthrange.php' => 1,
'kndradbundle.php' => 1,
'kjpaymentstripebundle.php' => 1,
'dayrange.php' => 1,
'logo2-64.png' => 1,
'logo2-32.png' => 1,
'guidable.php' => 1,
'logo-48.png' => 1,
'slugabble.php' => 1,
'permissionsserviceprovider.php' => 1,
'protecttrait.php' => 1,
'polishvalidatorrulesserviceprovider.php' => 1,
'keboolagoogleclientbundle.php' => 1,
'syrupcomponentbundle.php' => 1,
'changelog-id' => 1,
'logo-128.png' => 1,
'logo-256.png' => 1,
'logo-32.png' => 1,
'logo-64.png' => 1,
'weekrange.php' => 1,
'logo-96.png' => 1,
'logo2-128.png' => 1,
'logo2-256.png' => 1,
'lmlphp_logo_200.png' => 1,
'lml.php' => 1,
'lml.min.php' => 1,
4 => 1,
2 => 1,
'er_formatters.info.yml' => 1,
'yesterdayrange.php' => 1,
'yearrange.php' => 1,
'awss3filesystem.php' => 1,
'dialogpluginasset.php' => 1,
'junosspace.php' => 1,
'miniquery.php' => 1,
'kitpagesutilbundle.php' => 1,
'divisions_zh_cn.php' => 1,
'divisions_extra_zh_cn.php' => 1,
'worldquery.php' => 1,
'taobaoquery.php' => 1,
'sinaquery.php' => 1,
'kitpagesworkflowbundle.php' => 1,
'qqwryquery.php' => 1,
'kitpagesworkflowevents.php' => 1,
'monipdbquery.php' => 1,
'fullquery.php' => 1,
'guess_college.php' => 1,
'freeipipquery.php' => 1,
'filequery.php' => 1,
'databasequery.php' => 1,
'chinaquery.php' => 1,
'baidumapquery.php' => 1,
'kixstaticpagesbundle.php' => 1,
'liquidmetal.php' => 1,
'ipv4.yaml' => 1,
'ipv4' => 1,
'kjdatranslationbundle.php' => 1,
'guess_china.php' => 1,
'guess_world.php' => 1,
'light.php' => 1,
'lassomailparserbundle.php' => 1,
'kitpagesshopevents.php' => 1,
'lassomultilogbundle.php' => 1,
'jsonlogobject.php' => 1,
'partfactory.php' => 1,
'parsedmail.php' => 1,
'kitpagesshopcmsbundle.php' => 1,
'kitpagessimplecachebundle.php' => 1,
'kitpagessimpleedmbundle.php' => 1,
'kitpagessimpleedmevents.php' => 1,
'parsehelper.php' => 1,
'simpleedmexception.php' => 1,
'kitpagesusergeneratedevents.php' => 1,
'kitpagesstepbundle.php' => 1,
'registration' => 1,
'kitpagesstepevents.php' => 1,
'readme-regular-admin-forms' => 1,
'readme-lookup-tables' => 1,
'attila_tutoriel.docx' => 1,
'apollina_tutoriel.docx' => 1,
'stepexception.php' => 1,
'kitpagesusergeneratedbundle.php' => 1,
'moves.php' => 1,
'说昞' => 1,
'kkuetnetprestashopwebservicebundle.php' => 1,
'xpresion.png' => 1,
'kitpagesshopbundle.php' => 1,
'configuration.json' => 1,
'facebookextensiontrait.php' => 1,
'klesksliderbundle.php' => 1,
'headerparser.php' => 1,
'fgchttpclient.php' => 1,
'proxylib.php' => 1,
'neo4jclientbundle.php' => 1,
'jsonldresponse.php' => 1,
'hydrabundle.php' => 1,
'kickstart.sh' => 1,
'hydraapi.php' => 1,
'gitsynchronizer.php' => 1,
'lara' => 1,
'swoole_doc.php' => 1,
'nginx.tmpl' => 1,
'laravelserviceprovider.php' => 1,
'landingilogglybundle.php' => 1,
'framework.sql' => 1,
'adsb_raw.dat' => 1,
'lamosty-blog-helper.php' => 1,
'bedrock-plugin-control.php' => 1,
'markupbuilder.php' => 1,
'junosnetconf.php' => 1,
'facebookextensioninterface.php' => 1,
'composer.json.stub' => 1,
'lagdoctrinerepositorybundle.php' => 1,
'envoy' => 1,
'lagadminbundle.php' => 1,
'mongodbauthadapter.php' => 1,
'facebookauthenticationbundle.php' => 1,
'img.png' => 1,
'lissandra.png' => 1,
'ekko.jpg' => 1,
'example.gif' => 1,
'flare' => 1,
'facebookloginurlredirectresponse.php' => 1,
'lumen' => 1,
'facebookadapter.php' => 1,
'laraedit-v0.0.1.png' => 1,
'facebookadapteraware.php' => 1,
'lj-blog.php' => 1,
'trans_lang_lines.json' => 1,
'trans_comments.json' => 1,
'bladed.wiki' => 1,
'facebookadapterawareinterface.php' => 1,
'laravelcn' => 1,
'facebookadapterawaretrait.php' => 1,
'ordinationtrait.php' => 1,
'ordinationserviceprovider.php' => 1,
'laraedit-v0.0.2.png' => 1,
'multilogfactory.php' => 1,
'onlymessageformatter.php' => 1,
'fileobject.php' => 1,
'arraydiffhtml.php' => 1,
'wizard2.php' => 1,
'kimai.json' => 1,
'vinsearch.php' => 1,
'vehicles.php' => 1,
'vehicle.php' => 1,
'unit.php' => 1,
'unifilter.php' => 1,
'thanatosdigitaloceanbundle.php' => 1,
'nemesis.php' => 1,
'forker' => 1,
'readme-tests' => 1,
'wizardsearch.php' => 1,
'qgroups.php' => 1,
'qdetails.php' => 1,
'prag.php' => 1,
'localization_ru.php' => 1,
'localization_en.php' => 1,
'codecov' => 1,
'dependency.yml' => 1,
'framesearch.php' => 1,
'detailfilter.php' => 1,
'km.pm' => 1,
'wizard2bystep.php' => 1,
'wizardsearch2.php' => 1,
'applicability.php' => 1,
'ldaptoolsbundle.php' => 1,
'supercachebundle.php' => 1,
'h4md1jsqueezebundle.php' => 1,
'leaphlycartbundle.php' => 1,
'.realsync' => 1,
'treegridasset.php' => 1,
'treegrid.php' => 1,
'treecolumn.php' => 1,
'phpunit.xml.dist
' => 1,
'lepharemenubundle.php' => 1,
'lephareadmingeneratorbundle.php' => 1,
'killerwolfjcdecauxcyclocitybundle.php' => 1,
'procfile_dev' => 1,
'server-livereload.php' => 1,
'server-livereload.js' => 1,
'composer.jso' => 1,
'gatekeeperpropelbundle.php' => 1,
'lazyantsworkflowbundle.php' => 1,
'lazyantstoolkitbundle.php' => 1,
'lazyantsdynatreebundle.php' => 1,
'test-module-guestbook.yml' => 1,
'module-guestbook.yml' => 1,
'cody' => 1,
'code.yml' => 1,
'catalogs.php' => 1,
'am_searchpanel.php' => 1,
'clientfactory.php' => 1,
'kitpagesdatagridbundle.php' => 1,
'mu.php' => 1,
'ev.php' => 1,
'mess.php' => 1,
'.gitignore_global' => 1,
'mailboxmanager.php' => 1,
'kitpageschainevents.php' => 1,
'kitpagescommonstepbundle.php' => 1,
'lassovmailbundle.php' => 1,
'kitpagescompanybundle.php' => 1,
'kitpagescompanyevents.php' => 1,
'aliasmanager.php' => 1,
'chainexception.php' => 1,
'kitpagesdatagridevents.php' => 1,
'tokenfactory.php' => 1,
'lassooauth2clientbundle.php' => 1,
'kitpagesfilebundle.php' => 1,
'kitpagesfileevents.php' => 1,
'kitpagesfilesystembundle.php' => 1,
'kitpagesfilesystemevents.php' => 1,
'kitpagesmobileappbuilderbundle.php' => 1,
'kitpagespdfbundle.php' => 1,
'kitpagesredirectbundle.php' => 1,
'kitpagessemaphorebundle.php' => 1,
'kitpageschainbundle.php' => 1,
'kitpagescachecontrolbundle.php' => 1,
'am_manufacturerinfo.php' => 1,
'crunz' => 1,
'am_listmanufacturer.php' => 1,
'am_findoem.php' => 1,
'am_finddetail.php' => 1,
'aftermarket.php' => 1,
'lavoiesljquerybundle.php' => 1,
'jquery.resetform.js' => 1,
'polyfill.php' => 1,
'jquery.autocollapser.min.js' => 1,
'jquery.autocollapser.js' => 1,
'sked' => 1,
'endroidqrcodebundle.php' => 1,
'kitpagesactivityevents.php' => 1,
'lopipusherbundle.php' => 1,
'latyshababundle.php' => 1,
'example.zip' => 1,
'murmurhash3.php' => 1,
'km.php' => 1,
'km.py' => 1,
'km.rb' => 1,
'webuipopover.php' => 1,
'webuipopoverasset.php' => 1,
'activityexception.php' => 1,
'kitpagesactivitybundle.php' => 1,
'2.2.0.1.kdev4' => 1,
'xhtml_valid.png' => 1,
'moipbundle.php' => 1,
'page_white_coldfusion.png' => 1,
'drive_edit.png' => 1,
'drive_error.png' => 1,
'page_white_cup.png' => 1,
'drive_go.png' => 1,
'page_white_csharp.png' => 1,
'page_white_cplusplus.png' => 1,
'page_white_copy.png' => 1,
'drive_key.png' => 1,
'page_white_compressed.png' => 1,
'drive_link.png' => 1,
'page_white_code_red.png' => 1,
'page_white_delete.png' => 1,
'drive_magnify.png' => 1,
'drive_network.png' => 1,
'drive_rename.png' => 1,
'drive_user.png' => 1,
'page_white_code.png' => 1,
'drive_web.png' => 1,
'dvd.png' => 1,
'page_white_cd.png' => 1,
'page_white_camera.png' => 1,
'page_white_c.png' => 1,
'page_white_database.png' => 1,
'drive_disk.png' => 1,
'page_white_actionscript.png' => 1,
'page_white_horizontal.png' => 1,
'drink_empty.png' => 1,
'page_white_medal.png' => 1,
'drive.png' => 1,
'drive_add.png' => 1,
'page_white_magnify.png' => 1,
'page_white_link.png' => 1,
'drive_burn.png' => 1,
'page_white_lightning.png' => 1,
'drive_cd.png' => 1,
'page_white_key.png' => 1,
'page_white_h.png' => 1,
'drive_delete.png' => 1,
'page_white_go.png' => 1,
'page_white_get.png' => 1,
'page_white_gear.png' => 1,
'page_white_freehand.png' => 1,
'page_white_flash.png' => 1,
'page_white_find.png' => 1,
'page_white_excel.png' => 1,
'page_white_error.png' => 1,
'page_white_edit.png' => 1,
'drive_cd_empty.png' => 1,
'page_white_dvd.png' => 1,
'page_white_add.png' => 1,
'page_white_acrobat.png' => 1,
'page_white_office.png' => 1,
'overlays.png' => 1,
'page_attach.png' => 1,
'page_add.png' => 1,
'page.png' => 1,
'package_link.png' => 1,
'package_green.png' => 1,
'package_go.png' => 1,
'package_delete.png' => 1,
'package_add.png' => 1,
'email_delete.png' => 1,
'email_edit.png' => 1,
'email_error.png' => 1,
'page_copy.png' => 1,
'email_go.png' => 1,
'note_go.png' => 1,
'email_link.png' => 1,
'email_open.png' => 1,
'note_error.png' => 1,
'note_edit.png' => 1,
'note_delete.png' => 1,
'email_open_image.png' => 1,
'emoticon_evilgrin.png' => 1,
'note_add.png' => 1,
'page_code.png' => 1,
'page_delete.png' => 1,
'page_white.png' => 1,
'page_key.png' => 1,
'page_save.png' => 1,
'page_refresh.png' => 1,
'page_red.png' => 1,
'page_paste.png' => 1,
'dvd_add.png' => 1,
'page_paintbrush.png' => 1,
'dvd_delete.png' => 1,
'page_link.png' => 1,
'dvd_edit.png' => 1,
'page_lightning.png' => 1,
'page_green.png' => 1,
'page_error.png' => 1,
'dvd_error.png' => 1,
'dvd_go.png' => 1,
'dvd_key.png' => 1,
'dvd_link.png' => 1,
'page_go.png' => 1,
'email.png' => 1,
'page_gear.png' => 1,
'email_add.png' => 1,
'email_attach.png' => 1,
'page_find.png' => 1,
'page_excel.png' => 1,
'drink.png' => 1,
'page_white_paint.png' => 1,
'emoticon_happy.png' => 1,
'database_gear.png' => 1,
'picture_save.png' => 1,
'picture_link.png' => 1,
'picture_key.png' => 1,
'database_error.png' => 1,
'picture_go.png' => 1,
'picture_error.png' => 1,
'picture_empty.png' => 1,
'picture_edit.png' => 1,
'picture_delete.png' => 1,
'picture_add.png' => 1,
'database_go.png' => 1,
'pilcrow.png' => 1,
'database_key.png' => 1,
'database_lightning.png' => 1,
'photos.png' => 1,
'photo_link.png' => 1,
'photo_delete.png' => 1,
'database_link.png' => 1,
'photo_add.png' => 1,
'photo.png' => 1,
'phone_sound.png' => 1,
'database_refresh.png' => 1,
'pictures.png' => 1,
'pill.png' => 1,
'database_table.png' => 1,
'cut_red.png' => 1,
'cup_go.png' => 1,
'printer_empty.png' => 1,
'printer_delete.png' => 1,
'printer_add.png' => 1,
'cup_key.png' => 1,
'printer.png' => 1,
'plugin_link.png' => 1,
'cup_link.png' => 1,
'cursor.png' => 1,
'cut.png' => 1,
'plugin_go.png' => 1,
'pill_add.png' => 1,
'plugin_error.png' => 1,
'database_add.png' => 1,
'plugin_edit.png' => 1,
'plugin_disabled.png' => 1,
'plugin_delete.png' => 1,
'database_connect.png' => 1,
'plugin_add.png' => 1,
'database_delete.png' => 1,
'pill_go.png' => 1,
'pill_delete.png' => 1,
'database_edit.png' => 1,
'database_save.png' => 1,
'date.png' => 1,
'page_white_paintbrush.png' => 1,
'page_white_text.png' => 1,
'page_white_word.png' => 1,
'page_white_width.png' => 1,
'page_white_visualstudio.png' => 1,
'disk.png' => 1,
'page_white_vector.png' => 1,
'page_white_tux.png' => 1,
'page_white_text_width.png' => 1,
'disk_multiple.png' => 1,
'door.png' => 1,
'door_in.png' => 1,
'page_white_swoosh.png' => 1,
'page_white_wrench.png' => 1,
'door_open.png' => 1,
'door_out.png' => 1,
'page_white_star.png' => 1,
'page_white_stack.png' => 1,
'page_white_ruby.png' => 1,
'page_white_put.png' => 1,
'page_white_powerpoint.png' => 1,
'page_white_picture.png' => 1,
'page_white_php.png' => 1,
'page_white_paste.png' => 1,
'page_white_world.png' => 1,
'disconnect.png' => 1,
'date_add.png' => 1,
'pencil_add.png' => 1,
'date_delete.png' => 1,
'date_edit.png' => 1,
'date_error.png' => 1,
'date_go.png' => 1,
'phone_delete.png' => 1,
'phone_add.png' => 1,
'phone.png' => 1,
'pencil_go.png' => 1,
'date_link.png' => 1,
'pencil_delete.png' => 1,
'date_magnify.png' => 1,
'delete.png' => 1,
'date_next.png' => 1,
'pencil.png' => 1,
'paste_word.png' => 1,
'paste_plain.png' => 1,
'palette.png' => 1,
'paintcan.png' => 1,
'paintbrush.png' => 1,
'page_world.png' => 1,
'page_word.png' => 1,
'page_white_zip.png' => 1,
'date_previous.png' => 1,
'emoticon_grin.png' => 1,
'note.png' => 1,
'printer_error.png' => 1,
'ipod_sound.png' => 1,
'key.png' => 1,
'flag_yellow.png' => 1,
'joystick_error.png' => 1,
'folder.png' => 1,
'folder_add.png' => 1,
'joystick_delete.png' => 1,
'joystick_add.png' => 1,
'folder_bell.png' => 1,
'folder_brick.png' => 1,
'joystick.png' => 1,
'folder_bug.png' => 1,
'key_delete.png' => 1,
'ipod_cast_delete.png' => 1,
'folder_camera.png' => 1,
'folder_database.png' => 1,
'folder_delete.png' => 1,
'folder_edit.png' => 1,
'folder_error.png' => 1,
'ipod_cast_add.png' => 1,
'ipod_cast.png' => 1,
'ipod.png' => 1,
'information.png' => 1,
'key_add.png' => 1,
'key_go.png' => 1,
'image_link.png' => 1,
'layout_edit.png' => 1,
'lightbulb_off.png' => 1,
'lightbulb_delete.png' => 1,
'lightbulb_add.png' => 1,
'lightbulb.png' => 1,
'flag_blue.png' => 1,
'flag_green.png' => 1,
'layout_sidebar.png' => 1,
'layout_link.png' => 1,
'layout_header.png' => 1,
'layout_error.png' => 1,
'flag_orange.png' => 1,
'flag_red.png' => 1,
'layout_delete.png' => 1,
'layout_content.png' => 1,
'layout_add.png' => 1,
'flag_pink.png' => 1,
'flag_purple.png' => 1,
'layout.png' => 1,
'layers.png' => 1,
'keyboard_magnify.png' => 1,
'keyboard_delete.png' => 1,
'keyboard_add.png' => 1,
'keyboard.png' => 1,
'images.png' => 1,
'folder_explore.png' => 1,
'lightning_add.png' => 1,
'folder_user.png' => 1,
'heart_delete.png' => 1,
'heart_add.png' => 1,
'heart.png' => 1,
'group_link.png' => 1,
'group_key.png' => 1,
'folder_page_white.png' => 1,
'folder_palette.png' => 1,
'folder_picture.png' => 1,
'folder_star.png' => 1,
'folder_table.png' => 1,
'folder_wrench.png' => 1,
'hourglass.png' => 1,
'font.png' => 1,
'group_go.png' => 1,
'group_gear.png' => 1,
'group_error.png' => 1,
'font_add.png' => 1,
'group_edit.png' => 1,
'group_delete.png' => 1,
'group_add.png' => 1,
'group.png' => 1,
'font_go.png' => 1,
'help.png' => 1,
'hourglass_add.png' => 1,
'image_edit.png' => 1,
'folder_image.png' => 1,
'image_delete.png' => 1,
'folder_feed.png' => 1,
'folder_find.png' => 1,
'image_add.png' => 1,
'image.png' => 1,
'html_valid.png' => 1,
'html_go.png' => 1,
'folder_go.png' => 1,
'html_delete.png' => 1,
'folder_heart.png' => 1,
'html_add.png' => 1,
'hourglass_delete.png' => 1,
'html.png' => 1,
'house_link.png' => 1,
'house_go.png' => 1,
'house.png' => 1,
'folder_key.png' => 1,
'folder_lightbulb.png' => 1,
'folder_link.png' => 1,
'hourglass_link.png' => 1,
'hourglass_go.png' => 1,
'folder_magnify.png' => 1,
'folder_page.png' => 1,
'lightning.png' => 1,
'lightning_delete.png' => 1,
'emoticon_smile.png' => 1,
'money_delete.png' => 1,
'monitor_edit.png' => 1,
'monitor_delete.png' => 1,
'monitor_add.png' => 1,
'monitor.png' => 1,
'money_yen.png' => 1,
'feed_delete.png' => 1,
'money_pound.png' => 1,
'feed_disk.png' => 1,
'money_euro.png' => 1,
'money_dollar.png' => 1,
'money_add.png' => 1,
'feed_add.png' => 1,
'money.png' => 1,
'medal_silver_delete.png' => 1,
'medal_silver_add.png' => 1,
'medal_silver_3.png' => 1,
'medal_silver_2.png' => 1,
'medal_silver_1.png' => 1,
'medal_gold_delete.png' => 1,
'feed_edit.png' => 1,
'feed_error.png' => 1,
'feed_go.png' => 1,
'monitor_error.png' => 1,
'feed.png' => 1,
'medal_gold_add.png' => 1,
'music.png' => 1,
'emoticon_surprised.png' => 1,
'newspaper_link.png' => 1,
'emoticon_tongue.png' => 1,
'newspaper_go.png' => 1,
'newspaper_delete.png' => 1,
'newspaper_add.png' => 1,
'emoticon_unhappy.png' => 1,
'newspaper.png' => 1,
'new.png' => 1,
'emoticon_waii.png' => 1,
'emoticon_wink.png' => 1,
'monitor_go.png' => 1,
'error_add.png' => 1,
'mouse_error.png' => 1,
'error_delete.png' => 1,
'mouse_delete.png' => 1,
'mouse_add.png' => 1,
'error_go.png' => 1,
'mouse.png' => 1,
'exclamation.png' => 1,
'monitor_link.png' => 1,
'eye.png' => 1,
'monitor_lightning.png' => 1,
'feed_key.png' => 1,
'medal_gold_3.png' => 1,
'find.png' => 1,
'lock_break.png' => 1,
'lorry_go.png' => 1,
'lorry_flatbed.png' => 1,
'lorry_error.png' => 1,
'lorry_delete.png' => 1,
'lorry_add.png' => 1,
'lorry.png' => 1,
'lock_open.png' => 1,
'lock_go.png' => 1,
'lock_edit.png' => 1,
'lock_delete.png' => 1,
'lock_add.png' => 1,
'magifier_zoom_out.png' => 1,
'film_link.png' => 1,
'link_go.png' => 1,
'link_error.png' => 1,
'link_edit.png' => 1,
'link_delete.png' => 1,
'link_break.png' => 1,
'link_add.png' => 1,
'link.png' => 1,
'lightning_go.png' => 1,
'film_save.png' => 1,
'lorry_link.png' => 1,
'magnifier.png' => 1,
'medal_gold_2.png' => 1,
'film_delete.png' => 1,
'medal_gold_1.png' => 1,
'feed_link.png' => 1,
'medal_bronze_delete.png' => 1,
'medal_bronze_add.png' => 1,
'medal_bronze_3.png' => 1,
'medal_bronze_2.png' => 1,
'feed_magnify.png' => 1,
'female.png' => 1,
'film.png' => 1,
'film_add.png' => 1,
'medal_bronze_1.png' => 1,
'magnifier_zoom_in.png' => 1,
'map_magnify.png' => 1,
'film_edit.png' => 1,
'map_go.png' => 1,
'map_edit.png' => 1,
'map_delete.png' => 1,
'map_add.png' => 1,
'film_error.png' => 1,
'map.png' => 1,
'film_go.png' => 1,
'male.png' => 1,
'film_key.png' => 1,
'cup_error.png' => 1,
'rainbow.png' => 1,
'xhtml_go.png' => 1,
'text_indent_remove.png' => 1,
'text_lowercase.png' => 1,
'chart_bar_link.png' => 1,
'text_list_numbers.png' => 1,
'chart_curve.png' => 1,
'text_list_bullets.png' => 1,
'text_linespacing.png' => 1,
'text_letterspacing.png' => 1,
'text_letter_omega.png' => 1,
'text_kerning.png' => 1,
'text_italic.png' => 1,
'chart_curve_add.png' => 1,
'chart_bar_error.png' => 1,
'text_indent.png' => 1,
'text_horizontalrule.png' => 1,
'text_heading_6.png' => 1,
'text_heading_5.png' => 1,
'text_heading_4.png' => 1,
'text_heading_3.png' => 1,
'text_heading_2.png' => 1,
'text_heading_1.png' => 1,
'text_dropcaps.png' => 1,
'text_columns.png' => 1,
'text_padding_bottom.png' => 1,
'chart_bar_edit.png' => 1,
'chart_curve_delete.png' => 1,
'cart_put.png' => 1,
'text_underline.png' => 1,
'text_superscript.png' => 1,
'cart_error.png' => 1,
'cart_go.png' => 1,
'text_subscript.png' => 1,
'text_strikethrough.png' => 1,
'text_smallcaps.png' => 1,
'text_signature.png' => 1,
'text_replace.png' => 1,
'text_padding_top.png' => 1,
'cart_remove.png' => 1,
'chart_bar_delete.png' => 1,
'cd.png' => 1,
'cd_add.png' => 1,
'cd_burn.png' => 1,
'cd_delete.png' => 1,
'cd_edit.png' => 1,
'cd_eject.png' => 1,
'cd_go.png' => 1,
'chart_bar.png' => 1,
'text_padding_right.png' => 1,
'chart_bar_add.png' => 1,
'text_padding_left.png' => 1,
'text_bold.png' => 1,
'chart_curve_edit.png' => 1,
'textfield.png' => 1,
'clock_add.png' => 1,
'chart_pie_add.png' => 1,
'chart_pie_delete.png' => 1,
'chart_pie_edit.png' => 1,
'chart_pie_error.png' => 1,
'telephone.png' => 1,
'chart_pie_link.png' => 1,
'clock.png' => 1,
'tag_yellow.png' => 1,
'tag_red.png' => 1,
'tag_purple.png' => 1,
'clock_delete.png' => 1,
'chart_organisation_delete.png' => 1,
'clock_edit.png' => 1,
'tag_pink.png' => 1,
'tag_orange.png' => 1,
'clock_error.png' => 1,
'clock_go.png' => 1,
'clock_link.png' => 1,
'clock_pause.png' => 1,
'clock_play.png' => 1,
'tag_green.png' => 1,
'clock_red.png' => 1,
'chart_pie.png' => 1,
'chart_organisation_add.png' => 1,
'text_allcaps.png' => 1,
'chart_line_delete.png' => 1,
'text_align_right.png' => 1,
'chart_curve_error.png' => 1,
'text_align_left.png' => 1,
'text_align_justify.png' => 1,
'text_align_center.png' => 1,
'chart_curve_go.png' => 1,
'chart_curve_link.png' => 1,
'television_delete.png' => 1,
'chart_line.png' => 1,
'chart_line_add.png' => 1,
'chart_line_edit.png' => 1,
'chart_organisation.png' => 1,
'television_add.png' => 1,
'chart_line_error.png' => 1,
'chart_line_link.png' => 1,
'television.png' => 1,
'telephone_link.png' => 1,
'telephone_key.png' => 1,
'telephone_go.png' => 1,
'telephone_error.png' => 1,
'telephone_edit.png' => 1,
'telephone_delete.png' => 1,
'telephone_add.png' => 1,
'text_uppercase.png' => 1,
'cart_edit.png' => 1,
'tag_blue_delete.png' => 1,
'calendar_edit.png' => 1,
'calculator_delete.png' => 1,
'calculator_edit.png' => 1,
'calculator_error.png' => 1,
'calculator_link.png' => 1,
'calendar_add.png' => 1,
'webcam_error.png' => 1,
'webcam_delete.png' => 1,
'webcam_add.png' => 1,
'calendar_delete.png' => 1,
'webcam.png' => 1,
'weather_sun.png' => 1,
'world.png' => 1,
'weather_snow.png' => 1,
'weather_rain.png' => 1,
'weather_lightning.png' => 1,
'weather_cloudy.png' => 1,
'weather_clouds.png' => 1,
'wand.png' => 1,
'vector_delete.png' => 1,
'vector_add.png' => 1,
'vector.png' => 1,
'vcard_edit.png' => 1,
'calculator_add.png' => 1,
'calculator.png' => 1,
'calendar_view_day.png' => 1,
'world_go.png' => 1,
'xhtml_delete.png' => 1,
'bullet_green.png' => 1,
'xhtml_add.png' => 1,
'bullet_key.png' => 1,
'bullet_orange.png' => 1,
'xhtml.png' => 1,
'bullet_picture.png' => 1,
'wrench_orange.png' => 1,
'wrench.png' => 1,
'world_link.png' => 1,
'bullet_pink.png' => 1,
'cake.png' => 1,
'bullet_purple.png' => 1,
'bullet_red.png' => 1,
'bullet_star.png' => 1,
'bullet_toggle_minus.png' => 1,
'bullet_toggle_plus.png' => 1,
'bullet_white.png' => 1,
'bullet_wrench.png' => 1,
'bullet_yellow.png' => 1,
'world_edit.png' => 1,
'world_delete.png' => 1,
'world_add.png' => 1,
'calendar_link.png' => 1,
'calendar_view_month.png' => 1,
'textfield_add.png' => 1,
'cart_add.png' => 1,
'camera_small.png' => 1,
'transmit_blue.png' => 1,
'cancel.png' => 1,
'car.png' => 1,
'transmit_add.png' => 1,
'transmit.png' => 1,
'car_add.png' => 1,
'car_delete.png' => 1,
'cart.png' => 1,
'timeline_marker.png' => 1,
'time_go.png' => 1,
'camera_go.png' => 1,
'time_delete.png' => 1,
'time_add.png' => 1,
'time.png' => 1,
'tick.png' => 1,
'thumb_up.png' => 1,
'thumb_down.png' => 1,
'textfield_rename.png' => 1,
'textfield_key.png' => 1,
'cart_delete.png' => 1,
'textfield_delete.png' => 1,
'camera_link.png' => 1,
'camera_error.png' => 1,
'calendar_view_week.png' => 1,
'user_go.png' => 1,
'camera.png' => 1,
'vcard_delete.png' => 1,
'camera_add.png' => 1,
'vcard_add.png' => 1,
'vcard.png' => 1,
'user_suit.png' => 1,
'user_red.png' => 1,
'user_orange.png' => 1,
'user_green.png' => 1,
'user_gray.png' => 1,
'user_female.png' => 1,
'transmit_delete.png' => 1,
'user_edit.png' => 1,
'user_delete.png' => 1,
'user_comment.png' => 1,
'camera_delete.png' => 1,
'user_add.png' => 1,
'camera_edit.png' => 1,
'user.png' => 1,
'tux.png' => 1,
'transmit_go.png' => 1,
'transmit_error.png' => 1,
'transmit_edit.png' => 1,
'tag_blue_edit.png' => 1,
'tag_blue_add.png' => 1,
'report.png' => 1,
'controller.png' => 1,
'control_stop_blue.png' => 1,
'shading.png' => 1,
'server_uncompressed.png' => 1,
'server_link.png' => 1,
'server_lightning.png' => 1,
'server_key.png' => 1,
'server_go.png' => 1,
'server_error.png' => 1,
'server_edit.png' => 1,
'server_delete.png' => 1,
'server_database.png' => 1,
'control_stop.png' => 1,
'server_connect.png' => 1,
'server_compressed.png' => 1,
'server_chart.png' => 1,
'server_add.png' => 1,
'controller_add.png' => 1,
'server.png' => 1,
'script_save.png' => 1,
'script_palette.png' => 1,
'script_link.png' => 1,
'script_lightning.png' => 1,
'shape_align_bottom.png' => 1,
'shape_align_center.png' => 1,
'controller_delete.png' => 1,
'shape_move_backwards.png' => 1,
'shape_square_edit.png' => 1,
'shape_square_delete.png' => 1,
'shape_square_add.png' => 1,
'shape_square.png' => 1,
'shape_rotate_clockwise.png' => 1,
'control_repeat.png' => 1,
'control_repeat_blue.png' => 1,
'shape_rotate_anticlockwise.png' => 1,
'shape_move_front.png' => 1,
'shape_move_forwards.png' => 1,
'shape_move_back.png' => 1,
'shape_align_left.png' => 1,
'control_rewind.png' => 1,
'control_rewind_blue.png' => 1,
'shape_handles.png' => 1,
'shape_group.png' => 1,
'shape_flip_vertical.png' => 1,
'control_start.png' => 1,
'shape_flip_horizontal.png' => 1,
'control_start_blue.png' => 1,
'shape_align_top.png' => 1,
'shape_align_right.png' => 1,
'shape_align_middle.png' => 1,
'script_key.png' => 1,
'script_go.png' => 1,
'shape_square_go.png' => 1,
'cup.png' => 1,
'rss_add.png' => 1,
'rss.png' => 1,
'rosette.png' => 1,
'resultset_previous.png' => 1,
'resultset_next.png' => 1,
'resultset_last.png' => 1,
'resultset_first.png' => 1,
'report_word.png' => 1,
'report_user.png' => 1,
'report_picture.png' => 1,
'report_magnify.png' => 1,
'rss_delete.png' => 1,
'cup_add.png' => 1,
'report_link.png' => 1,
'report_key.png' => 1,
'report_go.png' => 1,
'report_edit.png' => 1,
'report_disk.png' => 1,
'report_delete.png' => 1,
'cup_delete.png' => 1,
'report_add.png' => 1,
'cup_edit.png' => 1,
'css_valid.png' => 1,
'rss_go.png' => 1,
'controller_error.png' => 1,
'css_add.png' => 1,
'script_gear.png' => 1,
'creditcards.png' => 1,
'script_error.png' => 1,
'script_edit.png' => 1,
'cross.png' => 1,
'script_delete.png' => 1,
'css.png' => 1,
'script_code_red.png' => 1,
'script_code.png' => 1,
'script_add.png' => 1,
'script.png' => 1,
'rss_valid.png' => 1,
'ruby_put.png' => 1,
'ruby_link.png' => 1,
'ruby_key.png' => 1,
'ruby_go.png' => 1,
'css_delete.png' => 1,
'css_go.png' => 1,
'ruby_get.png' => 1,
'ruby_gear.png' => 1,
'ruby_delete.png' => 1,
'ruby_add.png' => 1,
'ruby.png' => 1,
'shape_square_error.png' => 1,
'shape_square_key.png' => 1,
'tag_blue.png' => 1,
'sum.png' => 1,
'color_swatch.png' => 1,
'table.png' => 1,
'tab_go.png' => 1,
'tab_edit.png' => 1,
'tab_delete.png' => 1,
'color_wheel.png' => 1,
'comment.png' => 1,
'comment_add.png' => 1,
'tab_add.png' => 1,
'tab.png' => 1,
'style_go.png' => 1,
'table_delete.png' => 1,
'style_edit.png' => 1,
'style_delete.png' => 1,
'style_add.png' => 1,
'style.png' => 1,
'stop.png' => 1,
'status_online.png' => 1,
'comment_delete.png' => 1,
'comment_edit.png' => 1,
'status_offline.png' => 1,
'status_busy.png' => 1,
'table_add.png' => 1,
'coins_delete.png' => 1,
'star.png' => 1,
'table_row_insert.png' => 1,
'tag.png' => 1,
'clock_stop.png' => 1,
'table_sort.png' => 1,
'cog.png' => 1,
'cog_add.png' => 1,
'cog_delete.png' => 1,
'cog_edit.png' => 1,
'cog_error.png' => 1,
'table_save.png' => 1,
'cog_go.png' => 1,
'table_row_delete.png' => 1,
'table_edit.png' => 1,
'table_relationship.png' => 1,
'table_refresh.png' => 1,
'table_multiple.png' => 1,
'table_link.png' => 1,
'coins.png' => 1,
'table_lightning.png' => 1,
'table_key.png' => 1,
'table_go.png' => 1,
'coins_add.png' => 1,
'table_gear.png' => 1,
'table_error.png' => 1,
'status_away.png' => 1,
'sport_tennis.png' => 1,
'shape_square_link.png' => 1,
'control_play.png' => 1,
'control_equalizer_blue.png' => 1,
'control_fastforward.png' => 1,
'control_fastforward_blue.png' => 1,
'sport_basketball.png' => 1,
'control_pause.png' => 1,
'sport_8ball.png' => 1,
'spellcheck.png' => 1,
'sound_none.png' => 1,
'sound_mute.png' => 1,
'control_pause_blue.png' => 1,
'sound_low.png' => 1,
'control_end_blue.png' => 1,
'sound_delete.png' => 1,
'sound_add.png' => 1,
'sound.png' => 1,
'sitemap_color.png' => 1,
'sitemap.png' => 1,
'control_play_blue.png' => 1,
'shield_go.png' => 1,
'shield_delete.png' => 1,
'shield_add.png' => 1,
'shield.png' => 1,
'shape_ungroup.png' => 1,
'control_equalizer.png' => 1,
'control_end.png' => 1,
'sport_soccer.png' => 1,
'computer_edit.png' => 1,
'comments.png' => 1,
'comments_add.png' => 1,
'sport_shuttlecock.png' => 1,
'comments_delete.png' => 1,
'sport_raquet.png' => 1,
'compress.png' => 1,
'sport_golf.png' => 1,
'computer.png' => 1,
'computer_add.png' => 1,
'computer_delete.png' => 1,
'computer_error.png' => 1,
'control_eject_blue.png' => 1,
'computer_go.png' => 1,
'computer_key.png' => 1,
'sport_football.png' => 1,
'computer_link.png' => 1,
'connect.png' => 1,
'contrast.png' => 1,
'contrast_decrease.png' => 1,
'contrast_high.png' => 1,
'contrast_increase.png' => 1,
'contrast_low.png' => 1,
'control_eject.png' => 1,
'gelfgl.php' => 1,
'tearrespectvalidationbundle.php' => 1,
'sync-install.sh' => 1,
'doc-parser' => 1,
'pdfmanager.php' => 1,
'ddpdfbundle.php' => 1,
'elementbuilder.php' => 1,
'phpclasseditor.php' => 1,
'phpirt.php' => 1,
'curl' => 1,
'tokenparser.php' => 1,
'dduserbundle.php' => 1,
'doc-parser.php' => 1,
'layoutmanager.php' => 1,
'tv' => 1,
'emadsystem.php' => 1,
'licence.bsd' => 1,
'divine.php' => 1,
'example-output.jpg' => 1,
'typoscript-lint' => 1,
'tslint.yml' => 1,
'tslint.dist.yml' => 1,
'go-pear.php' => 1,
'graphizer' => 1,
'.graphpizer.json' => 1,
'scrclubcmsbundle.php' => 1,
'ddfiltertypeguesserbundle.php' => 1,
'do' => 1,
'idnmacros.php' => 1,
'edemyeventbundle.php' => 1,
'readme_l4' => 1,
'edemythemebundle.php' => 1,
'edemyproductbundle.php' => 1,
'edemymathbundle.php' => 1,
'cmb2-related-links.php' => 1,
'ju1iuswebpackassetsbundle.php' => 1,
'edemymainbundle.php' => 1,
'juanber84profilercommandbundle.php' => 1,
'edemylinkbundle.php' => 1,
'edemyfbbundle.php' => 1,
'edemydesignbundle.php' => 1,
'csstestmatrix.html' => 1,
'juanber84simplei18nbundle.php' => 1,
'edemycustomerbundle.php' => 1,
'monologplugin.php' => 1,
'edemycrawlerbundle.php' => 1,
'ddcdnbundle.php' => 1,
'edemycartbundle.php' => 1,
'edemycarruselbundle.php' => 1,
'edemybookingbundle.php' => 1,
'edemybackupbundle.php' => 1,
'edemybackgroundbundle.php' => 1,
'edemyagendabundle.php' => 1,
'debugwrapper.php' => 1,
'hoathisresourcelocatorbundle.php' => 1,
'edemywikibundle.php' => 1,
'class-tlc-transient-update-server.php' => 1,
'travis_config.ini' => 1,
'.stickler.yml' => 1,
'markpavlitskiconstraintextrabundle.php' => 1,
'pluploadwidget.php' => 1,
'phpunit-teardown.php' => 1,
'phpunit-config.php' => 1,
'ensurecoverage.sh' => 1,
'mlphp-ghpages.ini' => 1,
'tlc-transients.php' => 1,
'class-tlc-transient.php' => 1,
'server_time.php' => 1,
'package.py' => 1,
'_sync_types.php' => 1,
'testloop.sh' => 1,
'xxammailclientbundle.php' => 1,
'composerfuture.json' => 1,
'layoutfuture.php' => 1,
'breakfast.xml' => 1,
'imgbuilder.php' => 1,
'accounts-woocommerce-plugin.php' => 1,
'__condorcetautoload.php' => 1,
'condorcet-logo.png' => 1,
'luminous' => 1,
'supported.php' => 1,
'catcha.php' => 1,
'initial_document' => 1,
'jucevejuflowchartbundle.php' => 1,
'tab.phtml' => 1,
'supportedmutations' => 1,
'jusimplesearchbundle.php' => 1,
'ieditable.php' => 1,
'babelfish.php' => 1,
'cmssettings.php' => 1,
'push-server.php' => 1,
'dokumentacja.html' => 1,
'pushconnection.php' => 1,
'marshmninkbundle.php' => 1,
'versioncheck.php' => 1,
'savegridpaginationbehavior.php' => 1,
'savegridfiltersbehavior.php' => 1,
'videothumb.php' => 1,
'marquesbehavior.php' => 1,
'jackalope.db' => 1,
'updgrade-2.0-dev' => 1,
'marmelabsonataelasticabundle.php' => 1,
'marmelabngadmingeneratorbundle.php' => 1,
'slim.php' => 1,
'wp-on-routes.php' => 1,
'awesomeheader.php' => 1,
'sample.log' => 1,
'dynamodbwrapper.php' => 1,
'mabaoauthcommerceproxybundle.php' => 1,
'asdadmbundle.php' => 1,
'teocorebundle.php' => 1,
'ginny.dist.yml' => 1,
'advemail.php' => 1,
'tordf-0111-in.jsonld' => 1,
'cjsdeliverybundle.php' => 1,
'cjsdelivery.php' => 1,
'itsdangerous.php' => 1,
'iptools.php' => 1,
'developer_detection.php' => 1,
'debugging.php' => 1,
'tordf-0111-out.nq' => 1,
'sluggenerator.php' => 1,
'categorieswidget.ss' => 1,
'categorieswidget.php' => 1,
'.travis_redis.sh' => 1,
'xlproc.php' => 1,
'examples-config.json.template' => 1,
'php-makeup' => 1,
'php-make-up.php' => 1,
'gitspam.sh' => 1,
'tordf-0112-in.jsonld' => 1,
'tordf-0112-out.nq' => 1,
'teodb18nbundle.php' => 1,
'teoproductbundle.php' => 1,
'gitspam.php' => 1,
'cypresslesselephantbundle.php' => 1,
'magic_forms.info' => 1,
'tordf-0105-in.jsonld' => 1,
'tordf-0105-out.nq' => 1,
'tordf-0106-in.jsonld' => 1,
'examples.inc' => 1,
'gulpfile.coffee' => 1,
'cypressdidebuggerbundle.php' => 1,
'cypresspygmentselephantbundle.php' => 1,
'tordf-0106-out.nq' => 1,
'tordf-0107-in.jsonld' => 1,
'tordf-0107-out.nq' => 1,
'teoboilerplatebundle.php' => 1,
'tordf-0108-in.jsonld' => 1,
'cypressgitelephantbundle.php' => 1,
'cypresstreebundle.php' => 1,
'cypressfixturesbundle.php' => 1,
'tordf-0108-out.nq' => 1,
'tordf-0109-in.jsonld' => 1,
'tordf-0109-out.nq' => 1,
'tordf-0110-in.jsonld' => 1,
'tordf-0110-out.nq' => 1,
'cypressconsoledefaultsbundle.php' => 1,
'cypresscompasselephantbundle.php' => 1,
'tordf-0113-in.jsonld' => 1,
'behat.ci.yml' => 1,
'tordf-manifest.jsonld' => 1,
'tordf-0118-in.jsonld' => 1,
'crud.class.php' => 1,
'function.script.php' => 1,
'function.css.php' => 1,
'velikonjalabbybundle.php' => 1,
'nb-configuration.xml' => 1,
'mumscrum-db-bak-latest.sql' => 1,
'tordf-0117-in.jsonld' => 1,
'tordf-0117-out.nq' => 1,
'insur-leav-type.sql' => 1,
'.springbeans' => 1,
'tordf-0118-out.nq' => 1,
'otbsbundle.php' => 1,
'tordf-0119-in.jsonld' => 1,
'massivesearchbundle.php' => 1,
'massivebuildbundle.php' => 1,
'epnumberstowordsbundle.php' => 1,
'massilmultiuserbundle.php' => 1,
'phptube.php' => 1,
'phpman.php' => 1,
'phpman.phar' => 1,
'tordf-0119-out.nq' => 1,
'asmmarkdowncontentbundle.php' => 1,
'routes.class.php' => 1,
'non-production-robots-ignore.php' => 1,
'customersupportbundle.php' => 1,
'customnavblocks.php' => 1,
'debug' => 1,
'axiolabbootstrapselectbundle.php' => 1,
'tordf-0113-out.nq' => 1,
'tordf-0114-in.jsonld' => 1,
'tordf-0114-out.nq' => 1,
'tordf-0115-in.jsonld' => 1,
'tordf-0115-out.nq' => 1,
'uml.class.violet' => 1,
'glue.class.violet.html' => 1,
'mathielenimportenginebundle.php' => 1,
'matheouserbundle.php' => 1,
'gorgcasbundle.php' => 1,
'migrant' => 1,
'docker.sh' => 1,
'gorguserbundle.php' => 1,
'gorgreplicationtriggerbundle.php' => 1,
'pdepend.xsl' => 1,
'cpd.xsl' => 1,
'gorgldapormbundle.php' => 1,
'tordf-0116-in.jsonld' => 1,
'gorgjirabundle.php' => 1,
'gorggramapiclientbundle.php' => 1,
'tordf-0116-out.nq' => 1,
'condorcet-logo.psd' => 1,
'mabaoauthcommerceencryptedcredentialsbundle.php' => 1,
'magic_forms.module' => 1,
'sync.ini.example' => 1,
'bootstrapnotifyalertasset.php' => 1,
'flashalert.php' => 1,
'mapadotwigextensionsbundle.php' => 1,
'taggingasset.php' => 1,
'taggingquery.php' => 1,
'taggingwidget.php' => 1,
'manyrussmsbundle.php' => 1,
'logomb.jpg' => 1,
'itplogo.png' => 1,
'flow' => 1,
'wssepassworddigestcreator.php' => 1,
'message-board.php' => 1,
'addons' => 1,
'options' => 1,
'wsseheadersfactory.php' => 1,
'wsseserverbundle.php' => 1,
'kusf2utilsbundle.php' => 1,
'date-picker-cs.js' => 1,
'ventasconfig.php' => 1,
'uploaddatabundle.php' => 1,
'configprovider.php' => 1,
'ssoserverbundle' => 1,
'mapadotypeaheadjsbundle.php' => 1,
'hybrid.php' => 1,
'kussoserverbundle.php' => 1,
'polylang-translate-rewrite-slugs.php' => 1,
'oxrun.phar' => 1,
'test_mysql.php' => 1,
'test_mysql_timeout.php' => 1,
'gizlabdoctrinebundle.php' => 1,
'readme.1.3.x' => 1,
'hooker.yml.dist' => 1,
'obhighchartsbundle.php' => 1,
'obcmsbundle.php' => 1,
'obcachenukebundle.php' => 1,
'oauth-server.php' => 1,
'readme.src' => 1,
'mockingjconsole' => 1,
'important' => 1,
'asanastrategy.php' => 1,
'documentation.pdf' => 1,
'consoler.php' => 1,
'mapbenderfeatureinfobundle.php' => 1,
'mapbenderdigitizerbundle.php' => 1,
'mapbendermaptoolbundle.php' => 1,
'vice.php' => 1,
'openuserbundle.php' => 1,
'mapbendergeotransporterbundle.php' => 1,
'mapbenderdatasourcebundle.php' => 1,
'ssoevents.php' => 1,
'kussoclientbundle.php' => 1,
'epilog' => 1,
'mb_str_replace_license' => 1,
'base-files.zip' => 1,
'jhomepermissionsbundle.php' => 1,
'supervisor.conf.example' => 1,
'htme.php' => 1,
'web_tester.sh' => 1,
'web_tester.json' => 1,
'datatext.php' => 1,
'emma_config.php' => 1,
'repositoryasaservicebundle.php' => 1,
'admin.crt' => 1,
'safety.png' => 1,
'jhvuserevents.php' => 1,
'fa' => 1,
'rest.sql' => 1,
'orm_validation.php' => 1,
'orm_table.php' => 1,
'orm_primary_key.php' => 1,
'orm_model.php' => 1,
'holiday_jp' => 1,
'imgin.php' => 1,
'orm_field.php' => 1,
'orm_association.php' => 1,
'mangatibasebundle.php' => 1,
'comingsoon' => 1,
'presupuestobundle.php' => 1,
'saveprice.php' => 1,
'manueltranslationbundle.php' => 1,
'manuelajaxflashbundle.php' => 1,
'kuajaxbundle.php' => 1,
'ajaxhandler.php' => 1,
'labobundle.php' => 1,
'labotestmanubundle.php' => 1,
'ajaxcontentmixed.html' => 1,
'uploadlink.php' => 1,
'date-picker.js' => 1,
'uploadfile.php' => 1,
'template.phtml' => 1,
'jhvuserbundle.php' => 1,
'jhveasyinheritancemappingbundle.php' => 1,
'parseryml.php' => 1,
'parserjson.php' => 1,
'parserexcel.php' => 1,
'parsefileinterface.php' => 1,
'jhvpaymentcorebundle.php' => 1,
'jhvpaymentplugincobrebembundle.php' => 1,
'jhvpaymentservicebundle.php' => 1,
'jhvseobundle.php' => 1,
'readme-old' => 1,
'manager.sql' => 1,
'settingsindbbundle.php' => 1,
'bootstrap-phar.php' => 1,
'atys.png' => 1,
'jumalepagemetabundle.php' => 1,
'marduke182twigbundle.php' => 1,
'marcwserversideanalyticsbundle.php' => 1,
'jumaleattachmentbundle.php' => 1,
'countries.aggregate.php' => 1,
'cccn.php' => 1,
'marcwwurstbundle.php' => 1,
'marcvsqldumpbundle.php' => 1,
'lerconfig.php' => 1,
'inutilizar.php' => 1,
'imprimircce.php' => 1,
'openidconnectclient.php' => 1,
'opaqueencoder.php' => 1,
'danfe.php' => 1,
'cancelar.php' => 1,
'nfefacade.php' => 1,
'ping.php' => 1,
'dmrbundle.php' => 1,
'marcoshoyaboletophpbundle.php' => 1,
'sphinxbundle.php' => 1,
'class.smushit.php' => 1,
'client_example.php' => 1,
'mlbdagbundle.php' => 1,
'kurzor_config.php.sample' => 1,
'opaque.py' => 1,
'jsonbehavior.php' => 1,
'latestblogs.php' => 1,
'simpleresize.php' => 1,
'tubular.php' => 1,
'tubularasset.php' => 1,
'mabaoauthcommercecommonbundle.php' => 1,
'wake.php' => 1,
'animate.php' => 1,
'702.gif' => 1,
'review.php' => 1,
'latestblogs.ss' => 1,
'buzzbundle.php' => 1,
'blogeventdates.php' => 1,
'jumaleadminbundle.php' => 1,
'blogarchivemenuwidget.ss' => 1,
'buzzprofilerbundle.php' => 1,
'blogarchivemenuwidget.php' => 1,
'my_opml_file.xml' => 1,
'simpleitclaireexercisebundle.php' => 1,
'gearman.php' => 1,
'embedded.php' => 1,
'jdformbundle.php' => 1,
'butterweedsf1embedderbundle.php' => 1,
'fastrelibravatarbundle.php' => 1,
'testvectors' => 1,
'attributebehavior.php' => 1,
'dbad.license' => 1,
'__functions.php' => 1,
'payments.php' => 1,
'xeditableasset.php' => 1,
'chartpluginasset.php' => 1,
'xeditableaction.php' => 1,
'xeditable.php' => 1,
'test_dns_strings.php' => 1,
'wysihtml5asset.php' => 1,
'typeaheadnewasset.php' => 1,
'combodateasset.php' => 1,
'yii2_readme' => 1,
'yii2_license' => 1,
'menu.sql' => 1,
'all_tests.html' => 1,
'nestedsortableaction.php' => 1,
'tks.php' => 1,
'sample_config.php' => 1,
'jsonfcts.php' => 1,
'bd_field.php' => 1,
'auto-bd-class.php' => 1,
'540.php' => 1,
'yay_pretty.php' => 1,
'yay_parse.php' => 1,
'yay_compile.php' => 1,
'alltests.js' => 1,
'xeditablechecklist.php' => 1,
'wp_serve_file.php' => 1,
'configglobal.php' => 1,
'ð¡allablebehavior.php' => 1,
'captchainterface.php' => 1,
'vkbase.php' => 1,
'mjstwigapplyfilterbundle.php' => 1,
'workspacebehaviorpeer.php' => 1,
'workspacebehaviorclass.php' => 1,
'workspacebehavior.php' => 1,
'ramblerwebdriver.php' => 1,
'vkwebdriver.php' => 1,
'webdriverbase.php' => 1,
'gitlog' => 1,
'xeditablecolumn.php' => 1,
'frontcontroler.php' => 1,
'pch' => 1,
'xeditablewysihtml5.php' => 1,
'xeditabletextarea.php' => 1,
'xeditabletext.php' => 1,
'xeditableselect.php' => 1,
'xeditabledatetime.php' => 1,
'xeditabledate.php' => 1,
'doctrinedumpfixturesbundle.php' => 1,
'xeditableconfig.php' => 1,
'xeditablecombodate.php' => 1,
'magic_forms.install' => 1,
'logcounter' => 1,
'origami.sql' => 1,
'nodenotfoundexception.php' => 1,
'class.messages.php' => 1,
'envato_marketplaces.php' => 1,
'melifarobookingbundle.php' => 1,
'tordf-0057-in.jsonld' => 1,
'console_table.php' => 1,
'stringbuilder.php' => 1,
'tordf-0057-out.nq' => 1,
'quickaccesstrait.php' => 1,
'queryableexception.php' => 1,
'queryable.php' => 1,
'invalidexpressionexception.php' => 1,
'tordf-0056-in.jsonld' => 1,
'badtypeexception.php' => 1,
'tordf-0058-in.jsonld' => 1,
'tordf-0058-out.nq' => 1,
'tordf-0059-in.jsonld' => 1,
'rawexample.php' => 1,
'resamplr.php' => 1,
'spell_it.gemspec' => 1,
'recordlogger.php' => 1,
'serializeconverter.php' => 1,
'relatedconverter.php' => 1,
'tordf-0056-out.nq' => 1,
'tordf-0055-out.nq' => 1,
'tordf-0059-out.nq' => 1,
'sample.ini' => 1,
'meedivideobundle.php' => 1,
'lesspls.php' => 1,
'lesspls' => 1,
'emojiformat.php' => 1,
'online_check.php' => 1,
'tordf-0052-out.nq' => 1,
'tordf-0053-in.jsonld' => 1,
'tordf-0053-out.nq' => 1,
'cleancache.php' => 1,
'mlpostmasterbundle.php' => 1,
'yazquery.php' => 1,
'config.testing.php' => 1,
'parserini.php' => 1,
'parsequery.php' => 1,
'tordf-0054-in.jsonld' => 1,
'tordf-0054-out.nq' => 1,
'parserserviceprovider.php' => 1,
'marcxml.php' => 1,
'tordf-0055-in.jsonld' => 1,
'skoap-build.sublime-project' => 1,
'travs-config.ini' => 1,
'queueing-example.php' => 1,
'example-worker.php' => 1,
'numeralconverter.php' => 1,
'enumtrait.php' => 1,
'class.javascriptpacker.php4' => 1,
'tordf-0069-in.jsonld' => 1,
'tordf-0067-in.jsonld' => 1,
'mcwebbnormalizeddatabundle.php' => 1,
'phiremock.phar' => 1,
'example.yaml' => 1,
'regression.phar' => 1,
'tordf-0067-out.nq' => 1,
'money.phar' => 1,
'linear-algebra.phar' => 1,
'tordf-0068-in.jsonld' => 1,
'tordf-0068-out.nq' => 1,
'debug.inc.php' => 1,
'relatedsearchbehavior.php' => 1,
'glyphicons.png' => 1,
'libphonenumber.php' => 1,
'tordf-0069-out.nq' => 1,
'tordf-0070-in.jsonld' => 1,
'tordf-0070-out.nq' => 1,
'tordf-0071-in.jsonld' => 1,
'tordf-0071-out.nq' => 1,
'tordf-0072-in.jsonld' => 1,
'tordf-0072-out.nq' => 1,
'tordf-0073-in.jsonld' => 1,
'keenactivedataprovider.php' => 1,
'symfonypersiajalalidatebundle.php' => 1,
'enumconverter.php' => 1,
'tordf-0062-in.jsonld' => 1,
'tordf-0060-in.jsonld' => 1,
'dateconverter.php' => 1,
'clientbehavior.php' => 1,
'tordf-0060-out.nq' => 1,
'checkreload.php' => 1,
'appcache.php' => 1,
'tordf-0061-in.jsonld' => 1,
'tordf-0061-out.nq' => 1,
'autonumbervalidator.php' => 1,
'autonumber.php' => 1,
'tordf-0062-out.nq' => 1,
'tordf-0066-out.nq' => 1,
'tordf-0063-in.jsonld' => 1,
'relationuniquevalidator.php' => 1,
'tordf-0063-out.nq' => 1,
'tordf-0064-in.jsonld' => 1,
'queryscopebehavior.php' => 1,
'tordf-0064-out.nq' => 1,
'verifycontroller.php' => 1,
'tordf-0065-in.jsonld' => 1,
'entercode.php' => 1,
'tordf-0065-out.nq' => 1,
'tordf-0066-in.jsonld' => 1,
'tordf-0052-in.jsonld' => 1,
'example-file.php' => 1,
'tordf-0074-in.jsonld' => 1,
'tordf-0036-in.jsonld' => 1,
'mespronos.info.yml' => 1,
'mespronos_website.profile' => 1,
'mespronos_website.install' => 1,
'mespronos_website.info.yml' => 1,
'mespronos_front.theme' => 1,
'mespronos_front.libraries.yml' => 1,
'mespronos_front.info.yml' => 1,
'tordf-0035-in.jsonld' => 1,
'tordf-0035-out.nq' => 1,
'langselector.php' => 1,
'md.php' => 1,
'mespronos.libraries.yml' => 1,
'tordf-0036-out.nq' => 1,
'emojioneasset.php' => 1,
'manymanybehavior.php' => 1,
'aaencoder.php' => 1,
'aadecoder.php' => 1,
'curlhelper.php' => 1,
'tordf-0041-in.jsonld' => 1,
'tordf-0041-out.nq' => 1,
'smarttest.php' => 1,
'merobasebundle.php' => 1,
'mespronos.install' => 1,
'mespronos.links.action.yml' => 1,
'tordf-0042-out.nq' => 1,
'metalvarezcommentsbundle.php' => 1,
'tordf-0029-in.jsonld' => 1,
'tordf-0029-out.nq' => 1,
'tordf-0030-in.jsonld' => 1,
'tordf-0030-out.nq' => 1,
'metator' => 1,
'rdap.php' => 1,
'retro.php' => 1,
'metalvarezvotingbundle.php' => 1,
'tordf-0031-in.jsonld' => 1,
'tordf-0031-out.nq' => 1,
'tordf-0032-in.jsonld' => 1,
'tordf-0034-out.nq' => 1,
'metaclassauthenticationguardbundle.php' => 1,
'mespronos.services.yml' => 1,
'mespronos.routing.yml' => 1,
'tordf-0032-out.nq' => 1,
'tordf-0033-in.jsonld' => 1,
'mespronos.permissions.yml' => 1,
'mespronos.module' => 1,
'tordf-0033-out.nq' => 1,
'tordf-0034-in.jsonld' => 1,
'mespronos.links.task.yml' => 1,
'mespronos.links.menu.yml' => 1,
'tordf-0042-in.jsonld' => 1,
'testsimpletemplate.php' => 1,
'example-inline.php' => 1,
'tordf-0047-out.nq' => 1,
'cli-composer-config.json' => 1,
'sellsyapibundle.php' => 1,
'multipleinheritancebundle.php' => 1,
'mefdcontaofoundationbundle.php' => 1,
'tordf-0044-out.nq' => 1,
'tordf-0045-in.jsonld' => 1,
'tordf-0045-out.nq' => 1,
'tordf-0046-in.jsonld' => 1,
'tordf-0046-out.nq' => 1,
'tordf-0047-in.jsonld' => 1,
'tordf-0048-in.jsonld' => 1,
'access.xml' => 1,
'tordf-0048-out.nq' => 1,
'tordf-0049-in.jsonld' => 1,
'tordf-0049-out.nq' => 1,
'tordf-0050-in.jsonld' => 1,
'tordf-0050-out.nq' => 1,
'tordf-0051-in.jsonld' => 1,
'tordf-0051-out.nq' => 1,
'mefdcommonbundle.php' => 1,
'testshipment.php' => 1,
'testparcelstatus.php' => 1,
'test_services.dist.json' => 1,
'lang.xml' => 1,
'testheadlinks.php' => 1,
'currentinstallation.png' => 1,
'phartest.php' => 1,
'envmap.php' => 1,
'merkdoughbundle.php' => 1,
'phpunit.jenkins.xml' => 1,
'merchiumclient.php' => 1,
'insomniamaxmindgeoipbundle.php' => 1,
'tordf-0043-in.jsonld' => 1,
'ctocommunication.php' => 1,
'move.psd' => 1,
'frontendcheckboxmenu.png' => 1,
'clipboard.psd' => 1,
'parsers.xml' => 1,
'puphpet.json' => 1,
'memeoirspaymillbundle.php' => 1,
'tordf-0043-out.nq' => 1,
'tordf-0044-in.jsonld' => 1,
'dbase.php' => 1,
'memaw-phpcs.php.dist' => 1,
'melnikovedpopplerbundle.php' => 1,
'mekrasoberegbundle.php' => 1,
'xmlserver.php' => 1,
'urlhandler.php' => 1,
'router.xml' => 1,
'tordf-0073-out.nq' => 1,
'tordf-0074-out.nq' => 1,
'mysql2pdoexception.php' => 1,
'tordf-0092-out.nq' => 1,
'cartasi.php' => 1,
'tordf-0091-out.nq' => 1,
'laravel-installer' => 1,
'darkwoodgeneratorbundle.php' => 1,
'torfeed.php' => 1,
'tpbtorfeedhandler.php' => 1,
'standardtorfeedhandler.php' => 1,
'matuckmenubundle.php' => 1,
'kickasstorfeedhandler.php' => 1,
'tordf-0092-in.jsonld' => 1,
'matuckaliasbundle.php' => 1,
'appwebuser.php' => 1,
'mattwellss_magentocomposerautoloader.xml' => 1,
'mahangosignupbundle.php' => 1,
'tordf-0093-in.jsonld' => 1,
'tordf-0093-out.nq' => 1,
'tordf-0094-in.jsonld' => 1,
'tordf-0094-out.nq' => 1,
'mattvickharvestappbundle.php' => 1,
'tordf-0095-in.jsonld' => 1,
'mattschesvulnerabilitiesbundle.php' => 1,
'mattschesversioneyebundle.php' => 1,
'ajaxreturnobject.php' => 1,
'tordf-0091-in.jsonld' => 1,
'servicedefinitionvalidatorinterface.php' => 1,
'tordf-0088-out.nq' => 1,
'parsedownconverter.php' => 1,
'sculpineditorbundle.php' => 1,
'phpcs.conf.dist' => 1,
'.pairs' => 1,
'findbundle.php' => 1,
'twitterwidget.php' => 1,
'tordf-0087-out.nq' => 1,
'tordf-0088-in.jsonld' => 1,
'twittertweet.php' => 1,
'twitterreader.php' => 1,
'updatewidget.php' => 1,
'tordf-0090-out.nq' => 1,
'telegrambot.php' => 1,
'photosize.php' => 1,
'tordf-0089-in.jsonld' => 1,
'rpslswidget.php' => 1,
'rpslsasset.php' => 1,
'workinprogresswidget.php' => 1,
'tordf-0089-out.nq' => 1,
'passwordhelper.php' => 1,
'namedactiverecord.php' => 1,
'emailvalidator.php' => 1,
'tordf-0090-in.jsonld' => 1,
'tordf-0095-out.nq' => 1,
'servicedefinitionvalidatorfactoryinterface.php' => 1,
'projects.php' => 1,
'tordf-0103-in.jsonld' => 1,
'servicecontainerinterface.php' => 1,
'tordf-0102-in.jsonld' => 1,
'refactoring' => 1,
'nobackdoctrineormvalueobjectbundle.php' => 1,
'matthiaslazyservicesbundle.php' => 1,
'matthiasconsolecommandgeneratorbundle.php' => 1,
'.cauditor.yml' => 1,
'ogone.php' => 1,
'bayerjsonapibundle.php' => 1,
'tordf-0102-out.nq' => 1,
'test_v11.php' => 1,
'argumentvalidatorinterface.php' => 1,
'tordf-0103-out.nq' => 1,
'mysql_test_schema.sql' => 1,
'mysql_test_results' => 1,
'mysql_test_after.php' => 1,
'mysql_test.php' => 1,
'mysql_functions.php' => 1,
'tordf-0104-in.jsonld' => 1,
'mysql_example.php' => 1,
'mysql_definitions.php' => 1,
'tordf-0104-out.nq' => 1,
'argumentvalidator.php' => 1,
'argumentsvalidator.php' => 1,
'tordf-0096-in.jsonld' => 1,
'tordf-0098-out.nq' => 1,
'tordf-0096-out.nq' => 1,
'tordf-0097-in.jsonld' => 1,
'servicedefinitionvalidatorfactory.php' => 1,
'tordf-0097-out.nq' => 1,
'servicedefinitionvalidator.php' => 1,
'resultingclassresolverinterface.php' => 1,
'resultingclassresolver.php' => 1,
'methodcallsvalidatorinterface.php' => 1,
'tordf-0098-in.jsonld' => 1,
'methodcallsvalidator.php' => 1,
'tordf-0099-in.jsonld' => 1,
'argumentsvalidatorinterface.php' => 1,
'definitionargumentsvalidatorinterface.php' => 1,
'tordf-0099-out.nq' => 1,
'tordf-0100-in.jsonld' => 1,
'tordf-0100-out.nq' => 1,
'tordf-0101-in.jsonld' => 1,
'tordf-0101-out.nq' => 1,
'definitionargumentsvalidator.php' => 1,
'constructorresolverinterface.php' => 1,
'constructorresolver.php' => 1,
'batchservicedefinitionvalidatorinterface.php' => 1,
'batchservicedefinitionvalidator.php' => 1,
'tordf-0087-in.jsonld' => 1,
'sculpinprojectsbundle.php' => 1,
'tordf-0075-in.jsonld' => 1,
'mazuploadclass.php' => 1,
'varnishpurger.php' => 1,
'varnishpurgeprovider.php' => 1,
'livephpmonitor.php' => 1,
'livephp.js' => 1,
'livephpbundle.php' => 1,
'phpinteractorbundle.php' => 1,
'mboptimizationbundle.php' => 1,
'mbdashboardbundle.php' => 1,
'menumodules.php' => 1,
'hartija.html' => 1,
'processingbundle.php' => 1,
'tordf-0080-out.nq' => 1,
'mazarinisluggerbundle.php' => 1,
'redisenablebundle.php' => 1,
'responseevent.php' => 1,
'notificationerrorevent.php' => 1,
'mayeconotificationsbundle.php' => 1,
'mayecoinvoicesbundle.php' => 1,
'mayecogooglebundle.php' => 1,
'tordf-0081-out.nq' => 1,
'easyannotationbundle.php' => 1,
'tinymcewidget.php' => 1,
'tordf-0081-in.jsonld' => 1,
'tordf-0080-in.jsonld' => 1,
'owlcarouselwidget.php' => 1,
'dataparserapplication.php' => 1,
'tordf-0075-out.nq' => 1,
'tordf-0076-in.jsonld' => 1,
'tordf-0076-out.nq' => 1,
'tordf-0077-in.jsonld' => 1,
'tordf-0077-out.nq' => 1,
'tordf-0078-in.jsonld' => 1,
'tordf-0078-out.nq' => 1,
'mch0licopenflashchartbundle.php' => 1,
'wp-recaptcha-integration.php' => 1,
'mkzip.sh' => 1,
'softwaredeskbiketraderapibundle.php' => 1,
'ffixture.php' => 1,
'contact-process.php' => 1,
'flashmessagehandlerbundle.php' => 1,
'tordf-0079-in.jsonld' => 1,
'eventhubbundle.php' => 1,
'cleanvendorscontroller.php' => 1,
'cleanassetscontroller.php' => 1,
'zf2base.sql' => 1,
'zf2base-workflow.jpg' => 1,
'makutaclientbundle.php' => 1,
'ffixtureseed.php' => 1,
'tordf-0079-out.nq' => 1,
'tinymcecustomasset.php' => 1,
'owlcarouselasset.php' => 1,
'redirectgenerator.php' => 1,
'tordf-0085-out.nq' => 1,
'tordf-0083-out.nq' => 1,
'testit' => 1,
'tordf-0084-in.jsonld' => 1,
'build_archive.sh' => 1,
'tordf-0084-out.nq' => 1,
'harvester.php' => 1,
'tordf-0085-in.jsonld' => 1,
'githubapibundle.php' => 1,
'navbar.tpl' => 1,
'materialize.yml' => 1,
'blog_post.tpl' => 1,
'imagefilevalidator.php' => 1,
'blog.tpl' => 1,
'keyword-generator.php' => 1,
'common-words-ru_ru.php' => 1,
'tordf-0086-in.jsonld' => 1,
'twigpress.php' => 1,
'tordf-0086-out.nq' => 1,
'phpunit.dist' => 1,
'nginx-conf-parser' => 1,
'mawiajaxautocompletebundle.php' => 1,
'console.config.php' => 1,
'sculpinredirectbundle.php' => 1,
'testit.config.yml' => 1,
'imageprocessor.php' => 1,
'minifymanager.php' => 1,
'angularmainasset.php' => 1,
'minifyhelper.php' => 1,
'searchtrait.php' => 1,
'processfilterevent.php' => 1,
'additionstrait.php' => 1,
'fullpagejswidget.php' => 1,
'fullpagejsasset.php' => 1,
'tordf-0082-in.jsonld' => 1,
'appbootstrap.php' => 1,
'angularsanitizeasset.php' => 1,
'tordf-0082-out.nq' => 1,
'angulari18nasset.php' => 1,
'imageprocessorcontroller.php' => 1,
'angularuirouterasset.php' => 1,
'gc-example.php' => 1,
'maxmodegeneratorbundle.php' => 1,
'.travis-test.sh' => 1,
'.travis-install-prereqs.sh' => 1,
'.coveralls-phpunit.xml.dist' => 1,
'maxmind-db' => 1,
'readme.dev' => 1,
'jsviewsasset.php' => 1,
'tordf-0083-in.jsonld' => 1,
'imagevalidator.php' => 1,
'po.png' => 1,
'my_form_validation.php' => 1,
'demo-general.php' => 1,
'whhgasset.php' => 1,
'openiconicasset.php' => 1,
'multisitelanguageswitcher.php' => 1,
'sociconasset.php' => 1,
'phpct.yml' => 1,
'typiconsasset.php' => 1,
'mylogphp.class.php' => 1,
'uniasset.php' => 1,
'crudbundle.php' => 1,
'codekit-config.json' => 1,
'lanewechat.php' => 1,
'ipinfo.php' => 1,
'tweetercorebundle.php' => 1,
'agentdetect.php' => 1,
'livsisdtoolsbundle.php' => 1,
'ipinfoasset.php' => 1,
'dosuserbundle.php' => 1,
'html5input.php' => 1,
'html5inputasset.php' => 1,
'pluginassetbundle.php' => 1,
'translationtrait.php' => 1,
'dossmsbundle.php' => 1,
'dossettingsbundle.php' => 1,
'octiconsasset.php' => 1,
'cubebundle.php' => 1,
'syliusmediabundle.php' => 1,
'cache-clear' => 1,
'db-login' => 1,
'db-credentials' => 1,
'db-backup' => 1,
'coverage-report' => 1,
'coverage-ensure' => 1,
'composer-reinstall' => 1,
'composer-install' => 1,
'composer-binaries' => 1,
'codesniffer-run' => 1,
'gridresizestoreasset.php' => 1,
'baremetal-bootstrap' => 1,
'efoundationbundle.php' => 1,
'radiocolumn.php' => 1,
'radiocolumnasset.php' => 1,
'elusiveasset.php' => 1,
'smirikquizbundle.php' => 1,
'smirikexambundle.php' => 1,
'smirikcoursebundle.php' => 1,
'smirikcontentbundle.php' => 1,
'smirikadminbundle.php' => 1,
'lms2migrationbundle.php' => 1,
'flagiconasset.php' => 1,
'html.tpl.php' => 1,
'dosresourcebundle.php' => 1,
'dosmailerbundle.php' => 1,
'gridresizecolumnsasset.php' => 1,
'depdropasset.php' => 1,
'twitterplugin.php' => 1,
'vkplugin.php' => 1,
'sortableinput.php' => 1,
'sortableinputasset.php' => 1,
'stickytabsasset.php' => 1,
'tabsx.php' => 1,
'tabsxasset.php' => 1,
'affixasset.php' => 1,
'colorinputasset.php' => 1,
'depdropaction.php' => 1,
'depdropextasset.php' => 1,
'githubxplugin.php' => 1,
'starratingthemeasset.php' => 1,
'blazon.yml' => 1,
'render.inc.php' => 1,
'c2g_listvhosts.php' => 1,
'c2g_listbackups.php' => 1,
'c2g_functions.php' => 1,
'dataexchange.php' => 1,
'pharmaintelligencegstandaardbundle.php' => 1,
'foundationassets.php' => 1,
'datetimepickerassets.php' => 1,
'googleplugin.php' => 1,
'githubplugin.php' => 1,
'sdfaefeafe' => 1,
'init_aspect.php' => 1,
'biz_sub_apis.php' => 1,
'biz_apis.php' => 1,
'fastest' => 1,
'liuggiostatsdclientbundle.php' => 1,
'labelinplace.php' => 1,
'labelinplaceasset.php' => 1,
'navxasset.php' => 1,
'jdexception.php' => 1,
'jdclient.php' => 1,
'sweetcaptchabundle.php' => 1,
'stormapi.class.php' => 1,
'facebookplugin.php' => 1,
'lioshiwondercachebundle.php' => 1,
'popoverx.php' => 1,
'prophet' => 1,
'make_test_environment.sh' => 1,
'magicdoc' => 1,
'advancedconnectorbundle.php' => 1,
'transmogrifier.sublime-project' => 1,
'screenshot.json.dist' => 1,
'objectstorage.conf.dist' => 1,
'filelist.conf.dist' => 1,
'popoverxasset.php' => 1,
'db-sample-data' => 1,
'docs-generate' => 1,
'backstrech.php' => 1,
'index.tp.php' => 1,
'losodiannotationsbundle.php' => 1,
'how to install' => 1,
'faq and docs' => 1,
'dbtable.php' => 1,
'ult.php' => 1,
'initinterface.php' => 1,
'http_cache.php' => 1,
'muzijk.php' => 1,
'libslize.php.tp' => 1,
'libslize' => 1,
'libslize.php' => 1,
'superbanner.php' => 1,
'hunter.js' => 1,
'spaces.css' => 1,
'bootstrapvalidator.min.js' => 1,
'detailviewasset.php' => 1,
'dialogbootstrapasset.php' => 1,
'dropdownxasset.php' => 1,
'dynagrid.php' => 1,
'dynagridasset.php' => 1,
'dynagriddetail.php' => 1,
'bootstrapvalidator.min.css' => 1,
'contextmenu.php' => 1,
'ezpublishcoreextrabundle.php' => 1,
'phpunit.php52.xml.dist' => 1,
'demo1.html' => 1,
'antdeb.xml' => 1,
'ant-deb.jar' => 1,
'antcontrib.xml' => 1,
'tabularform.php' => 1,
'tabularformasset.php' => 1,
'postal_resolver.js' => 1,
'cleanup' => 1,
'spefilesizeextensionbundle.php' => 1,
'flot' => 1,
'checkboxx.php' => 1,
'yunxin.php' => 1,
'krajeeflatbluethemeasset.php' => 1,
'yuntongxun.php' => 1,
'yunpian.php' => 1,
'webchinese.php' => 1,
'sxt.php' => 1,
'smsbao.php' => 1,
'chuanglan.php' => 1,
'checkboxxasset.php' => 1,
'tetranslationbundle.php' => 1,
'tesearchifybundle.php' => 1,
'tedoctrinebehaviorsbundle.php' => 1,
'lolautruchepaylinebundle.php' => 1,
'callbackassets.php' => 1,
'dynagriddetailasset.php' => 1,
'gridperfectscrollbarasset.php' => 1,
'gridexportasset.php' => 1,
'checkboxcolumnasset.php' => 1,
'rename-empty' => 1,
'owner-set' => 1,
'columntrait.php' => 1,
'nfsexports-setsudoaccess' => 1,
'editablecolumnaction.php' => 1,
'expandrowcolumn.php' => 1,
'migrations' => 1,
'expandrowcolumnasset.php' => 1,
'formulacolumn.php' => 1,
'metrics-generate' => 1,
'booleancolumn.php' => 1,
'logs-clear' => 1,
'git-remotechanges' => 1,
'git-localchanges' => 1,
'git-hook-workingcopychange' => 1,
'git-currentbranch' => 1,
'folder-delete-items-older-than-days' => 1,
'email' => 1,
'docs-post' => 1,
'gridfloatheadasset.php' => 1,
'gridgroupasset.php' => 1,
'tests-run' => 1,
'exportmenuasset.php' => 1,
'dynagridstore.php' => 1,
'constantsarray.php' => 1,
'migration-doctrine-cli.php' => 1,
'migration-create.php' => 1,
'migrate-to-version.php' => 1,
'migrate-to-latest.php' => 1,
'migrate-init.php' => 1,
'editableasset.php' => 1,
'migrate-init-config.php' => 1,
'gls online api.pdf' => 1,
'dpd-api.pdf' => 1,
'api-test.php' => 1,
'editablepjaxasset.php' => 1,
'vagrant-exec' => 1,
'exportcolumnasset.php' => 1,
'exportmenu.php' => 1,
'phpunix.xml.dist' => 1,
'locastictcompaywaypayumbundle.php' => 1,
'github-changelog' => 1,
'loamoksubformsmadeeasybundle.php' => 1,
'loamokjquerysliderbundle.php' => 1,
'phpdoc.dist.xml.template' => 1,
'composer.json.template' => 1,
'readme.md.template' => 1,
'.travis.yml.template' => 1,
'backstrechassets.php' => 1,
'example_url.php' => 1,
'updaterepositorytask.php' => 1,
'css_browser_selector.min.js' => 1,
'kyticketpost.php' => 1,
'kyticketpriority.php' => 1,
'kyticketstatus.php' => 1,
'arraytoxml.php' => 1,
'kytickettimetrack.php' => 1,
'kytickettype.php' => 1,
'clsms.php' => 1,
'kytroubleshooterattachment.php' => 1,
'kytroubleshootercategory.php' => 1,
'bitcoin.php' => 1,
'css_browser_selector.js' => 1,
'kyticketcustomfieldgroup.php' => 1,
'css_browser_selector.class.php' => 1,
'rawhttpmethod.php' => 1,
'vim.tar.gz' => 1,
'lhpalaciobackupmanagerbundle.php' => 1,
'kytroubleshootercomment.php' => 1,
'kytroubleshooterstep.php' => 1,
'lexxpavlovpagebundle.php' => 1,
'lexxpavlovsettingsbundle.php' => 1,
'lexikworkflowbundle.php' => 1,
'kyuser.php' => 1,
'kyticketnote.php' => 1,
'cookiehelper.php' => 1,
'lexikpayboxbundle.php' => 1,
'librinfobaseentitiesbundle.php' => 1,
'notormpanel.php' => 1,
'librinfovarietiesbundle.php' => 1,
'librinfouserbundle.php' => 1,
'librinfouibundle.php' => 1,
'librinfosecuritybundle.php' => 1,
'librinfodoctrinepgsqlbundle.php' => 1,
'librinfodoctrinebundle.php' => 1,
'librinfodecoratorbundle.php' => 1,
'librinfocorebundle.php' => 1,
'librinfocrmbundle.php' => 1,
'readme-from-scratch' => 1,
'simplearraytoxml.php' => 1,
'links' => 1,
'dev.sh' => 1,
'dev-cleanstart.sh' => 1,
'dev-check.sh' => 1,
'kyresultset.php' => 1,
'kystaff.php' => 1,
'kystaffgroup.php' => 1,
'gravitonvcapbundle.php' => 1,
'qy.php' => 1,
'kyticket.php' => 1,
'kyticketattachment.php' => 1,
'kyusergroup.php' => 1,
'lexikmonologbrowserbundle.php' => 1,
'weixinapi' => 1,
'post-test.bat' => 1,
'kayueessencebundle.php' => 1,
'kayuewordpressbundle.php' => 1,
'db.bat' => 1,
'wordpressevents.php' => 1,
'favicon' => 1,
'kwparserbundle.php' => 1,
'zenstruckcontentbundle.php' => 1,
'sws.php' => 1,
'zenstruckcontrollerutilbundle.php' => 1,
'serve.bat' => 1,
'config.integration.example.json' => 1,
'recreate_test_db.sh' => 1,
'coding_standard.xml' => 1,
'dployer' => 1,
'tisql.php' => 1,
'leozaentitiesbundle.php' => 1,
'entitymanagerexception.php' => 1,
'entitygeneratorexception.php' => 1,
'entitygenerator.php' => 1,
'leozaapiserverbundle.php' => 1,
'leozaapiclientbundle.php' => 1,
'demo-mysql.php' => 1,
'ruckusing.conf.php' => 1,
'yammer.php' => 1,
'lexikjwtauthenticationbundle.php' => 1,
'mongodbmanager.php' => 1,
'lexikframeworkacceleratorbundle.php' => 1,
'lexikformfilterbundle.php' => 1,
'lexikdatalayerbundle.php' => 1,
'lexikcurrencybundle.php' => 1,
'lexikcolissimobundle.php' => 1,
'eyandexmetrikawidget.php' => 1,
'tuner' => 1,
'chords.yml' => 1,
'fminorrepertoire.php' => 1,
'repertoireinterface.php' => 1,
'kyuserorganization.php' => 1,
'jstreeinput.php' => 1,
'rbaccached.php' => 1,
'angellist.php' => 1,
'deviantart.php' => 1,
'flattr.php' => 1,
'formstack.php' => 1,
'mixcloud.php' => 1,
'nestedsetsquerybehavior.php' => 1,
'msn.php' => 1,
'snapr.php' => 1,
'socialmedia_oauth_connect.php' => 1,
'stocktwits.php' => 1,
'panel.latte' => 1,
'php-wechat.wiki' => 1,
'avatar.php' => 1,
'kycustomfield.php' => 1,
'kycommentbase.php' => 1,
'searchfactoryinterface.php' => 1,
'kycommentablebase.php' => 1,
'liipsearchbundle.php' => 1,
'pidfile.php' => 1,
'kyconfig.php' => 1,
'lockexception.php' => 1,
'liiponeallbundle.php' => 1,
'liipmultiplexbundle.php' => 1,
'liipmonitorbundle.php' => 1,
'imagineevents.php' => 1,
'exceptional.php' => 1,
'liiphyphenatorbundle.php' => 1,
'hyphenatorfactory.php' => 1,
'kycustomfielddate.php' => 1,
'kycustomfielddefinition.php' => 1,
'liiphellobundle.php' => 1,
'paratest' => 1,
'liipfoxycartbundle.php' => 1,
'cartvalidation.php' => 1,
'kycustomfieldfile.php' => 1,
'liipformtranslationchoicebundle.php' => 1,
'liipsoaprecorderbundle.php' => 1,
'example-vejnavn.php' => 1,
'drupaltranslationmodule.module' => 1,
'tojsonldinterface.php' => 1,
'limitlandldapbundle.php' => 1,
'switchinputasset.php' => 1,
'ormdfixerbundle.php' => 1,
'bootstrapmedialightboxasset.php' => 1,
'instantconfigurationplugin.php' => 1,
'lilwebextrabundle.php' => 1,
'lilwebcoffeescriptbundle.php' => 1,
'lilwebldapbundle.php' => 1,
'lilwebjobbundle.php' => 1,
'lilwebevolutionbundle.php' => 1,
'liipviebundle.php' => 1,
'activetheme.php' => 1,
'fromjsonldinterface.php' => 1,
'typeaheadbasicasset.php' => 1,
'typeaheadhbasset.php' => 1,
'karudevproductbundle.php' => 1,
'liipurlautoconverterbundle.php' => 1,
'sinlinebundle.php' => 1,
'envato-plugin-update.php' => 1,
'liiptranslationbundle.php' => 1,
'example.build.xml' => 1,
'liipthemebundle.php' => 1,
'dyndns.php' => 1,
'vm.drush.inc' => 1,
'drupaltranslationmodule.info' => 1,
'.gitattributes.dist' => 1,
'lcmbrightcovebundle.php' => 1,
'kynewscomment.php' => 1,
'liipcachecontrolbundle.php' => 1,
'readme.developers' => 1,
'liilomangopaybundle.php' => 1,
'kynewsitem.php' => 1,
'kynewssubscriber.php' => 1,
'w2ui.jquery.json' => 1,
'kyobjectbase.php' => 1,
'brainstorm' => 1,
'kyobjectwithcustomfieldsbase.php' => 1,
'lighthartgridbundle.php' => 1,
'migrate_fos' => 1,
'schedules' => 1,
'cocarbundle.php' => 1,
'kyrestclient.php' => 1,
'kyrestclientinterface.php' => 1,
'example-module.php' => 1,
'lifotypeaheadbundle.php' => 1,
'lidaatwigbundle.php' => 1,
'lidaatransbundle.php' => 1,
'lockformasset.php' => 1,
'lockbsformasset.php' => 1,
'layermobileasset.php' => 1,
'kynewscategory.php' => 1,
'liipcodebundle.php' => 1,
'drupalregistrymodule.module' => 1,
'kyhelpers.php' => 1,
'kycustomfieldgroupbase.php' => 1,
'drupalregistrymodule.info' => 1,
'drupaleventmanagermodule.module' => 1,
'drupaleventmanagermodule.info' => 1,
'kycustomfieldlinkedselect.php' => 1,
'kycustomfieldmultiselect.php' => 1,
'drupalcrudadminmodule.module' => 1,
'kycustomfieldoption.php' => 1,
'kycustomfieldselect.php' => 1,
'kydepartment.php' => 1,
'kyincludes.php' => 1,
'liipcontainerwrapperbundle.php' => 1,
'kyknowledgebasearticle.php' => 1,
'kyknowledgebaseattachment.php' => 1,
'kyknowledgebasecategory.php' => 1,
'kyknowledgebasecomment.php' => 1,
'drupalcrudadminmodule.install' => 1,
'drupalcrudadminmodule.info' => 1,
'drupalcrudadminmodule.helper.inc' => 1,
'drupalcrudadminmodule.admin.inc' => 1,
'drupalconnectormodule.module' => 1,
'drupalconnectormodule.info' => 1,
'liipdoctrinecachebundle.php' => 1,
'installtask.php' => 1,
'debpkg.phing.xml' => 1,
'star.php' => 1,
'maciaddressbundle.php' => 1,
'maciorderbundle.php' => 1,
'macimediabundle.php' => 1,
'macimailerbundle.php' => 1,
'macilistbundle.php' => 1,
'macicorebundle.php' => 1,
'macicontactbundle.php' => 1,
'kairosgoogleanalyticsclientbundle.php' => 1,
'kairosgoogleanalyticsserversidebundle.php' => 1,
'maciblogbundle.php' => 1,
'maciadminbundle.php' => 1,
'swaggeruiasset.php' => 1,
'macitranslatorbundle.php' => 1,
'apiresponse.php' => 1,
'apimodel.php' => 1,
'apigenerator.php' => 1,
'sparkline.php' => 1,
'softdeletetrait.php' => 1,
'notificationsmodule.php' => 1,
'flot.php' => 1,
'boxtrait.php' => 1,
'.php-version' => 1,
'yiimailmessage.php' => 1,
'maciproductbundle.php' => 1,
'http_build_url.php' => 1,
'wrepidealbundle.php' => 1,
'stringplural.php' => 1,
'datetimerangepicker.php' => 1,
'socketserver.php' => 1,
'socketserverclient.php' => 1,
'multiloader.php' => 1,
'xmldeserializer.php' => 1,
'xmlserializable.php' => 1,
'xmlserializer.php' => 1,
'hicri.php' => 1,
'hilal.php' => 1,
'parse_netscape_bookmarks.php' => 1,
'kaguxsilexintegrationbundle.php' => 1,
'metadatabehavior.php' => 1,
'backendmodule.php' => 1,
'mrsectionwidgetasset.php' => 1,
'imagecropsection.php' => 1,
'us.stackdump' => 1,
'tmdbapi.php' => 1,
'www' => 1,
'simplequeuemessage.php' => 1,
'simplequeuecontroller.php' => 1,
'simplequeueaction.php' => 1,
'simplequeue.php' => 1,
'googleanalyticsbundle.php' => 1,
'yiimail.php' => 1,
'paragraph.php' => 1,
'fakeuploadedfile.php' => 1,
'm4griosepomexbundle.php' => 1,
'mandrillmailer.php' => 1,
'quicky.class.php' => 1,
'quicky.form.class.php' => 1,
'mrocarequestlogbundle.php' => 1,
'mczolkoherokuschedulerbundle.php' => 1,
'quicky_bbcode.class.php' => 1,
'rsentrylog.php' => 1,
'rsentrycomponent.php' => 1,
'alternativemail.php' => 1,
'foppdfbundle.php' => 1,
'quicky_compiler.class.php' => 1,
'localstorage.class.php' => 1,
'xppaut' => 1,
'mophugbearbundle.php' => 1,
'moparangodbbundle.php' => 1,
'datacollector.php' => 1,
'newscooptageswochewidgetspluginbundle.php' => 1,
'blitz.class.php' => 1,
'newscoopingestparsersuperdeskcontentapibundle.php' => 1,
'jskasset.php' => 1,
'jsk.php' => 1,
'terminatur.bootstrap.inc' => 1,
'wbxcommunesdefrancebundle.php' => 1,
'wbxfilebundle.php' => 1,
'measuretextresult.php' => 1,
'about.png' => 1,
'measuretextcounts.php' => 1,
'measuretext.php' => 1,
'linesbreaker.php' => 1,
'linesbreakpointresult.php' => 1,
'uaparserbundle.php' => 1,
'linesbreakpoint.php' => 1,
'linesbreakcharresult.php' => 1,
'linesbreakchar.php' => 1,
'translatethis' => 1,
'seo.png' => 1,
'character optimization for translation service.xlsx' => 1,
'redcodeflowbundle.php' => 1,
'kalista' => 1,
'mmwhoisbundle.php' => 1,
'dojobundle.php' => 1,
'googlesearchengineplugin.php' => 1,
'duckduckgosearchengineplugin.php' => 1,
'bingsearchengineplugin.php' => 1,
'zohoinvoiceapiclient.php' => 1,
'twitterapi.php' => 1,
'oauthhmacsha1.php' => 1,
'kairoszohoinvoiceconnectorbundle.php' => 1,
'redcodetransactionmanagerbundle.php' => 1,
'socketclient.php' => 1,
'networkexception.php' => 1,
'terminatur.code.inc' => 1,
'acumulusbundle.php' => 1,
'sf_dic.module' => 1,
'sf_dic.install' => 1,
'sf_dic.info' => 1,
'sf_dic.container.php' => 1,
'env.sample.json' => 1,
'env.json' => 1,
'dumpcontent.php' => 1,
'mdmtranslatorcheckerbundle.php' => 1,
'mapperinterface.php' => 1,
'broadwayrethinkdbbundle.php' => 1,
'zf1wrapperbundle.php' => 1,
'sf_dic.services.yml' => 1,
'requests' => 1,
'setup.cfg' => 1,
'gtm.php' => 1,
'newemailwatcherdump.php' => 1,
'newemailwatcherinterface.php' => 1,
'servercustom.php' => 1,
'sendinblueapibundle.php' => 1,
'mailxpertapibundle.php' => 1,
'cffie.png' => 1,
'dataresponse.php' => 1,
'sf_dic.path.inc' => 1,
'makingwavesezaddthisbundle.php' => 1,
'mongod.conf' => 1,
'autoloadwidget.php' => 1,
'eventstore.config.php' => 1,
'autoloader.ini' => 1,
'readme.md.old' => 1,
'phantastic' => 1,
'config.yaml.sample' => 1,
'rgba-server.php' => 1,
'rgba-cli' => 1,
'ajarloader.php' => 1,
'ajar.php' => 1,
'mediaasset.php' => 1,
'yak.png' => 1,
'makingwavesezstarratingbundle.php' => 1,
'\\com\\iesebre\\dam2\\max\\persons\\person.uml' => 1,
'\\com\\iesebre\\dam2\\max\\curriculum\\study.uml' => 1,
'diagrampersons.png' => 1,
'diagramcurriculum.png' => 1,
'icalendar.php' => 1,
'icalperson.php' => 1,
'icalevent.php' => 1,
'icalattendee.php' => 1,
'icalalarm.php' => 1,
'frontendbundle.php' => 1,
'mapperbuilder.php' => 1,
'psxbundle.php' => 1,
'test_form.php' => 1,
'abstractserverclient.php' => 1,
'madesstdoctrinegenerationbundle.php' => 1,
'db_init.php' => 1,
'cookie2' => 1,
'cookie' => 1,
'dropboxuploader.php' => 1,
'clientmessagedtos.proto' => 1,
'kachkaevdropboxbackupbundle.php' => 1,
'.bookignore' => 1,
'kachkaevphprbundle.php' => 1,
'install-elasticsearch.sh' => 1,
'madesstsecurityextrabundle.php' => 1,
'madesstapidebugbundle.php' => 1,
'contributor-readme' => 1,
'keylighter.php' => 1,
'staging.jpg' => 1,
'development.jpg' => 1,
'backendauthasset.php' => 1,
'textformatsbehavior.php' => 1,
'selectizetextinput.php' => 1,
'selectizedropdownlist.php' => 1,
'selectizebase.php' => 1,
'abstractserver.php' => 1,
'autocompletestyleasset.php' => 1,
'pagee.php' => 1,
'ssbuilderscrack' => 1,
'preview.gif' => 1,
'jarlssen_cmsfiles.xml' => 1,
'.arty.example.yml' => 1,
'math_captcha.php' => 1,
'magican' => 1,
'run_tests' => 1,
'imagicreativityjqueryknobbundle.php' => 1,
'magallanes.sublime-project' => 1,
'isolation.php' => 1,
'package.json.sample' => 1,
'gruntfile.js.sample' => 1,
'report.full' => 1,
'mgf.php' => 1,
'sandbox.html' => 1,
'mgf.bat' => 1,
'magento-finder.php' => 1,
'magento-finder.bat' => 1,
'synctranslitbehavior.php' => 1,
'synctranslit.php' => 1,
'font.php' => 1,
'phatic.yml.dist' => 1,
'magaritestbundle.php' => 1,
'maestrano.png' => 1,
'kachkaevcountersbundle.php' => 1,
'kachkaevdafbundle.php' => 1,
'treeviewassets.php' => 1,
'tinymcefilemanagerasset.php' => 1,
'debpkg.xml' => 1,
'update-locales.sh' => 1,
'.travisload.sh' => 1,
'kamranxmlformbundle.php' => 1,
'.phpunit.dist.xml' => 1,
'.magmierrors' => 1,
'.localtest.sh' => 1,
'config.dist.yml' => 1,
'phpunit-unit.xml.dist' => 1,
'lsroudiclassifiedadsevents.php' => 1,
'lsroudiclassifiedadsbundle.php' => 1,
'update-pot.sh' => 1,
'run-phpdoc.sh' => 1,
'athens.php' => 1,
'makepackagexml.php' => 1,
'make-release.sh' => 1,
'ixr_library.php' => 1,
'radiofilter.php' => 1,
'dropdownfilter.php' => 1,
'datefilter.php' => 1,
'checkboxfilter.php' => 1,
'lpwebpaymentevents.php' => 1,
'lpwebpaymentbundle.php' => 1,
'reflection_php4.php' => 1,
'baseaccount.php' => 1,
'facerepository.php' => 1,
'service.json' => 1,
'wechatshakearound.php' => 1,
'notificationhandler.php' => 1,
'googledrivebundle.php' => 1,
'drivemodifier.php' => 1,
'drivefinder.php' => 1,
'driveconnector.php' => 1,
'channelmanager.php' => 1,
'start-selenium-server.bat' => 1,
'screenshot-simpletest-gui.png' => 1,
'wechatuser.php' => 1,
'wechatstat.php' => 1,
'wechatsemantic.php' => 1,
'photorepository.php' => 1,
'wechatqrcode.php' => 1,
'wechatoauth2.php' => 1,
'migrations.xml' => 1,
'wechatmessage.php' => 1,
'wechatmenu.php' => 1,
'wechatkf.php' => 1,
'wechatcard.php' => 1,
'b2backblazebundle.php' => 1,
'kamrangroupchoicelistbundle.php' => 1,
'kamransettingbundle.php' => 1,
'payserver.php' => 1,
'phpup' => 1,
'documentasset.php' => 1,
'pdfparserbundle.php' => 1,
'karserrobokassabundle.php' => 1,
'easytest.php' => 1,
'symvirins' => 1,
'symvirins.phar' => 1,
'kahorimagethumbnailbundle.php' => 1,
'binarythinkinglastfmbundle.php' => 1,
'openmiddlewarebundle.php' => 1,
'ussd.php' => 1,
'phpunit_ci.xml' => 1,
'karsergoogletranslatebundle.php' => 1,
'karsermainsmsbundle.php' => 1,
'karsersmsbundle.php' => 1,
'richerrortest.php' => 1,
'karsersmsvestibundle.php' => 1,
'activeformevent.php' => 1,
'gemaadminbundle.php' => 1,
'puzzle' => 1,
'svn.xml' => 1,
'phplint.xml' => 1,
'formgrid.php' => 1,
'formtrait.php' => 1,
'git.xml' => 1,
'exec.xml' => 1,
'default.yaml' => 1,
'richerror.php' => 1,
'wubookapibundle.php' => 1,
'ajaxq.php' => 1,
'config_merge.php' => 1,
'greek_vat_validator.php' => 1,
'events.test.php' => 1,
'transelot.php' => 1,
'reversepagination.php' => 1,
'reverselinkpager.php' => 1,
'ajaxqasset.php' => 1,
'bvcmsbundle.php' => 1,
'bvitemplatebundle.php' => 1,
'bvrolebundle.php' => 1,
'kapcontactbundle.php' => 1,
'restfulparser.php' => 1,
'try_catch.php' => 1,
'notify_url.php' => 1,
'alipayapi.php' => 1,
'alipay.config.php' => 1,
'ophir.php' => 1,
'file_upload.php' => 1,
'propelmodelparserbundle.php' => 1,
'propertycollection.php' => 1,
'sample_config.inc.php' => 1,
'create_database.sql' => 1,
'rsparsertest.php' => 1,
'pdfparser.php' => 1,
'gitaski' => 1,
'terminatur.database.inc' => 1,
'domquery.js' => 1,
'lifestreamserviceprovider.php' => 1,
'config.yml-dist' => 1,
'wc-edostavka.php' => 1,
'.platform-project' => 1,
'emailmakr' => 1,
'windwalker' => 1,
'phpunit.xml.pgsql.dist' => 1,
'admin-global-search-autocomplete.php' => 1,
'moduleloader.js' => 1,
'etmas.css' => 1,
'ajaxutil.js' => 1,
'direction.php' => 1,
'imageuploadasset.php' => 1,
'imageupload.php' => 1,
'ezmigrationbundle.php' => 1,
'makephar' => 1,
'kaliopqueueingpluginskinesisbundle.php' => 1,
'kaliopqueueingpluginssqsbundle.php' => 1,
'kaliopqueueingpluginsstompbundle.php' => 1,
'kaliopqueueingbundle.php' => 1,
'simplemenu.php' => 1,
'shortcutmenu.php' => 1,
'lyrixxlifestreambundle.php' => 1,
'city.mmdb' => 1,
'viewengine.php' => 1,
'b3wasset.php' => 1,
'tinymcecontentstylesasset.php' => 1,
'elfindercontroller.php' => 1,
'authitem.php' => 1,
'terminatur.drush.inc' => 1,
'fullcalendarassets.php' => 1,
'terminatur.files.inc' => 1,
'dynmodels.php' => 1,
'dynmodelfields.php' => 1,
'dynmodeleditor.php' => 1,
'checkboxlist.php' => 1,
'wtexception.php' => 1,
'country.mmdb' => 1,
'simpledemo.php' => 1,
'groupdemo.php' => 1,
'worldtextsms.class.php' => 1,
'worldtextgroup.class.php' => 1,
'worldtextadmin.class.php' => 1,
'worldtext.php' => 1,
'terminatur.settings.inc' => 1,
'terminatur.utils.inc' => 1,
'symfonyformgeneratorbundle.php' => 1,
'lzakrzewskifacebookauthenticationbundle.php' => 1,
'pingpp.php' => 1,
'notifymenu.php' => 1,
'webuploaderhtml5onlyasset.php' => 1,
'readme.eng' => 1,
'mage.package.xml' => 1,
'localebundleevents.php' => 1,
'changelog-2_1' => 1,
'wp-nonce.php' => 1,
'listsearchwidget.php' => 1,
'coalaconsolebundle.php' => 1,
'coalacatchphperrorsbundle.php' => 1,
'decoder.php' => 1,
'interface-pm-proxy' => 1,
'pdo.class.inc.php' => 1,
'pear.package.xml' => 1,
'micro.sql' => 1,
'wysibbwidgetasset.php' => 1,
'.atoum.php.ci' => 1,
'playbloomguzzlebundle.php' => 1,
'.kisma.php' => 1,
'pbarcode39.php~' => 1,
'gusuploaderbundle.php' => 1,
'multicombinator.php' => 1,
'klein.php' => 1,
'ppie.php~' => 1,
'humbuglog' => 1,
'workstead' => 1,
'snowflake' => 1,
'luneticstimezonebundle.php' => 1,
'timezonebundleevents.php' => 1,
'webuploaderflashonlyasset.php' => 1,
'remote-admin.png' => 1,
'uploaderaction.php' => 1,
'ueditorassets.php' => 1,
'amazeuithreepresenter.php' => 1,
'test3.jpeg' => 1,
'test2.jpeg' => 1,
'test1.jpeg' => 1,
'featurecheckerbundle.php' => 1,
'garbagecollector.php' => 1,
'phreepio' => 1,
'kumitebundle.php' => 1,
'registerinterface.php' => 1,
'website' => 1,
'luya.php' => 1,
'bootstrap4asset.php' => 1,
'luxiferrabbitmqmanagementbundle.php' => 1,
'googlemapassets.php' => 1,
'navcustom.php' => 1,
'resizecrop.php' => 1,
'selectmaplocationassets.php' => 1,
'composer.jsonbak' => 1,
'chrome.crx' => 1,
'selectmaplocationwidget.php' => 1,
'wysibbwidget.php' => 1,
'subtree-split.config' => 1,
'twbsmaxlengthasset.php' => 1,
'wp-plugin-core.php' => 1,
'socolissimo.php' => 1,
'theliasmarty.php' => 1,
'theliamigratecountry.php' => 1,
'theliahybridauth.php' => 1,
'theliagooglemap.php' => 1,
'theliadebugbar.php' => 1,
'taxruleimport.php' => 1,
'takecustomeraccount.php' => 1,
'tntfrance.php' => 1,
'supportticket.php' => 1,
'stripepayment.php' => 1,
'storeseo.php' => 1,
'stockonorder.php' => 1,
'stockalert.php' => 1,
'smartyredirection.php' => 1,
'theliatwig.php' => 1,
'smartyfilter.php' => 1,
'smartycache.php' => 1,
'shoppingflux.php' => 1,
'routesmatchinverter.php' => 1,
'rewriteurl.php' => 1,
'removeuselesscart.php' => 1,
'redsys.php' => 1,
'redirection.php' => 1,
'recentlyviewed.php' => 1,
'productsearch.php' => 1,
'productonlinewithoutstock.php' => 1,
'productofflinewithstock.php' => 1,
'popin.php' => 1,
'theliastudio.php' => 1,
'tokenrenew.php' => 1,
'payzenmulti.php' => 1,
'configuration.html' => 1,
'document-edit.html' => 1,
'customers.html' => 1,
'customer-edit.html' => 1,
'currency-edit.html' => 1,
'currencies.html' => 1,
'create-password.html' => 1,
'create-password-success.html' => 1,
'coupon-update.html' => 1,
'coupon-list.html' => 1,
'coupon-create.html' => 1,
'country-edit.html' => 1,
'countries.html' => 1,
'content-edit.html' => 1,
'config-store.html' => 1,
'transferpayment.php' => 1,
'category-edit.html' => 1,
'categories.html' => 1,
'brands.html' => 1,
'brand-edit.html' => 1,
'attributes.html' => 1,
'attribute-edit.html' => 1,
'api.html' => 1,
'advanced-configuration.html' => 1,
'administrators.html' => 1,
'admin-logs.html' => 1,
'admin-layout.tpl' => 1,
'wiretransfer.php' => 1,
'virtualproductdelivery.php' => 1,
'virtualproductcontrol.php' => 1,
'payzenoneoffsepa.php' => 1,
'payzen.php' => 1,
'export-page.html' => 1,
'dealerteam.php' => 1,
'googleshopping.php' => 1,
'freeorder.php' => 1,
'forcephone.php' => 1,
'flatfeedelivery.php' => 1,
'featuretype.php' => 1,
'extraorderdata.php' => 1,
'duplicateorder.php' => 1,
'dpdpickup.php' => 1,
'dpdclassic.php' => 1,
'diaporamas.php' => 1,
'deliveryround.php' => 1,
'deliveryexcludedate.php' => 1,
'deliverydelay.php' => 1,
'dealer.php' => 1,
'gratisonlinealert.php' => 1,
'databasesmanager.php' => 1,
'customerscope.php' => 1,
'customergroupacl.php' => 1,
'phpcbf.sh' => 1,
'customergroup.php' => 1,
'customerfamily.php' => 1,
'customerbirthdate.php' => 1,
'customdelivery.php' => 1,
'criteriasearch.php' => 1,
'creditnote.php' => 1,
'creditaccount.php' => 1,
'contest.php' => 1,
'contentcode.php' => 1,
'googleuniversalanalytics.php' => 1,
'hookadminhome.php' => 1,
'paymentrecall.php' => 1,
'imagefactory.php' => 1,
'paybox.php' => 1,
'ordercreation.php' => 1,
'ordercomment.php' => 1,
'opensearchserversearch.php' => 1,
'moneris.php' => 1,
'mailjet.php' => 1,
'loyalty.php' => 1,
'lengow.php' => 1,
'legacyproductattributes.php' => 1,
'keyword.php' => 1,
'indexengine.php' => 1,
'importt1.php' => 1,
'importexportseo.php' => 1,
'inseegeo.php' => 1,
'hookanalytics.php' => 1,
'hooksocial.php' => 1,
'hooksearch.php' => 1,
'hookproductsoffer.php' => 1,
'hookproductsnew.php' => 1,
'hooknewsletter.php' => 1,
'hooknavigation.php' => 1,
'hooklinks.php' => 1,
'hooklang.php' => 1,
'hookdoc.php' => 1,
'hookcustomer.php' => 1,
'hookcurrency.php' => 1,
'hookcookies.php' => 1,
'hookcontact.php' => 1,
'hookcart.php' => 1,
'error.html' => 1,
'export.html' => 1,
'colissimo.php' => 1,
'theme.ini' => 1,
'dtgeshibundle.php' => 1,
'atresourceaccessbundle.php' => 1,
'theodorogercmsbundle.php' => 1,
'theodoquizbundle.php' => 1,
'theodoframeworkextrabundle.php' => 1,
'theodoevolutionsessionbundle.php' => 1,
'theodoevolutionlegacywrapperbundle.php' => 1,
'theododrupal8bundle.php' => 1,
'theodoesendexclientbundle.php' => 1,
'twade.php' => 1,
'katana' => 1,
'ovhsmsbundle.php' => 1,
'imagesbase64converterbundle.php' => 1,
'tmhoauth.php' => 1,
'.shuntpwd' => 1,
'maschitcryptencoderbundle.php' => 1,
'maschitbarcodebundle.php' => 1,
'unit-tests.sh' => 1,
'unit-tests.bat' => 1,
'reset_install.sh' => 1,
'reset_install.bat' => 1,
'php-cs.bat' => 1,
'php-cs' => 1,
'change-version.sh' => 1,
'thelia.sql' => 1,
'tax_faker.php' => 1,
'insert.sql.tpl' => 1,
'insert.sql' => 1,
'rfc5849' => 1,
'travis.xml.dist' => 1,
'faker_100categories_1000products_4locales.php' => 1,
'aismatakuliahbundle.php' => 1,
'aisuserbundle.php' => 1,
'aistranskripbundle.php' => 1,
'aisstatuskeaktifanbundle.php' => 1,
'aisslotbundle.php' => 1,
'aissemesterbundle.php' => 1,
'aisruangbundle.php' => 1,
'aisprovinsibundle.php' => 1,
'aisprodibundle.php' => 1,
'aisprestasibundle.php' => 1,
'aispimpinanprodibundle.php' => 1,
'aispertemuanmahasiswabundle.php' => 1,
'aispertemuandosenbundle.php' => 1,
'aispertemuanbundle.php' => 1,
'aismahasiswaprofilebundle.php' => 1,
'tacticianbundle.php' => 1,
'aismahasiswabundle.php' => 1,
'aiskontrakmahasiswabundle.php' => 1,
'aiskontrakdosenbundle.php' => 1,
'aiskabupatenbundle.php' => 1,
'aisjadwalbundle.php' => 1,
'aisijasahsmabundle.php' => 1,
'aisharibundle.php' => 1,
'aisgedungbundle.php' => 1,
'aisdosenbundle.php' => 1,
'aisdaftarbundle.php' => 1,
'aisbimbinganbundle.php' => 1,
'md2resume_dev.php' => 1,
'working.php' => 1,
'fb' => 1,
'faker_add_ecotax.php' => 1,
'faker.php' => 1,
'feature-edit.html' => 1,
'module-edit.html' => 1,
'shipping-zones-edit.html' => 1,
'shipping-configuration.html' => 1,
'shipping-configuration-edit.html' => 1,
'sales.html' => 1,
'sale-edit.html' => 1,
'profiles.html' => 1,
'profile-edit.html' => 1,
'product-edit.html' => 1,
'orders.html' => 1,
'order-edit.html' => 1,
'modules.html' => 1,
'module-hooks.html' => 1,
'module-hook-edit.html' => 1,
'module-configure.html' => 1,
'simple-layout.tpl' => 1,
'message-edit.html' => 1,
'mailing-system.html' => 1,
'lost-password.html' => 1,
'languages.html' => 1,
'import-page.html' => 1,
'image-edit.html' => 1,
'hooks.html' => 1,
'hook-edit.html' => 1,
'home.html' => 1,
'general_error.html' => 1,
'folders.html' => 1,
'folder-edit.html' => 1,
'features.html' => 1,
'shipping-zones.html' => 1,
'state-edit.html' => 1,
'database.yml.sample' => 1,
'admin_password' => 1,
'hooktest.php' => 1,
'delivery.html' => 1,
'password' => 1,
'password.html' => 1,
'order_notification' => 1,
'order_notification.html' => 1,
'order_confirmation' => 1,
'order_confirmation.html' => 1,
'newsletter_subscription_confirmation' => 1,
'newsletter_subscription_confirmation.html' => 1,
'email-layout.tpl' => 1,
'default-text-layout.tpl' => 1,
'default-html-layout.tpl' => 1,
'admin_password.html' => 1,
'states.html' => 1,
'account_created_by_admin' => 1,
'account_created_by_admin.html' => 1,
'account_changed_by_admin' => 1,
'account_changed_by_admin.html' => 1,
'variables.html' => 1,
'variable-edit.html' => 1,
'translations.html' => 1,
'tools.html' => 1,
'templates.html' => 1,
'template-edit.html' => 1,
'taxes-rules.html' => 1,
'tax-rule-edit.html' => 1,
'tax-edit.html' => 1,
'system-logs.html' => 1,
'configdoc.php' => 1,
'cmcic.php' => 1,
'vmcpatientbundle.php' => 1,
'tebruexecutionerbundle.php' => 1,
'release-1.1.0' => 1,
'api-2.0.0' => 1,
'api-1.1.0' => 1,
'api-1.0.0' => 1,
'license.orig' => 1,
'example-vanilla.php' => 1,
'example-composer.php' => 1,
'phpctags.class.php' => 1,
'pbc-export.sh' => 1,
'wp-async-task.php' => 1,
'tebrustripebundle.php' => 1,
'tebruretrofitbundle.php' => 1,
'servicescollection.php' => 1,
'teapotiobaseuserbundle.php' => 1,
'release-2.0.1' => 1,
'teapotiobasethemebundle.php' => 1,
'teapotiobaseforumbundle.php' => 1,
'teapotiobasecachebundle.php' => 1,
'statuscode.php' => 1,
'retention.php' => 1,
'retention.civix.php' => 1,
'nonmembers.php' => 1,
'nonmembers.civix.php' => 1,
'registerwithoutemail.php' => 1,
'registerwithoutemail.civix.php' => 1,
'management.php' => 1,
'management.civix.php' => 1,
'mailgun.civix.php' => 1,
'release-2.0.0' => 1,
'release-2.0.2' => 1,
'cache' => 1,
'uspsprioritylabel.php' => 1,
'update-checker' => 1,
'.circle.yml' => 1,
'pumukityoutubebundle.php' => 1,
'pumukitvideoeditorbundle.php' => 1,
'pumukitpaellaplayerbundle.php' => 1,
'pumukitmoodlebundle.php' => 1,
'pumukitgeantwebtvbundle.php' => 1,
'baserestservicetb.php' => 1,
'authtb.php' => 1,
'datatableassets.php' => 1,
'collapsewidgetasset.php' => 1,
'collapsewidget.php' => 1,
'uspsservicedeliverycalculator.php' => 1,
'uspsopendistributelabel.php' => 1,
'copying-gpl' => 1,
'uspsinternationallabel.php' => 1,
'uspsfirstclassservicestandards.php' => 1,
'cspoosmsbundle.php' => 1,
'cspooswiftmailermailgunbundle.php' => 1,
'data_bridge.php' => 1,
'siteidentifier.php' => 1,
'tedivmstashbundle.php' => 1,
'setupenvironment.sh' => 1,
'.dovecottestingmark' => 1,
'phpcs_test.xml' => 1,
'quickstart-guide' => 1,
'pear-summary' => 1,
'project.properties' => 1,
'readme.pear' => 1,
'voice' => 1,
'pagetsconfig' => 1,
'temporesourceextrabundle.php' => 1,
'memcachefactory.php' => 1,
'tfoxestidcardbundle.php' => 1,
'tfoxditoolsbundle.php' => 1,
'tfoxdbprocedureevents.php' => 1,
'tfoxdbprocedurebundle.php' => 1,
'tfoxcalendarbundle.php' => 1,
'tfoxbeanstalkdbundle.php' => 1,
'nginx_rewrite' => 1,
'thtranslationlogbundle.php' => 1,
'loggingmessagecatalogue.php' => 1,
'statsd.php' => 1,
'smstatsdbundle.php' => 1,
'smmemcachebundle.php' => 1,
'mockmemcache.php' => 1,
'tariochphealbundle.php' => 1,
'userpolicy.php' => 1,
'tariocheveapifetcherbundle.php' => 1,
'upstartmonitorbundle.php' => 1,
'upstartbundle.php' => 1,
'dockerfile.py' => 1,
'test-runner.php' => 1,
'torm.php' => 1,
'delayedmail.php' => 1,
'solrfacade.php' => 1,
'solrconnectionfactory.php' => 1,
'solrconnection.php' => 1,
'taprontoformfilterbundle.php' => 1,
'filterformservice.php' => 1,
'formulate.php' => 1,
'tfoxpangalinkbundle.php' => 1,
'workchatclient.php' => 1,
'rqlbundle.php' => 1,
'gan_tokenizer.php' => 1,
'leoorestbundle.php' => 1,
'teaandcodeapibundle.php' => 1,
'vertere' => 1,
'rml' => 1,
'agpl-3.0' => 1,
'example_torrent_creator.php' => 1,
'example_seeder.php' => 1,
'example_announce.php' => 1,
'license.gplv2' => 1,
'license.asl20' => 1,
'pxgif.php' => 1,
'pquery.php' => 1,
'gan_xml2array.php' => 1,
'gan_selector_html.php' => 1,
'class-page-layouts.php' => 1,
'gan_parser_html.php' => 1,
'gan_node_html.php' => 1,
'gan_formatter.php' => 1,
'iquery.php' => 1,
'server-conf.php' => 1,
'oandawrapreference.html' => 1,
'oandawraplicense' => 1,
'oandawrap.php' => 1,
'taviisqsjobqueuebundle.php' => 1,
'sqsjobqueueevents.php' => 1,
'sutra.kdev4' => 1,
'flourish-alternatives' => 1,
'field-groups.php' => 1,
'class-post-layouts.php' => 1,
'tempojsconfigurationbundle.php' => 1,
'samplev2.php' => 1,
'catchthelia1url.php' => 1,
'topribbonmenu.css' => 1,
'underscore.png' => 1,
'jquery-1.7.2.min.js' => 1,
'loading.gif' => 1,
'fileuploader.js' => 1,
'fileuploader.css' => 1,
'static_highlight.js' => 1,
'scrollable-page.html' => 1,
'kitchen-sink.html' => 1,
'kitchen-sink-req.html' => 1,
'druplash.module' => 1,
'druplash.info' => 1,
'messages.css' => 1,
'topribbonmenu.js' => 1,
'thecitystrategy.php' => 1,
'composer-mouf.lock' => 1,
'phpcliutil.class.php' => 1,
'phpcli.class.php' => 1,
'theapicctvblindfoldbundle.php' => 1,
'stepper.php' => 1,
'blindfold.php' => 1,
'lace' => 1,
'environment.json' => 1,
'.travis,yml' => 1,
'jquery.percentageloader-0.1.js' => 1,
'jquery.percentageloader-0.1.css' => 1,
'multiple.html' => 1,
'index8.html' => 1,
'index7.html' => 1,
'composer-mouf.json' => 1,
'composer-mouf.sh' => 1,
'index5.html' => 1,
'adminsubdomain.php' => 1,
'canonicalurl.php' => 1,
'canadapost.php' => 1,
'cbfranfinance3x.php' => 1,
'brandproductdisplay.php' => 1,
'brandcarousel.php' => 1,
'bosearch.php' => 1,
'beanstreammodule.php' => 1,
'be2bill.php' => 1,
'backofficepath.php' => 1,
'backofficecss.php' => 1,
'responsecode.php' => 1,
'attributetype.php' => 1,
'atos.php' => 1,
'admincomment.php' => 1,
'git-commit-packages.sh' => 1,
'pdo.json.default' => 1,
'memcache.php.default' => 1,
'app.php.default' => 1,
'mongo.json.default' => 1,
'upload_cc.sh' => 1,
'documentation.zip' => 1,
'gruntfile' => 1,
'gruntfile.php' => 1,
'rediscache.php' => 1,
'php-travis.ini' => 1,
'cacheadmin.php' => 1,
'node-js.png' => 1,
'install_screen.php' => 1,
'git-recursive.sh' => 1,
'index6.html' => 1,
'index4.html' => 1,
'tenelevengeolocatorbundle.php' => 1,
'modulelanguageredirect.php' => 1,
'mpforms.php' => 1,
'formmpformpageswitch.php' => 1,
'mailusername.php' => 1,
'leadsexport.php' => 1,
'leads.php' => 1,
'inserttags.php' => 1,
'formstylify.php' => 1,
'easythemes.php' => 1,
'checkboxchooseatleastone.php' => 1,
'formcountryselectmenu.php' => 1,
'formconditionalselectmenu.php' => 1,
'conditionalselectmenu.php' => 1,
'conditionalformfields.php' => 1,
'modulechangelanguage.php' => 1,
'newslanguage.php' => 1,
'changelanguage.php' => 1,
'ceaccess.php' => 1,
'namespaceclassloader.php' => 1,
'wiringpiphp.iml' => 1,
'nagios_check_nagixx' => 1,
'paginator.html.twig' => 1,
'dev-auth.php-sample' => 1,
'autoloader-dev.php' => 1,
'sitemap-glue.php.sample' => 1,
'ten24cmspagesbundle.php' => 1,
'blockdiag.php' => 1,
'rpc.php' => 1,
'btc_address_validator.php' => 1,
'mpformsformmanager.php' => 1,
'modulebackgroundimage.php' => 1,
'index3.html' => 1,
'youtrackticket.php' => 1,
'index2.html' => 1,
'wizard-list-place.html' => 1,
'wizard-list-boat.html' => 1,
'jquery.creditcardvalidator.js' => 1,
'cards.png' => 1,
'xiseasyformsbundle.php' => 1,
'hampezurbinkbundle.php' => 1,
'vendor.yml' => 1,
'lyrisapi.php' => 1,
'tgaforumbundle.php' => 1,
'tgaopengraphbundle.php' => 1,
'textpack' => 1,
'textmagic-cli.php' => 1,
'youtrackticket.body.php' => 1,
'modulepageimage.php' => 1,
'piwik_tracking_api.php' => 1,
'piwiktracker.php' => 1,
'tetranzselect2entitybundle.php' => 1,
'option-parser' => 1,
'option-parameter' => 1,
'bloggerblogbundle.php' => 1,
'fotogrid.php' => 1,
'commentsbundle.php' => 1,
'doctrinestackbundle.php' => 1,
'terramarsalesbundle.php' => 1,
'terramarcustomerbundle.php' => 1,
'modulealias.php' => 1,
'tablelookupwizard.php' => 1,
'pageimage.php' => 1,
'aiswisudabundle.php' => 1,
'vmcvisitbundle.php' => 1,
'alicache.php' => 1,
'precis.php' => 1,
'fnc.php' => 1,
'pecserkeyamlfixturesbundle.php' => 1,
'pecserketwigdoctrineloaderbundle.php' => 1,
'oauth.py' => 1,
'o1auth.php' => 1,
'moreoauth.php' => 1,
'index4.php' => 1,
'hello.py' => 1,
'flaskoauth.py' => 1,
'auth.py' => 1,
'valueexpression.php' => 1,
'dynamicactiverecord.php' => 1,
'dynamicactivequery.php' => 1,
'casefolddatatrait.php' => 1,
'debug-performance.css' => 1,
'casefold.php' => 1,
'bididatatrait.php' => 1,
'bidi.php' => 1,
'labeler.php' => 1,
'labeler' => 1,
'liver' => 1,
'test_login.php' => 1,
'abc.php' => 1,
'test_patterns.php' => 1,
'test_login_html_auto.php' => 1,
'test_login_html.php' => 1,
'test_login3.php' => 1,
'test_login2.php' => 1,
'conceptitorientdbbundle.php' => 1,
'debug-performance.js' => 1,
'ebi.phar' => 1,
'tiga' => 1,
'superglue.php' => 1,
'fm-demo2.png' => 1,
'fm-demo.png' => 1,
'demo_temp_for_laravel.blade.php' => 1,
'view.xml' => 1,
'tooffftoolsforcrudbundle.php' => 1,
'toofffsessionbundle.php' => 1,
'toofffformsbundle.php' => 1,
'ovethesaurusbundle.php' => 1,
'oveproceduresbundle.php' => 1,
'oveauthentificationbundle.php' => 1,
'tiga.php' => 1,
'tiga-command.php' => 1,
'threescalebundle.php' => 1,
'diffdir.php' => 1,
'biodb_body.php' => 1,
'biodb.php' => 1,
'semanticdataimport.php' => 1,
'semanticdataimport.i18n.php' => 1,
'pdflib.php' => 1,
'pdflibexception.php' => 1,
'dscountdownasset.php' => 1,
'dscountdown.php' => 1,
'arkulpasymfonyextensionsbundle.php' => 1,
'arkulpacontactformbundle.php' => 1,
'ruleset-for-tests.xml' => 1,
'ruleset-for-contexts.xml' => 1,
'tommygnrdatatablesbundle.php' => 1,
'create-composer-json.php' => 1,
'test_login1.php' => 1,
'toin0udigitaloceanbundle.php' => 1,
'create_migration.php' => 1,
'maczukinappversionbundle.php' => 1,
'couscous.phar' => 1,
'phpunit_stdlib.xml' => 1,
'phpunit_mvc.xml' => 1,
'phpunit_di.xml' => 1,
'module_documents' => 1,
'documents' => 1,
'test11' => 1,
123 => 1,
'access.log' => 1,
'tmcycyitmapbundle.php' => 1,
'themer-logo' => 1,
'enttestfile.php' => 1,
'algorithm' => 1,
'smtpmailer.php' => 1,
'tmwkcpaneluapibundle.php' => 1,
'oauth2china.php' => 1,
'sybase.php' => 1,
'tkuskauserevents.php' => 1,
'tkuskauserbundle.php' => 1,
'tkuskaribbonbundle.php' => 1,
'tkuskageneratorbundle.php' => 1,
'widgetprovider.php' => 1,
'tkuskadashboardbundle.php' => 1,
'refreshtabaction.php' => 1,
'dwzxheditorasset.php' => 1,
'dwzuploadifyasset.php' => 1,
'dwzprintasset.php' => 1,
'dwzcoreasset.php' => 1,
'ebfacebookbundle.php' => 1,
'naokihanzawa.php' => 1,
'toiinecouchbasebundle.php' => 1,
'skeleton.html.php' => 1,
'samples.html' => 1,
'toguuserbundle.php' => 1,
'togutemplatebundle.php' => 1,
'toguengine.php' => 1,
'toguserializationbundle.php' => 1,
'togumediabundle.php' => 1,
'togugeneratorbundle.php' => 1,
'togufrontendbundle.php' => 1,
'toguapplicationmodelsbundle.php' => 1,
'toguannotationbundle.php' => 1,
'toguadminbundle.php' => 1,
'toffiakurlshortenerbundle.php' => 1,
'skeleton.json.php' => 1,
'sitemap.xslt.php' => 1,
'email.class.php' => 1,
'tjmstandardeditionbundle.php' => 1,
'pprint_r.php' => 1,
'symfony2_env_vars' => 1,
'phpunit.bootstrapless.xml.dist' => 1,
'boris-loader.php' => 1,
'tobiassjostenthetvdbbundle.php' => 1,
'ascoraformatter.php' => 1,
'toavalidatorbundle.php' => 1,
'toatwitterbootstrapbundle.php' => 1,
'toaframeworkextrabundle.php' => 1,
'toalayoutbundle.php' => 1,
'toabowerbundle.php' => 1,
'toaasseticbundle.php' => 1,
'toaapcbundle.php' => 1,
'color_terminal.php' => 1,
'update_database.php' => 1,
'gaunt.php' => 1,
'my-sites-search.js' => 1,
'vhost.conf.dist' => 1,
'autocompletion.php' => 1,
'.env.docker.dist' => 1,
'jslogasset.php' => 1,
'arrayinputasset.php' => 1,
'arrayinput.php' => 1,
'aceeditor.php' => 1,
'capayable-client-php.sublime-project' => 1,
'myposeobundle.php' => 1,
'tristanbeselophantbundle.php' => 1,
'environment.php.dist' => 1,
'apiclientbundle.php' => 1,
'my-sites-search.php' => 1,
'my-sites-search.css' => 1,
'cerberus.mysql.sql' => 1,
'class-tp-taxonomy-terms.php' => 1,
'class-tp-post-type-posts.php' => 1,
'class-tp-widget-customizable.php' => 1,
'tw-sliders.php' => 1,
'class-tp-term-taxonomy-meta.php' => 1,
'class-tp-term-image.php' => 1,
'class-tp-term-description-editor.php' => 1,
'class-tp-tabs.php' => 1,
'class-tp-static-widget.php' => 1,
'class-tp-smtp.php' => 1,
'class-tp-related.php' => 1,
'class-tp-redirects.php' => 1,
'recurring-widgets.php' => 1,
'vhost.conf.docker.dist' => 1,
'cerberus.pgsql.sql' => 1,
'class-tp-post-type-archive-settings.php' => 1,
'tinymce.min.js' => 1,
'pingdom-rum.php' => 1,
'img-pingdom-logo.png' => 1,
'tuisessionbundle.php' => 1,
'tuhaokuai.php' => 1,
'rssreader.php' => 1,
'flagicon.php' => 1,
'uniqifier.php' => 1,
'bementioned' => 1,
'filebundle.php' => 1,
'update-1.1' => 1,
'tssbehatbuilderbundle.php' => 1,
'sculpinrelatedpostsbundle.php' => 1,
'relatedpostsgenerator.php' => 1,
'jquery.tinymce.min.js' => 1,
'clear.sql' => 1,
'cachedrivers.php.ini' => 1,
'asciimath.php' => 1,
'pkpass.php' => 1,
'trustly.php' => 1,
'ezcontentdecoratorbundle.php' => 1,
'trsteelhtmlformvalidationbundle.php' => 1,
'preloader.i18n.php' => 1,
'trovitcronmanagerbundle.php' => 1,
'doxyfile.in' => 1,
'gitnotes' => 1,
'mssqlbundle.php' => 1,
'httpwebrequest.php' => 1,
'sethost.php' => 1,
'composer54.json' => 1,
'class-tp-post-type-order.php' => 1,
'class-tp-opening-hours.php' => 1,
'future.json' => 1,
'privmsg.php' => 1,
'tpeigneadminbundle.php' => 1,
'activate' => 1,
'switcheryasset.php' => 1,
'switchery.php' => 1,
'fineuploaderjqueryasset.php' => 1,
'toukiftpbundle.php' => 1,
'index.csv' => 1,
'imageinspector' => 1,
'tzandertestbundle.php' => 1,
'tzblogbundle.php' => 1,
'pagefactory.iml' => 1,
'terms.php' => 1,
'styleguide.php' => 1,
'opensearch_desc_bt.xml' => 1,
'sitemapmodule.php' => 1,
'opensearch_desc.xml' => 1,
'modcp.php' => 1,
'group_edit.php' => 1,
'dl_list.php' => 1,
'dl.php' => 1,
'callseed.php' => 1,
'movefile.sample' => 1,
'uorm.lib.php' => 1,
'udb.php' => 1,
'mysqli-log.php' => 1,
'error-log.php' => 1,
'trtswiftcssinlinerbundle.php' => 1,
'trtasynctasksbundle.php' => 1,
'imagick.php' => 1,
'cmars.php' => 1,
'class-tp-opening-hours-widget.php' => 1,
'class-tp-debug.php' => 1,
'class-tp-opening-hours-special.php' => 1,
'class-tp-opening-hours-periods.php' => 1,
'class-tp-opening-hours-frontend.php' => 1,
'class-tp-opening-hours-day.php' => 1,
'class-tp-opening-hours-admin.php' => 1,
'multisite-labels.php' => 1,
'class-tp-multiple-thumbnails.php' => 1,
'multiple-content-blocks.php' => 1,
'class-tp-global-content-blocks.php' => 1,
'class-tp-events.php' => 1,
'class-tp-editor-capabilities.php' => 1,
'class-tp-dev-uploads.php' => 1,
'class-tp-dev-mail.php' => 1,
'credits.php' => 1,
'aliexpress.php' => 1,
'class-tp-contact-information.php' => 1,
'auto-update.php' => 1,
'trend404bundle.php' => 1,
'install_composer.sh' => 1,
'tweaks.patch' => 1,
'autoload.patch' => 1,
'pmd.xml' => 1,
'amkfile' => 1,
'.ctags' => 1,
'.empty' => 1,
'translationexchange.php' => 1,
'transferbundle.php' => 1,
'nikoladevanabookappbundle.php' => 1,
'cache-main.php' => 1,
'dwzasset.php' => 1,
'example.nginx.conf' => 1,
'phpab.bat' => 1,
'iron.json' => 1,
'formhandler.php' => 1,
'bpost.php' => 1,
'bpack247.php' => 1,
'dropbox.php' => 1,
'dbfact.php' => 1,
'ciscospa500.php' => 1,
'activecollab.php' => 1,
'translator.tpl.php' => 1,
'testfilter.php' => 1,
'lsoftadbundle.php' => 1,
'jigsaw' => 1,
'doctrinegeneratemodelsbundle.php' => 1,
'tigefa.jquery.json' => 1,
'tideways.php' => 1,
'shm-deep-integration-v3.xsd' => 1,
'tickitcachebundle.php' => 1,
'riak.php' => 1,
'php-doxyfile' => 1,
'testapi.php' => 1,
'freemobile.crt' => 1,
'freemobilenotificationsender.php' => 1,
'select2buttonasset.php' => 1,
'select2button.php' => 1,
'isloadingasset.php' => 1,
'isloadingajaxstatusasset.php' => 1,
'isloading.php' => 1,
'json2dto' => 1,
'triplepointphpunitsofmeasurebundle.php' => 1,
'geo6.php' => 1,
'log.todo' => 1,
'mapping.yaml' => 1,
'noderpcclient.php' => 1,
'booty.php' => 1,
'booty.i18n.php' => 1,
'booty.extension.php' => 1,
'booty.class.php' => 1,
'tester' => 1,
'u.php' => 1,
'elementoptionsplugin.php' => 1,
'rpcserverbundle.php' => 1,
'rpcserver.php' => 1,
'rpcproxy.php' => 1,
'rpcclientbundle.php' => 1,
'rpcclient.php' => 1,
'nodeserverbundle.php' => 1,
'nodeclientbundle.php' => 1,
'phonebook.mwb' => 1,
'nodeclient.php' => 1,
'geonamesbundle.php' => 1,
'geonames.php' => 1,
'querybuilder.png' => 1,
'devcon.jpg' => 1,
'varnishbundle.php' => 1,
'epicoftimewastedcryptobundle.php' => 1,
'timepadapi.php' => 1,
'stripeoauth2client.class.php' => 1,
'stripeoauth.class.php' => 1,
'raorocrmtimelapbundle.php' => 1,
'travis-codeclimate-report.sh' => 1,
'redis-cache.php' => 1,
'taskpaper.todo' => 1,
'sharepointapi.php' => 1,
'hinter.php' => 1,
'skinny.i18n.magic.php' => 1,
'rtti.php' => 1,
'newscoopmeteobluepluginbundle.php' => 1,
'newscoopdonationspluginbundle.php' => 1,
'inewstickerasset.php' => 1,
'thingdom.php' => 1,
'galdiboletobundle.php' => 1,
'thibaudtwittertwigextensionbundle.php' => 1,
'zenviamodule.php' => 1,
'apicomponent.php' => 1,
'skelgen' => 1,
'ppp.sublime-workspace' => 1,
'uploadutil.php' => 1,
'strutil.php' => 1,
'requestparser.php' => 1,
'paramutil.php' => 1,
'newscooptwitterpluginbundle.php' => 1,
'objectcreator.php' => 1,
'jsoninvoker.php' => 1,
'httpsender.php' => 1,
'classcreator.php' => 1,
'castutil.php' => 1,
'arrayutil.php' => 1,
'thewellcomcontactbundle.php' => 1,
'pirum-license' => 1,
'slim' => 1,
'phpdox.bat' => 1,
'phpdox' => 1,
'fdomdocument.spec' => 1,
'phpab.php' => 1,
'newscoopsmartyextensionspluginbundle.php' => 1,
'installing' => 1,
'helper.overframe.php' => 1,
'execute' => 1,
'config.overframe.php' => 1,
'statreportasset.php' => 1,
'statreport.php' => 1,
'series.php' => 1,
'fixedheaderasset.php' => 1,
'datatablesresponsiveasset.php' => 1,
'datatablesgridview.php' => 1,
'dataseries.php' => 1,
'thracemediabundle.php' => 1,
'thraceformbundle.php' => 1,
'thracedatagridbundle.php' => 1,
'thracecomponentbundle.php' => 1,
'execute.bat' => 1,
'booting.yml' => 1,
'apigeneratorbundle.php' => 1,
'thormeiertransportclientbundle.php' => 1,
'thormeierbreadcrumbbundle.php' => 1,
'thormeiermobiledetectlightbundle.php' => 1,
'twimultidomainlocalebundle.php' => 1,
'laravel-composer' => 1,
'bsd-3-clause-license' => 1,
'redpilllinprosimplereportsbundle.php' => 1,
'bisonlabsakonninbundle.php' => 1,
'bisonlabcommonbundle.php' => 1,
'querybuilderrepositorygeneratorbundle.php' => 1,
'jsonannotationbundle.php' => 1,
'tcreference_1.php' => 1,
'getsetforeignnormalizerbundle.php' => 1,
'doctrinerelationvisualizerbundle.php' => 1,
'skinny.class.php' => 1,
'skinny.i18n.php' => 1,
'tjvmollieidealbundle.php' => 1,
'file.hh' => 1,
'localeroute.hh' => 1,
'group.hh' => 1,
'filter.hh' => 1,
'callbackroute.hh' => 1,
'output.hh' => 1,
'middleware.hh' => 1,
'kernel.hh' => 1,
'input.hh' => 1,
'application.hh' => 1,
'abstractkernel.hh' => 1,
'writer.hh' => 1,
'node.hh' => 1,
'folder.hh' => 1,
'bundle.hh' => 1,
'route.hh' => 1,
'translator.hh' => 1,
'routeresolver.hh' => 1,
'pluralrule.hh' => 1,
'messageloader.hh' => 1,
'messagebundle.hh' => 1,
'localeregistry.hh' => 1,
'localebundle.hh' => 1,
'locale.hh' => 1,
'catalog.hh' => 1,
'outgoingresponseaware.hh' => 1,
'outgoingresponse.hh' => 1,
'mime.hh' => 1,
'message.hh' => 1,
'matcher.hh' => 1,
'router.hh' => 1,
'incomingrequest.hh' => 1,
'abstractvalidator.hh' => 1,
'test.selector.php' => 1,
'selector.inc' => 1,
'view.hh' => 1,
'template.hh' => 1,
'locator.hh' => 1,
'helper.hh' => 1,
'engineview.hh' => 1,
'engine.hh' => 1,
'abstractview.hh' => 1,
'validator.hh' => 1,
'corevalidator.hh' => 1,
'constraintprovider.hh' => 1,
'constraint.hh' => 1,
'validate.hh' => 1,
'urlbuilder.hh' => 1,
'time.hh' => 1,
'str.hh' => 1,
'sanitize.hh' => 1,
'path.hh' => 1,
'number.hh' => 1,
'inflect.hh' => 1,
'format.hh' => 1,
'config.hh' => 1,
'col.hh' => 1,
'xml.hh' => 1,
'stringbuffer.hh' => 1,
'objectcollection.hh' => 1,
'hashmap.hh' => 1,
'arraylist.hh' => 1,
'incomingrequestaware.hh' => 1,
'http.hh' => 1,
'skinny.php' => 1,
'zorbusadminthemebundle.php' => 1,
'arrayable.hh' => 1,
'storageaware.hh' => 1,
'storage.hh' => 1,
'missitem.hh' => 1,
'item.hh' => 1,
'hititem.hh' => 1,
'cache.hh' => 1,
'wiresannotations.hh' => 1,
'wireable.hh' => 1,
'annotation.hh' => 1,
'zorbususerthemebundle.php' => 1,
'zorbuspagebundle.php' => 1,
'zorbusblockbundle.php' => 1,
'zorbuslinkedinbundle.php' => 1,
'cacheable.hh' => 1,
'syncuptest.sh' => 1,
'syncup.sh' => 1,
'not_rsync_up' => 1,
'_deletepreviewfiles.php' => 1,
'webbotcheccker.php' => 1,
'tipimail.php' => 1,
'wikiseo.php' => 1,
'wikiseo.i18n.php' => 1,
'wikiseo.i18n.magic.php' => 1,
'wikiseo.body.php' => 1,
'skinny.template.php' => 1,
'skinny.slim.php' => 1,
'skinny.skin.php' => 1,
'bag.hh' => 1,
'jsonable.hh' => 1,
'cookie.hh' => 1,
'mcryptcipher.hh' => 1,
'subject.hh' => 1,
'observer.hh' => 1,
'listener.hh' => 1,
'event.hh' => 1,
'emitter.hh' => 1,
'emitsevents.hh' => 1,
'loader.hh' => 1,
'detector.hh' => 1,
'logger.hh' => 1,
'dumper.hh' => 1,
'debugger.hh' => 1,
'benchmark.hh' => 1,
'opensslcipher.hh' => 1,
'cipher.hh' => 1,
'macroable.hh' => 1,
'abstractcipher.hh' => 1,
'errorcontroller.hh' => 1,
'controller.hh' => 1,
'action.hh' => 1,
'abstractcontroller.hh' => 1,
'serviceprovider.hh' => 1,
'depository.hh' => 1,
'definition.hh' => 1,
'xmlable.hh' => 1,
'vectorable.hh' => 1,
'stringable.hh' => 1,
'staticcacheable.hh' => 1,
'mutable.hh' => 1,
'mapable.hh' => 1,
'alicacheserver.php' => 1,
'example.mdb' => 1,
'netsuite application developer license agreement' => 1,
'homonoia.php' => 1,
'staffimdtobundle.php' => 1,
'attachmentbuilder.php' => 1,
'stadlineexecutioncachebundle.php' => 1,
'stadlinejsextensionbundle.php' => 1,
'glog_util.php' => 1,
'stackinstancemailerbundle.php' => 1,
'xhprof.inc.php' => 1,
'yandexmetrika.php' => 1,
'metrikabase.php' => 1,
'metrika.php' => 1,
'ssonecmsbundle.php' => 1,
'talos.php' => 1,
'hygieia.php' => 1,
'hestia.php' => 1,
'staffimsplunkbundle.php' => 1,
'cache-manager.php' => 1,
'autoload.example.php' => 1,
'spjsonrpc.php' => 1,
'proxy.example.ini' => 1,
'test_converter.php' => 1,
'converter.class.php' => 1,
'apidoc.xml.dist' => 1,
'ceca.php' => 1,
'firebirdmigration.php' => 1,
'activeresponseasset.php' => 1,
'activeresponse.php' => 1,
'wp-cli-composer-command.php' => 1,
'no-wpmu.php' => 1,
'staffimdatetimebundle.php' => 1,
'staffimtimestampablebundle.php' => 1,
'socialshareevents.php' => 1,
'starkerxpcqrsesbundle.php' => 1,
'rebase.sh' => 1,
'deluntrackedbranch.sh' => 1,
'deltag.sh' => 1,
'addtag.sh' => 1,
'devbundle.php' => 1,
'contactbundle.php' => 1,
'spraedpdfgeneratorbundle.php' => 1,
'buildapidocs.sh' => 1,
'apcprofilerbundle.php' => 1,
'nyx.json.dist' => 1,
'dbmysql.php' => 1,
'startplatzwordpressintegrationbundle.php' => 1,
'soundex.php' => 1,
'wp-commonmark.php' => 1,
'cfvalidator.php' => 1,
'solero.php' => 1,
'wp-deep-links.php' => 1,
'deeplinks.php' => 1,
'lemonrestbundle.php' => 1,
'lemonreportbundle.php' => 1,
'lemoncrudbundle.php' => 1,
'lemonbootstrapbundle.php' => 1,
'lemonappbundle.php' => 1,
'sms-factory.uml' => 1,
'searcher.uml' => 1,
'sf-code.class.php' => 1,
'stampery.inc.php' => 1,
'license.zf' => 1,
'cfvalidatorasset.php' => 1,
'lockdown-wp-admin.php' => 1,
'srozeiosocialsharebundle.php' => 1,
'status.sh' => 1,
'spiritdevcihubpostbundle.php' => 1,
'osteo.yml' => 1,
'tokenmanagerbundle.php' => 1,
'sncapiloggerbundle.php' => 1,
'apiauthenticator.php' => 1,
'abstractfixtureloadbundle.php' => 1,
'abstractfixtureload.php' => 1,
'sample.png' => 1,
'mono.png' => 1,
'everyblock-php-api.php' => 1,
'class-querystring.php' => 1,
'spiritdevoauth2clientbundle.php' => 1,
'spiritdevoauth2serverbundle.php' => 1,
'spiritdevcihubprebundle.php' => 1,
'spiritdevcihubcorebundle.php' => 1,
'spress.php' => 1,
'spiritdevbugreporterbundle.php' => 1,
'spiral.bat' => 1,
'spiral' => 1,
'spiraapplication.php' => 1,
'urlentry.php' => 1,
'generator' => 1,
'filterbuilder.php' => 1,
'spiiicyflightstatsbundle.php' => 1,
'application.config.php.dist' => 1,
'license_vendor' => 1,
'future.php' => 1,
'apidockert.php' => 1,
's4atimeagobundle.php' => 1,
'sprainvalidatorbundle.php' => 1,
'cerb5_webapi.php' => 1,
'sriorestuploadbundle.php' => 1,
'websocket_server.php' => 1,
'processcollection.php' => 1,
'namedchainprocessinterface.php' => 1,
'dependentchainprocessinterface.php' => 1,
'decoratorfactoryinterface.php' => 1,
'decoratorfactory.php' => 1,
'chainrunner.php' => 1,
'chainprocessinterface.php' => 1,
'chainprocessdecorator.php' => 1,
'chaincontext.php' => 1,
'chainbuilder.php' => 1,
'arraychaincontext.php' => 1,
'jquery.easypaginate.js' => 1,
'easypaginate.jquery.json' => 1,
'websocket_client.html' => 1,
'cachemanagerinterface.php' => 1,
'basicoauth.php' => 1,
'docusign.php' => 1,
'bookmark.php' => 1,
'spyritpropeldatagridbundle.php' => 1,
'spyritpropelcrudgeneratorbundle.php' => 1,
'tabcollapsex.php' => 1,
'tabcollapseasset.php' => 1,
'tabcollapse.php' => 1,
'collapsebehavior.php' => 1,
'sputnikpubsubbundle.php' => 1,
'pubsubevents.php' => 1,
'sputniknewsletterbundle.php' => 1,
'batchsubscriberinterface.php' => 1,
'sputnikcachebundle.php' => 1,
'renamebranch.sh' => 1,
'proxybundle.php' => 1,
'sunrise-scenarios.sh' => 1,
'stocarultwitterbundle.php' => 1,
'elasticbundle.php' => 1,
'pff2.iml' => 1,
'run_phpunit.sh' => 1,
'run_phpmd.sh' => 1,
'pre_commit.sh' => 1,
'init-pgsql.sql' => 1,
'init-mysql.sql' => 1,
'doctrine-bootstrap.php' => 1,
'config-testing.php' => 1,
'ckeditor.css' => 1,
'addventurectl.php' => 1,
'xlabpchartbundle.php' => 1,
'stocarulurbanairshipbundle.php' => 1,
'pitechpdodblibbundle.php' => 1,
'key.p12.enc' => 1,
'stocarulfacebookbundle.php' => 1,
'stnwdatepickerbundle.php' => 1,
'avatarbundle.php' => 1,
'flipclock.php' => 1,
'excuseme.php' => 1,
'simusanteuserwidgetbundle.php' => 1,
'cpasimusantesimutoolsbundle.php' => 1,
'cpasimusantesimuresourcebundle.php' => 1,
'cpasimusanteghangoutbundle.php' => 1,
'simusantepfcbundle.php' => 1,
'charcoal.inc.php' => 1,
'ditto.sublime-project' => 1,
'phpunit.unit.xml' => 1,
'issue' => 1,
'tech' => 1,
'bootstrap.integration.php' => 1,
'wp-term-colors.php' => 1,
'soapaction.php' => 1,
'paynl.php' => 1,
'icepay.php' => 1,
'servecontroller.php' => 1,
'changyanwidget.php' => 1,
'stz184captchabundle.php' => 1,
'wp-user-profiles.php' => 1,
'wp-user-groups.php' => 1,
'wp-user-avatars.php' => 1,
'wp-user-activity.php' => 1,
'wp-term-visibility.php' => 1,
'wp-term-meta.php' => 1,
'wp-term-families.php' => 1,
'wp-spider-cache.php' => 1,
'.git_workflow.ini' => 1,
'wp-post-publish-ays.php' => 1,
'wpmn-loader.php' => 1,
'wp-event-calendar.php' => 1,
'wp-comment-humility.php' => 1,
'wp-article-order.php' => 1,
'studiositeapiclientgeneratorbundle.php' => 1,
'conventer.php' => 1,
'studioartlansyngbundle.php' => 1,
'demo_auth.php' => 1,
'strsocialsmsqueuebundle.php' => 1,
'stormssonmultifetchbundle.php' => 1,
'clientside.php' => 1,
'deploy-key.enc' => 1,
'sagextras.php' => 1,
'bootstrap.unit.php' => 1,
'pui.php' => 1,
'blockprefixtrait.php' => 1,
'ssh2bundle.php' => 1,
'contentdivider.php' => 1,
'advent' => 1,
'cloudflare' => 1,
'zebra_curl.php' => 1,
'zebra_session.php' => 1,
'zebra_pagination.php' => 1,
'zebra_mptt.php' => 1,
'zebra_image.php' => 1,
'mimes.json' => 1,
'zebra_form.php' => 1,
'zebra_database.php' => 1,
'sbpushbulletbundle.php' => 1,
'versionsbundle.php' => 1,
'shortcutsbundle.php' => 1,
'facecommanderbundle.php' => 1,
'scripts.sh' => 1,
'schema.sh' => 1,
'pull.sh' => 1,
'doctrinemigrations.sh' => 1,
'doctrinecache.sh' => 1,
'dirs.sh' => 1,
'csfixer.sh' => 1,
'composerupdate.sh' => 1,
'composerinstall.sh' => 1,
'cache.sh' => 1,
'assetsinstall.sh' => 1,
'asseticdump.sh' => 1,
'nametrait.php' => 1,
'mangojsonapibundle.php' => 1,
'modeltrait.php' => 1,
'pdb.php' => 1,
'changelog.config.php' => 1,
'stfalconportfoliobundle.php' => 1,
'stfalconpaymentbundle.php' => 1,
'stfalconpagebundle.php' => 1,
'stfalconnewsbundle.php' => 1,
'cron.conf' => 1,
'stfalconshippingbundle.php' => 1,
'stfalconabtestbundle.php' => 1,
'stewejsi18nbundle.php' => 1,
'stevninjainvoicebundle.php' => 1,
'stevlistafirmebundle.php' => 1,
'stevgeonamesbundle.php' => 1,
'footestcase.php' => 1,
'barsuite.xml' => 1,
'process_aweber.php' => 1,
'class-php-ico.php' => 1,
'aweberclass.php' => 1,
'api-guide' => 1,
'menubrowser.php' => 1,
'phpcs.xml.sample' => 1,
'phpcs-vip.xml.sample' => 1,
'inventory-banner.jpg' => 1,
'calendar-helper-banner.jpg' => 1,
'sladbookingbundle.php' => 1,
'mustang.engine' => 1,
'mustache.engine' => 1,
'handlebars.engine' => 1,
'forecast' => 1,
'newpassword' => 1,
'laravelmodelbehavior.php' => 1,
'.gitattributes.layout' => 1,
'unusedcode.xml' => 1,
'francium.log' => 1,
'sesshin' => 1,
'soerenmartiuswishlistbundle.php' => 1,
'digitalshiftmailboxpersistencebundle.php' => 1,
'digitalshiftmailboxformbundle.php' => 1,
'digitalshiftmailboxconnectionbundle.php' => 1,
'date_time_picker-v5.php' => 1,
'date_time_picker-v4.php' => 1,
'date_time_picker-v3.php' => 1,
'acf-date_time_picker.php' => 1,
'jupiter' => 1,
'requirements-test' => 1,
'parallel-phpunit' => 1,
'exelreaderinterface.php' => 1,
'exel.php' => 1,
'hybridauthcomponent.php' => 1,
'duallistboxasset.php' => 1,
'left-pad.php' => 1,
'receive.php' => 1,
'config.xsd' => 1,
'snowcapyamlfixturesbundle.php' => 1,
'snowcapogonebundle.php' => 1,
'ogonemanager.php' => 1,
'ogoneevents.php' => 1,
'snowcapimbundle.php' => 1,
'snowcapi18nbundle.php' => 1,
'snowcapelasticabundle.php' => 1,
'snowcapcorebundle.php' => 1,
'snowcapcachebundle.php' => 1,
'snowcapbootstrapbundle.php' => 1,
'creole.php' => 1,
'sample-code' => 1,
'whoops.php' => 1,
'soilnotificationbundle.php' => 1,
'solilokiamsummernotebundle.php' => 1,
'httprediscache.php' => 1,
'installerwrapper.php' => 1,
'disable-comments-mu.php' => 1,
'solano.yml' => 1,
'solano-phpunit' => 1,
'bare-composer.json' => 1,
'bare-readme' => 1,
'soilusertrackbundle.php' => 1,
'soilsmserbundle.php' => 1,
'soilrdfpersistencebundle.php' => 1,
'soilqueuehttpendpointbundle.php' => 1,
'soilonsitenotificationbundle.php' => 1,
'soileventbundle.php' => 1,
'captchaasset.php' => 1,
'soildiscoverbundle.php' => 1,
'soilcorsrequesthandlerbundle.php' => 1,
'soilcommentsdigestbundle.php' => 1,
'soilackservicebundle.php' => 1,
'eloquent-command.php' => 1,
'softlogouserbundle.php' => 1,
'softlogoshopbundle.php' => 1,
'softlogoproductbundle.php' => 1,
'softlogoportfoliobundle.php' => 1,
'softlogonewsbundle.php' => 1,
'softlogocustomerbundle.php' => 1,
'softlogocmsbundle.php' => 1,
'softflygeneratorbundle.php' => 1,
'seto-mini.ttf' => 1,
'snowcapadminbundle.php' => 1,
'twig.class.php' => 1,
'moneta-api.ini' => 1,
'deliverer.php' => 1,
'cache-faculty-journal-menus.sql' => 1,
'enrollment-info-ui-tweaks.js' => 1,
'embedded-documentation.js' => 1,
'discussion-permalinks.js' => 1,
'show-rubrics.php' => 1,
'cache-rubrics.php' => 1,
'cache-and-show-rubrics.js' => 1,
'bookmarklet.php' => 1,
'bookmarklet.js' => 1,
'auto-open-feedback.js' => 1,
'wpup' => 1,
'intro.gif' => 1,
'smsupapibundle.php' => 1,
'smoyaomniatabundle.php' => 1,
'smcanvaslib' => 1,
'makerlabspagerbundle.php' => 1,
'smoyacustomchoicebundle.php' => 1,
'smoyaassetmanagementbundle.php' => 1,
'gnu-gpl' => 1,
'installcheck.php' => 1,
'aplbundle.php' => 1,
'smith981securitybundle.php' => 1,
'smith981newsboxbundle.php' => 1,
'smith981crudgeneratorbundle.php' => 1,
'smiriktaggablebundle.php' => 1,
'smirikpropelserializerbundle.php' => 1,
'smirikpropeladminbundle.php' => 1,
'smirikconfigbundle.php' => 1,
'faculty-journal.php' => 1,
'student-loader.php' => 1,
'monolog.php' => 1,
'oauthnegotiator.php' => 1,
'hookagent.php' => 1,
'dotarrayfilter.php' => 1,
'cyberappuploaderbundle.php' => 1,
'cyberapptreechoicebundle.php' => 1,
'cyberappselect2bundle.php' => 1,
'twofactorforeveryone.png' => 1,
'snapcmsmodule.php' => 1,
'microphp.php' => 1,
'microphp.min.php' => 1,
'cloud-zoom.js' => 1,
'cloud-zoom.css' => 1,
'smurfyasseticcssbundleimagesbundle.php' => 1,
'asaayerscrowdbundle.php' => 1,
'templates.js.php' => 1,
'canvas-custom-prefs.sql' => 1,
'templates-schema.sql' => 1,
'templates-loader.js' => 1,
'template-copy.php' => 1,
'assignments api.csv' => 1,
'color-schedule.js.php' => 1,
'color-schedule.css.php' => 1,
'stmarks-branding.css' => 1,
'organize-user-enrollments.css' => 1,
'lock-notifications.js.php' => 1,
'lock-notifications.css' => 1,
'navigation-menu.js.php' => 1,
'navbar.css' => 1,
'menu-loader.js' => 1,
'click.php' => 1,
'solispauwelsthemespackbundle.php' => 1,
'meme.phar' => 1,
'naming.xml' => 1,
'echo-js-lazy-load.php' => 1,
'writer.sql' => 1,
'commentswidget.php' => 1,
'spamjs_book.iml' => 1,
'project_structure' => 1,
'package_structure' => 1,
'libraries' => 1,
'isjs' => 1,
'foojs' => 1,
'definejs' => 1,
'glossary' => 1,
'super-simple-events.php' => 1,
'simple-google-news-sitemap.php' => 1,
'wpcom-helper.php' => 1,
'disable-xml-rpc-fully.php' => 1,
'http-status-check' => 1,
'custom-post-type-rss-feed.php' => 1,
'built-in-taxos-cpt.php' => 1,
'advanced-nav-cache.php' => 1,
'repairtags.php' => 1,
'soyukaseedbundle.php' => 1,
'phpsemver.xml' => 1,
'docker-compose-dev.yml' => 1,
'svntime.php' => 1,
'revisions.csv' => 1,
'months.csv' => 1,
'example.bat' => 1,
'cleaned_blocks.csv' => 1,
'blocks.csv' => 1,
'php7to5' => 1,
'ssl-certificate-chain-resolver' => 1,
'html2text.php' => 1,
'htmlpurifier.safe-includes.php' => 1,
'design.xml' => 1,
'controversial.xml' => 1,
'codesize.xml' => 1,
'cleancode.xml' => 1,
'composer-package-update-checker.php' => 1,
'composer-package-update-checker' => 1,
'composerupdatechecker.php' => 1,
'painfreereleases' => 1,
'gitpolicy' => 1,
'analyser' => 1,
'.gitpolicy.yml' => 1,
'transipclient.php' => 1,
'wideimage.php' => 1,
'htmlpurifier.path.php' => 1,
'specgenstateworkflowspecgenbundle.php' => 1,
'htmlpurifier.kses.php' => 1,
'htmlpurifier.includes.php' => 1,
'htmlpurifier.func.php' => 1,
'htmlpurifier.composer.php' => 1,
'htmlpurifier.autoload.php' => 1,
'htmlpurifier.auto.php' => 1,
'polymerasset.php' => 1,
'headerpanel.php' => 1,
'static.tpl' => 1,
'login.tpl' => 1,
'header.tpl' => 1,
'footer.tpl' => 1,
'component.tpl' => 1,
'project.kwi' => 1,
'spritify.php' => 1,
'global_defines.sample.php' => 1,
'pvp_api.php' => 1,
'sonatradoctrineextensionsbundle.php' => 1,
'sonatrasessionbundle.php' => 1,
'sonatrasecuritybundle.php' => 1,
'reachableroleevents.php' => 1,
'organizationaltypes.php' => 1,
'identityretrievalevents.php' => 1,
'aclmanipulatorevents.php' => 1,
'sonatraresourcebundle.php' => 1,
'resourcestatutes.php' => 1,
'resourceliststatutes.php' => 1,
'sonatramailerbundle.php' => 1,
'mailtypes.php' => 1,
'sonatragluonbundle.php' => 1,
'sonatraformextensionsbundle.php' => 1,
'sonatradoctrineconsolebundle.php' => 1,
'spoolemailstatus.php' => 1,
'sonatradefaultvaluebundle.php' => 1,
'sonatrabootstrapbundle.php' => 1,
'sonatrablockbundle.php' => 1,
'sonatraajaxbundle.php' => 1,
'ajaxevents.php' => 1,
'missingscmplugin.php' => 1,
'sonatajquerybundle.php' => 1,
'sonatatranslationbundle.php' => 1,
'sonatapropeladminbundle.php' => 1,
'sonatamarkitupbundle.php' => 1,
'sonataintlbundle.php' => 1,
'sonataeasyextendsbundle.php' => 1,
'sonataadminsearchbundle.php' => 1,
'sonatraswiftmailerdoctrinebundle.php' => 1,
'sntoolboxbundle.php' => 1,
'fs_directory.php' => 1,
'sopinetsimplepointbundle.php' => 1,
'fs_dialplan.php' => 1,
'fs_curl.php' => 1,
'fs_configuration.php' => 1,
'fs_chatplan.php' => 1,
'fs_cdr.php' => 1,
'dialplan_importer.php' => 1,
'sopinetchatbundle.php' => 1,
'sopinetuserbundle.php' => 1,
'sopinetuserpreferencesbundle.php' => 1,
'sopinetusernotificationsbundle.php' => 1,
'sopinetuploadmagicbundle.php' => 1,
'sopinettimelinebundle.php' => 1,
'sopinettemplatesbadmin2bundle.php' => 1,
'sopinetlogbundle.php' => 1,
'regionutils.php' => 1,
'help.es' => 1,
'sopinetflashmessagesbundle.php' => 1,
'sopinetcolorizebundle.php' => 1,
'sopinetbootstrapextendbundle.php~' => 1,
'sopinetbootstrapextendbundle.php' => 1,
'sopinetautologinbundle.php' => 1,
'sopinetaboutmagicbundle.php' => 1,
'sopinetuploadfilesbundle.php' => 1,
'sopinetgcmbundle.php' => 1,
'gcmevents.php' => 1,
'sopinetapihelperbundle.php' => 1,
'sopinetadminbundle.php' => 1,
'improverangevalidator.php' => 1,
'regionvalidator.php' => 1,
'soapservice.php' => 1,
'class.logsys.php' => 1,
'phpaccess.php' => 1,
'propertyaccessextractorinterface.php' => 1,
'csrftokenmanager.php' => 1,
'authenticationevents.php' => 1,
'securitybundle.php' => 1,
'routecollectionbuilder.php' => 1,
'requestcontextawareinterface.php' => 1,
'compiledroute.php' => 1,
'httpmessagefactoryinterface.php' => 1,
'httpfoundationfactoryinterface.php' => 1,
'propertytypeextractorinterface.php' => 1,
'propertylistextractorinterface.php' => 1,
'propertyinfoextractorinterface.php' => 1,
'propertyinfoextractor.php' => 1,
'propertydescriptionextractorinterface.php' => 1,
'propertypathiteratorinterface.php' => 1,
'abstractguardauthenticator.php' => 1,
'propertypathiterator.php' => 1,
'propertypathinterface.php' => 1,
'propertypathbuilder.php' => 1,
'propertypath.php' => 1,
'propertyaccessorinterface.php' => 1,
'propertyaccessorbuilder.php' => 1,
'processutils.php' => 1,
'processbuilder.php' => 1,
'phpprocess.php' => 1,
'phpexecutablefinder.php' => 1,
'inputstream.php' => 1,
'executablefinder.php' => 1,
'binaryonfuncoverload.php' => 1,
'csrftokenmanagerinterface.php' => 1,
'guardauthenticatorhandler.php' => 1,
'php70.php' => 1,
'templatenameparser.php' => 1,
'appvariable.php' => 1,
'translatorbaginterface.php' => 1,
'pluralizationrules.php' => 1,
'metadataawareinterface.php' => 1,
'messageselector.php' => 1,
'messagecatalogueinterface.php' => 1,
'messagecatalogue.php' => 1,
'loggingtranslator.php' => 1,
'identitytranslator.php' => 1,
'datacollectortranslator.php' => 1,
'templatereferenceinterface.php' => 1,
'templatereference.php' => 1,
'templatenameparserinterface.php' => 1,
'streamingengineinterface.php' => 1,
'guardauthenticatorinterface.php' => 1,
'phpengine.php' => 1,
'delegatingengine.php' => 1,
'.travis.php' => 1,
'stopwatchperiod.php' => 1,
'stopwatchevent.php' => 1,
'stopwatch.php' => 1,
'section.php' => 1,
'serializerawaretrait.php' => 1,
'securityevents.php' => 1,
'parameterbagutils.php' => 1,
'firewallmapinterface.php' => 1,
'firewallmap.php' => 1,
'accessmapinterface.php' => 1,
'accessmap.php' => 1,
'binarynofuncoverload.php' => 1,
'php56.php' => 1,
'constraint.php' => 1,
'formrendererinterface.php' => 1,
'reversedtransformer.php' => 1,
'resolvedformtypeinterface.php' => 1,
'resolvedformtypefactoryinterface.php' => 1,
'resolvedformtypefactory.php' => 1,
'resolvedformtype.php' => 1,
'requesthandlerinterface.php' => 1,
'preloadedextension.php' => 1,
'nativerequesthandler.php' => 1,
'formview.php' => 1,
'formtypeinterface.php' => 1,
'formtypeguesserinterface.php' => 1,
'formtypeguesserchain.php' => 1,
'formtypeextensioninterface.php' => 1,
'formrendererengineinterface.php' => 1,
'submitbuttonbuilder.php' => 1,
'formrenderer.php' => 1,
'formregistryinterface.php' => 1,
'formregistry.php' => 1,
'formfactoryinterface.php' => 1,
'formfactorybuilderinterface.php' => 1,
'formfactorybuilder.php' => 1,
'formfactory.php' => 1,
'formextensioninterface.php' => 1,
'formevents.php' => 1,
'formerroriterator.php' => 1,
'formerror.php' => 1,
'formconfiginterface.php' => 1,
'formconfigbuilderinterface.php' => 1,
'submitbutton.php' => 1,
'submitbuttontypeinterface.php' => 1,
'php55arraycolumn.php' => 1,
'icudata.php' => 1,
'php55.php' => 1,
'php54.php' => 1,
'mbstring.php' => 1,
'grapheme.php' => 1,
'iconv.php' => 1,
'optionsresolver.php' => 1,
'notfoundactivationstrategy.php' => 1,
'monologbundle.php' => 1,
'ldapclientinterface.php' => 1,
'ldapclient.php' => 1,
'icuregionbundle.php' => 1,
'iculocalebundle.php' => 1,
'iculanguagebundle.php' => 1,
'icucurrencybundle.php' => 1,
'acceptheader.php' => 1,
'urisigner.php' => 1,
'terminableinterface.php' => 1,
'kernelinterface.php' => 1,
'serverbag.php' => 1,
'responseheaderbag.php' => 1,
'requeststack.php' => 1,
'requestmatcherinterface.php' => 1,
'requestmatcher.php' => 1,
'iputils.php' => 1,
'headerbag.php' => 1,
'expressionrequestmatcher.php' => 1,
'binaryfileresponse.php' => 1,
'apacherequest.php' => 1,
'acceptheaderitem.php' => 1,
'templateiterator.php' => 1,
'constraintvalidator.php' => 1,
'formbuilderinterface.php' => 1,
'tadckasitemapbundle.php' => 1,
'urls.sql' => 1,
'endiciaapi.php' => 1,
'tahoecrudbundle.php' => 1,
'tahoecredentialbundle.php' => 1,
'countries.json' => 1,
'out.php' => 1,
'outtest.php' => 1,
'tadckatreebundle.php' => 1,
'textinformation.php' => 1,
'tadckatextbundle.php' => 1,
'tadckageneratorbundle.php' => 1,
'modelmanagerinfo.php' => 1,
'tadckasitemapevents.php' => 1,
'tadckaroutingbundle.php' => 1,
'newscoopgithublatestcommitsbundle.php' => 1,
'tadckareporterbundle.php' => 1,
'tadckapaginatorbundle.php' => 1,
'tadckaobjectratingbundle.php' => 1,
'objectratinginfo.php' => 1,
'tadckanoticemanagerbundle.php' => 1,
'noticetype.php' => 1,
'tadckamapperbundle.php' => 1,
'tadckajstreebundle.php' => 1,
'filedownloader.php' => 1,
'tadckaattributesbundle.php' => 1,
'tadckaaddressbundle.php' => 1,
'psr-police' => 1,
'php-cs-fixer.pre-commit.php' => 1,
'takeitamphtmlbundle.php' => 1,
'newscoopcommunitytickerbundle.php' => 1,
'propelwebprofilerserviceprovider.php' => 1,
'automate.config' => 1,
'finzip.php' => 1,
'tconverter.class.php' => 1,
'routerintern.interface.php' => 1,
'routerintern.class.php' => 1,
'routerext.php' => 1,
'errors.class.php' => 1,
'client.json' => 1,
'model.interface.php' => 1,
'loadbase.php' => 1,
'controller.interface.php' => 1,
'controller.class.php' => 1,
'automate.php' => 1,
'automate.json' => 1,
'bdados.php' => 1,
'locks.log' => 1,
'bdadospdo.php' => 1,
'cs' => 1,
'tambur.php' => 1,
'weather.php' => 1,
'toby.php' => 1,
'rackem.php' => 1,
'tamagotipsmanagerbundle.php' => 1,
'tamagofeedrenderbundle.php' => 1,
'cccemailtemplatebundle.php' => 1,
'install_v8js' => 1,
'tab.php' => 1,
'materializecustomasset.php' => 1,
'fab.php' => 1,
'basewidgettrait.php' => 1,
'daydream.php' => 1,
'propellogger.php' => 1,
'constraintvalidatorfactoryinterface.php' => 1,
's2bcrawlerbundle.php' => 1,
'inputrange.php' => 1,
'syselevenpowerdnsbundle.php' => 1,
'mysqlmyisamdriver.php' => 1,
'syrmawebcontainerbundle.php' => 1,
'synoliafullcontactbundle.php' => 1,
'readonlybehavior.php' => 1,
'synatreeasset.php' => 1,
'dynamicrelations.php' => 1,
'synaqzasabundle.php' => 1,
'synaqcurlbundle.php' => 1,
'phpunit.shippable.xml' => 1,
'symtoockeditorbundle.php' => 1,
'acmesymfonyanbundle.php' => 1,
'admingeneratorformextensionsbundle.php' => 1,
'fullcalendarbundle.php' => 1,
'admingeneratorformbundle.php' => 1,
'check_cs' => 1,
'unescaper.php' => 1,
'inline.php' => 1,
'webprofilerbundle.php' => 1,
'validatorbuilderinterface.php' => 1,
'validatorbuilder.php' => 1,
'objectinitializerinterface.php' => 1,
'groupsequenceproviderinterface.php' => 1,
'constraintviolationlistinterface.php' => 1,
'constraintviolationlist.php' => 1,
'constraintviolationinterface.php' => 1,
'constraintvalidatorinterface.php' => 1,
'pagemediasetbundle.php' => 1,
'sessao.php' => 1,
'propeldatacollector.php' => 1,
'wunderliststrategy.php' => 1,
'docini' => 1,
'edmodostrategy.php' => 1,
'tabernicolajukeclouduserbundle.php' => 1,
'tabernicolajukecloudbundle.php' => 1,
'tabernicolajukecloudadminbundle.php' => 1,
'tabernicolablogbundle.php' => 1,
'ezreal-0.html' => 1,
'tabbi89commanderbundle.php' => 1,
'twigextrabundle.php' => 1,
'phpunit.xml.coverage' => 1,
'tpsolariumextensionsbundle.php' => 1,
't73biztranslocationbundle.php' => 1,
'changleog' => 1,
'wakatimestrategy.php' => 1,
'createtable.php' => 1,
'ultraregstrategy.php' => 1,
'trellostrategy.php' => 1,
'timelystrategy.php' => 1,
'slackstrategy.php' => 1,
'harveststrategy.php' => 1,
'frecklestrategy.php' => 1,
'dropboxstrategy.php' => 1,
'campaignmonitorstrategy.php' => 1,
'basecampstrategy.php' => 1,
'ignore.gitignore' => 1,
'entityexplorerbundle.php' => 1,
'szummediauploadbundle.php' => 1,
'szumadministrationpanelbundle.php' => 1,
'auto-login.php' => 1,
'formconfigbuilder.php' => 1,
'datatransformerinterface.php' => 1,
'tca.php' => 1,
'tagcloudall.php' => 1,
'keriodirectoryapi.php' => 1,
'keriocontrolapi.php' => 1,
'kerioconnectapi.php' => 1,
'superfeedr.php' => 1,
'curl_readme' => 1,
'debug-tests.sh' => 1,
'.blackfire.yml' => 1,
'superreal.png' => 1,
'sunraturbosmsbundle.php' => 1,
'wishlistmember.php' => 1,
'widgetadvertisement.php' => 1,
'widgetadvertisement .ss' => 1,
'tagcloudall.ss' => 1,
'sidetext.png' => 1,
'kerioworkspaceapi.php' => 1,
'sidetextwidget.ss' => 1,
'sidetextwidget.php' => 1,
'richadvertisement.ss' => 1,
'richadvertisement.php' => 1,
'quote.ss' => 1,
'quote.php' => 1,
'quicklinks.ss' => 1,
'quicklinks.php' => 1,
'featuredvideowidget.ss' => 1,
'featuredvideowidget.php' => 1,
'latestpagesvisitedwidget.ss' => 1,
'latestpagesvisitedwidget.php' => 1,
'latestblogentries.ss' => 1,
'keriooperatorapi.php' => 1,
'samepageapi.php' => 1,
'headlines.ss' => 1,
'effect.js' => 1,
'ant-crc32.jar' => 1,
'ajaxfileuploadcomponent.php' => 1,
'graphqlbundle.php' => 1,
'graphql.php' => 1,
'uploadbutton.js' => 1,
'swf.js' => 1,
'storage.js' => 1,
'sound.js' => 1,
'sharedobject.js' => 1,
'sb.js' => 1,
'js1_5.js' => 1,
'ie6.js' => 1,
'flashgate.js' => 1,
'developer.js' => 1,
'supertaggearmanbundle.php' => 1,
'cookies.js' => 1,
'bookmarklets.js' => 1,
'uploadbutton.swf' => 1,
'surebert.swf' => 1,
'flashgate.swf' => 1,
'neostag.php' => 1,
'openssltools.php' => 1,
'can.php' => 1,
'aes.php' => 1,
'limp.php' => 1,
'shared_host_install' => 1,
'recurringsubscription.php' => 1,
'paypalrecurring.php' => 1,
'workload.php' => 1,
'latestblogentries.php' => 1,
'headlines.php' => 1,
'paginate.standalone.php' => 1,
'factr.php' => 1,
'mobiledetectbundle.php' => 1,
'suncatadminpageboardbundle.php' => 1,
'config.ini-dist' => 1,
'.htaccess-dist' => 1,
'teamleader.php' => 1,
'sumoforkclass.php' => 1,
'sumocodersframeworkuserbundle.php' => 1,
'sumocodersframeworksettingsbundle.php' => 1,
'settingsmanager.php' => 1,
'sumocodersframeworksearchbundle.php' => 1,
'sumocodersframeworkexamplebundle.php' => 1,
'sumocodersframeworkerrorbundle.php' => 1,
'sumocodersframeworkcorebundle.php' => 1,
'.phpbench.dist' => 1,
'applicationextra.php' => 1,
'suluroutebundle.php' => 1,
'suluqrcodebundle.php' => 1,
'sululdapbundle.php' => 1,
'suludeveloperbundle.php' => 1,
'phpffmpegbundle.php' => 1,
'gen_keys.php' => 1,
'encrypt_cls.php' => 1,
'encrypt.php' => 1,
'encoding2.php' => 1,
'encoding1.php' => 1,
'encoded.php' => 1,
'worker_script' => 1,
'supervisor-suitcoda.conf' => 1,
'weatherundergroundbundle.php' => 1,
'libravatar-replace.php' => 1,
'didyouknow.ss' => 1,
'zendaclserviceprovider.php' => 1,
'didyouknow.php' => 1,
'currencyconverterwidget.ss' => 1,
'currencyconverterwidget.php' => 1,
'childblogentries.ss' => 1,
'childblogentries.php' => 1,
'upgradesilverstripe.php' => 1,
'replacementdata.php' => 1,
'reset.sh' => 1,
'index.php.removethispartforwindows' => 1,
'_ss_environment.php.example' => 1,
'upgradedocs' => 1,
'zendsessionserviceprovider.php' => 1,
'zendauthenticationserviceprovider.php' => 1,
'webprofilercontrollerprovider.php' => 1,
'.vendor.png' => 1,
'restserviceprovider.php' => 1,
'restevents.php' => 1,
'restevent.php' => 1,
'ormserviceprovider.php' => 1,
'managerregistryserviceprovider.php' => 1,
'dbalserviceprovider.php' => 1,
'crudevents.php' => 1,
'crudevent.php' => 1,
'pimpleawareinterface.php' => 1,
'pimpleawareeventdispatcher.php' => 1,
'pimpleaware.php' => 1,
'phar-compiler.xsd' => 1,
'v.php' => 1,
'paginate.php' => 1,
'unnoyandexmapsbundle.php' => 1,
'block_helper.php' => 1,
'clickableinterface.php' => 1,
'metadatainterface.php' => 1,
'callbackslugifier.php' => 1,
'cmfsimplecmsbundle.php' => 1,
'suggestionproviderinterface.php' => 1,
'sitemapawareinterface.php' => 1,
'seoawaretrait.php' => 1,
'seoawareinterface.php' => 1,
'cmfseobundle.php' => 1,
'alternatelocaleproviderinterface.php' => 1,
'cmfsearchbundle.php' => 1,
'cmfroutingbundle.php' => 1,
'cmfroutingautobundle.php' => 1,
'quietfactory.php' => 1,
'cmfmenubundle.php' => 1,
'mediamanagerinterface.php' => 1,
'package_template.xml' => 1,
'hierarchyinterface.php' => 1,
'cmfmediabundle.php' => 1,
'binaryinterface.php' => 1,
'cmfcorebundle.php' => 1,
'cmfcontentbundle.php' => 1,
'jack' => 1,
'cmfblockbundle.php' => 1,
'symfonycmfroutingextrabundle.php' => 1,
'urigeneratorinterface.php' => 1,
'urigenerator.php' => 1,
'uricontextcollectionbuilder.php' => 1,
'uricontextcollection.php' => 1,
'uricontext.php' => 1,
'slugifierinterface.php' => 1,
'sl_si.csv' => 1,
'routingautoevents.php' => 1,
'bufferinglogger.php' => 1,
'callbacktransformer.php' => 1,
'buttontypeinterface.php' => 1,
'buttonbuilder.php' => 1,
'abstractrendererengine.php' => 1,
'lockhandler.php' => 1,
'immutableeventdispatcher.php' => 1,
'containerawareeventdispatcher.php' => 1,
'abstracturielement.php' => 1,
'containerawareeventmanager.php' => 1,
'taggedcontainerinterface.php' => 1,
'resettablecontainerinterface.php' => 1,
'expressionlanguageprovider.php' => 1,
'definitiondecorator.php' => 1,
'cssselectorconverter.php' => 1,
'post' => 1,
'consoleevents.php' => 1,
'resourcecheckerinterface.php' => 1,
'resourcecheckerconfigcachefactory.php' => 1,
'resourcecheckerconfigcache.php' => 1,
'filelocatorinterface.php' => 1,
'configcacheinterface.php' => 1,
'configcachefactoryinterface.php' => 1,
'configcachefactory.php' => 1,
'wincacheclassloader.php' => 1,
'doctrineprovider.php' => 1,
'urlpackage.php' => 1,
'pathpackage.php' => 1,
'packages.php' => 1,
'packageinterface.php' => 1,
'tokenproviderinterface.php' => 1,
'defunctroutehandlerinterface.php' => 1,
'vellozziurlshortenerbundle.php' => 1,
'yellowcube.install' => 1,
'syph' => 1,
'sycamorepostcodeanywherebundle.php' => 1,
'sycamorefreespeebundle.php' => 1,
'sycamorecarwebbundle.php' => 1,
'dropzoneassets.php' => 1,
'ecommerceassets.php' => 1,
'wechatshareaddr.php' => 1,
'swoopsterobjectmanagerbundle.php' => 1,
'gpl-2.0-license' => 1,
'yellowcube.rules_defaults.inc' => 1,
'yellowcube.rules.inc' => 1,
'yellowcube.module' => 1,
'yellowcube.jobs.inc' => 1,
'yellowcube.info' => 1,
'sdstripebundle.php' => 1,
'yellowcube.client.inc' => 1,
'neo4juserbundle.php' => 1,
'swismoonphasebundle.php' => 1,
'swisgoogleanalyticsbundle.php' => 1,
'swisdatabaseextrabundle.php' => 1,
'swisannotationextrabundle.php' => 1,
'curlerarray.php' => 1,
'license.mb' => 1,
'sweikenbredismqbundle.php' => 1,
'swarrotbundle.php' => 1,
'y.php' => 1,
'migrace.php' => 1,
'clanky' => 1,
'flosytwitterbundle.php' => 1,
'symboobootstrapbundle.php' => 1,
'conflictresolverinterface.php' => 1,
'chainrouterinterface.php' => 1,
'autoroutemanager.php' => 1,
'versatilegeneratorinterface.php' => 1,
'routereferrersreadinterface.php' => 1,
'routereferrersinterface.php' => 1,
'routeobjectinterface.php' => 1,
'redirectrouteinterface.php' => 1,
'providerbasedgenerator.php' => 1,
'pagedrouteproviderinterface.php' => 1,
'pagedroutecollection.php' => 1,
'lazyroutecollection.php' => 1,
'contentrepositoryinterface.php' => 1,
'contentawaregenerator.php' => 1,
'chainedrouterinterface.php' => 1,
'chainrouter.php' => 1,
'symeditblogbundle.php' => 1,
'chainroutecollection.php' => 1,
'cmfresourcerestbundle.php' => 1,
'cmfresourcebundle.php' => 1,
'repositoryregistryinterface.php' => 1,
'cmfcreatebundle.php' => 1,
'cmfblogbundle.php' => 1,
'symfoniansadminbundle.php' => 1,
'symeditwidgetbundle.php' => 1,
'symeditthemebundle.php' => 1,
'symeditsitemapbundle.php' => 1,
'symeditshortcodebundle.php' => 1,
'symeditmenubundle.php' => 1,
'symeditmediabundle.php' => 1,
'symediteventsbundle.php' => 1,
'pingdom.css' => 1,
'runbehat' => 1,
'smilingplantspagerbundle.php' => 1,
'bootstrapfakeasset.php' => 1,
'yamilovssypexgeobundle.php' => 1,
'yamikocacheadministrationbundle.php' => 1,
'yamikobasicpagesbundle.php' => 1,
'example2_object.php' => 1,
'example1_create.php' => 1,
'example0_intro.php' => 1,
'samples' => 1,
'config.json.example' => 1,
'googletagmanagerbundle.php' => 1,
'xynnnblacklistedemailvalidatorbundle.php' => 1,
'xxtea.php' => 1,
'pregfile.php' => 1,
'jsxs.php' => 1,
'minput.php' => 1,
'herosphpv2.0.chm' => 1,
'peter.php' => 1,
'qqvalidator.php' => 1,
'mobilevalidator.php' => 1,
'dialog.css' => 1,
'customasset.php' => 1,
'stflagiconcssbundle.php' => 1,
'rbac.sql' => 1,
'emoji.php' => 1,
'templateserviceprovider.php' => 1,
'uncleemptymaintenancebundle.php' => 1,
'update-modules.sh' => 1,
'tacticianmiddlewarebundle.php' => 1,
'aweapp.php' => 1,
'constants.enc.yamoney' => 1,
'bump_version.sh' => 1,
'xthiagoformextrabundle.php' => 1,
'lackeyfile.php' => 1,
'qtranslate_services.php' => 1,
'qtranslate_options.php' => 1,
'qtranslate_hooks.php' => 1,
'qtranslate_frontend.php' => 1,
'qtranslate_core.php' => 1,
'qtranslate_compatibility.php' => 1,
'qtranslate.php' => 1,
'i18n-config.json' => 1,
'multilingual-press.php' => 1,
'breadcrumbsnode.php' => 1,
'breadcrumbsbundle.php' => 1,
'breadcrumbsbuilder.php' => 1,
'txt.thanks' => 1,
'turkish.php' => 1,
'enumbundle.php' => 1,
'phpunit-local.xml' => 1,
'yasiekzrouterbundle.php' => 1,
'readme.pl' => 1,
'yasiekzformbundle.php' => 1,
'yasiekzvideojsbundle.php' => 1,
'milight.php' => 1,
'jquery.bt.min.js' => 1,
'jquery.bt.js' => 1,
'jquery.bt.css' => 1,
'yanyabosymfonybundle.php' => 1,
'edropzone.php' => 1,
'dependencyinjection.json' => 1,
'yokaiizanamibundle.php' => 1,
'izanamievents.php' => 1,
'imagemodule.php' => 1,
'screen1.jpg' => 1,
'qtranslate_widget.php' => 1,
'esperantoassetsbundle.php' => 1,
'esperantoshopbundle.php' => 1,
'esperantosettingbundle.php' => 1,
'esperantosearchbundle.php' => 1,
'esperantoreferencebundle.php' => 1,
'esperantoprojectbundle.php' => 1,
'esperantopagebundle.php' => 1,
'esperantonewsletterbundle.php' => 1,
'esperantonewsbundle.php' => 1,
'esperantomediabundle.php' => 1,
'esperantodownloadbundle.php' => 1,
'esperantocontentbundle.php' => 1,
'esperantocategorybundle.php' => 1,
'esperantocalendarbundle.php' => 1,
'esperantoadminbundle.php' => 1,
'esperantotestingbundle.php' => 1,
'octoguard.config.dist' => 1,
'gpg-mailgate.php' => 1,
'grumphp.sh' => 1,
'cs-fixer.sh' => 1,
'codecept.sh' => 1,
'tagbundle.php' => 1,
'xphereonetimeaccessbundle.php' => 1,
'test.xar' => 1,
'boot.pth' => 1,
'project.pth' => 1,
'integration.ini' => 1,
'mysqlcontroller.php' => 1,
'xolaelasticsearchproxybundle.php' => 1,
'esperantosliderbundle.php' => 1,
'esperantouserbundle.php' => 1,
'previewasset.php' => 1,
'producerchangesv1.patch' => 1,
'jquery.fullscreen.js' => 1,
'jquery.fullscreen.css' => 1,
'xsolveunitskelgenbundle.php' => 1,
'xsolvegoogleauthbundle.php' => 1,
'xsolvecookieacknowledgementbundle.php' => 1,
'wtw.phar' => 1,
'wtw-inline.phar' => 1,
'box-inline.json' => 1,
'shone.phar' => 1,
'xpress' => 1,
'license_lbp' => 1,
'svg-edit-2-6-patch-for-xrowsvg.diff' => 1,
'odata.ini' => 1,
'config.php.append' => 1,
'simplehtmldomnode.php' => 1,
'xrowmetadatabundle.php' => 1,
'anychart_eula.pdf' => 1,
'xrowgisbundle.php' => 1,
'xrowsyliusbundle.php' => 1,
'xrowrestbundle.php' => 1,
'xrowjbpmbundle.php' => 1,
'xrowfieldtypesbundle.php' => 1,
'xrowezobjectrelationlistplusbundle.php' => 1,
'xrowdownloadlibrarybundle.php' => 1,
'xrowbootstrapbundle.php' => 1,
'xrowgoogletagmanagerbundle.php' => 1,
'xrowtwitterimportbundle.php' => 1,
'xrowbundleezpublishtoolsbundle.php' => 1,
'xrowezpublishsolrdocsbundle.php' => 1,
'qtranslate_utils.php' => 1,
'content-chat.php' => 1,
'xoeorohelperbundle.php' => 1,
'eccvalidator.php' => 1,
'linkmanybehavior.php' => 1,
'transformfilebehavior.php' => 1,
'imagefilebehavior.php' => 1,
'eagerjointrait.php' => 1,
'eagerjoinquerytrait.php' => 1,
'templatestoragephp.php' => 1,
'templatestoragemongodb.php' => 1,
'templatestoragedb.php' => 1,
'templatestorageactiverecord.php' => 1,
'templatestorage.php' => 1,
'templatemodelfinder.php' => 1,
'activemessageevent.php' => 1,
'activemessage.php' => 1,
'timezoneaction.php' => 1,
'rolebehavior.php' => 1,
'selectize.php' => 1,
'pieasset.php' => 1,
'pie.php' => 1,
'linkpreviewasset.php' => 1,
'linkpreview.php' => 1,
'ionsliderasset.php' => 1,
'ionslider.php' => 1,
'imagecomponent.php' => 1,
'googlemapsasset.php' => 1,
'ftpwrapper.php' => 1,
'ftpclient.php' => 1,
'datasyncbehavior.php' => 1,
'commentasset.php' => 1,
'positionbehavior.php' => 1,
'variationbehavior.php' => 1,
'bxslider.php' => 1,
'filemanagerphp.php' => 1,
'dbtokenmanager.php' => 1,
'emongoquerybuilder.php' => 1,
'emongodbref.php' => 1,
'hauth.php' => 1,
'cepinput.php' => 1,
'cepasset.php' => 1,
'cepaction.php' => 1,
'ceivalidator.php' => 1,
'indexfile.php' => 1,
'basefile.php' => 1,
'localfileplaceholder.php' => 1,
'initcontroller.php' => 1,
'queryprocessor.php' => 1,
'filemanagerjson.php' => 1,
'authlogidentitybehavior.php' => 1,
'mapping.php' => 1,
'containertrait.php' => 1,
'storagephp.php' => 1,
'storagemongodb.php' => 1,
'storagedb.php' => 1,
'storageactiverecord.php' => 1,
'behaviortrait.php' => 1,
'managermongodb.php' => 1,
'managerdbtransaction.php' => 1,
'managerdb.php' => 1,
'managerdataserializetrait.php' => 1,
'manageractiverecord.php' => 1,
'authlogwebuserbehavior.php' => 1,
'authlogloginformbehavior.php' => 1,
'bxsliderasset.php' => 1,
'purifybehavior.php' => 1,
'content-status.php' => 1,
'database-repair.php' => 1,
'eavbehavior.php' => 1,
'yee.php' => 1,
'blockmodule.php' => 1,
'server.ini' => 1,
'wpuf.php' => 1,
'wpuf-functions.php' => 1,
'wp-pagenavi.php' => 1,
'pagenavi-css.css' => 1,
'wp-page-numbers.php' => 1,
'screenshot-1.gif' => 1,
'wp-dbmanager.pot' => 1,
'wp-dbmanager.php' => 1,
'database-run.php' => 1,
'database-optimize.php' => 1,
'eavquerytrait.php' => 1,
'database-manager.php' => 1,
'database-manage.php' => 1,
'database-empty.php' => 1,
'database-backup.php' => 1,
'authkey.sample.php' => 1,
'header.blade.php' => 1,
'footer.blade.php' => 1,
'content.blade.php' => 1,
'content-search.php' => 1,
'sidebar-content.php' => 1,
'featured-content.php' => 1,
'content-featured-post.php' => 1,
'sidebar-main.php' => 1,
'eavmodule.php' => 1,
'mediamodule.php' => 1,
'selenium-server-standalone-2.45.0.jar' => 1,
'ygfacebookbundle.php' => 1,
'robo.phar' => 1,
'breadcrumbsfilter.php' => 1,
'epdffactorydoc.php' => 1,
'epdffactory.php' => 1,
'multimodelform.php' => 1,
'scrolluppager.php' => 1,
'fileuploaderwidget.php' => 1,
'paymentcomponent.php' => 1,
'gatewayabstract.php' => 1,
'membershipinterface.php' => 1,
'membershipcomponent.php' => 1,
'webuploaderaction.php' => 1,
'markdown2htmlasset.php' => 1,
'idiorm.php.b0922d8719a94e3a0e0e4a0ca3876f4f91475dcf' => 1,
'pagemodule.php' => 1,
'.yf_version' => 1,
'yetheedateformbundle.php' => 1,
'biplaneenumbundle.php' => 1,
'yitnotificationbundle.php' => 1,
'yithelpbundle.php' => 1,
'yitgeobridgebundle.php' => 1,
'yitpollbundle.php' => 1,
'yitmapbundle.php' => 1,
'yitadsbundle.php' => 1,
'lsnotificationbundle.php' => 1,
'avroextrabundle.php' => 1,
'tripmodule.php' => 1,
'translationmodule.php' => 1,
'settingsmodule.php' => 1,
'xoeoropicturecutbundle.php' => 1,
'xoeorobytehandbundle.php' => 1,
'mongodbtokenmanager.php' => 1,
'start-8020.sh' => 1,
'xabbuhlrsbundle.php' => 1,
'xabbuhdiconfigurationbundle.php' => 1,
'xaavqueuebundle.php' => 1,
'vanityurls.php' => 1,
'steamid.php' => 1,
'.codeclimate.sh' => 1,
'view_serverping.php' => 1,
'ocicollections.php' => 1,
'stop-8021.sh' => 1,
'start-8021.sh' => 1,
'stop-8030.sh' => 1,
'stop-8020.sh' => 1,
'start-8030.sh' => 1,
'pssaasbundle.php' => 1,
'xabbuhxapiclientbundle.php' => 1,
'pspublicwriterbundle.php' => 1,
'pspublicreaderbundle.php' => 1,
'stop-8010.sh' => 1,
'start-8010.sh' => 1,
'start-8000.sh' => 1,
'cfddns.sample.yml' => 1,
'jswidget.php' => 1,
'iterable.php' => 1,
'functional.php' => 1,
'argplaceholder.php' => 1,
'xscanner.class.php' => 1,
'myscanner.class.php' => 1,
'millenniumpaginationbundle.php' => 1,
'xabbuhpandabundle.php' => 1,
'xabbuhcrapibundle.php' => 1,
'view-without-data.png' => 1,
'xv-planeta.php' => 1,
'employeeattadancemovement.note' => 1,
'phorms.php' => 1,
'build-pear.sh' => 1,
'slug_test.php' => 1,
'proctor' => 1,
'bandaid.inc' => 1,
'bandaid.drush.inc' => 1,
'fueluxasset.php' => 1,
'combobox.php' => 1,
'php_opendkim.h' => 1,
'opendkim.c' => 1,
'bwork_edit_notes' => 1,
'helloword.php' => 1,
'types-timber-integration.php' => 1,
'xapiclient.php' => 1,
'foggitexpertbundle.php' => 1,
'entitymodalbundle.php' => 1,
'.gitignore.dist' => 1,
'exampleenvironment.php' => 1,
'tracyshortcuts.php' => 1,
'verbfixtures.php' => 1,
'statementresultfixtures.php' => 1,
'statementfixtures.php' => 1,
'documentfixtures.php' => 1,
'actorfixtures.php' => 1,
'activityfixtures.php' => 1,
'xapiclientinterface.php' => 1,
'xapiclientbuilderinterface.php' => 1,
'xapiclientbuilder.php' => 1,
'tree-resources.png' => 1,
'view-with-data.png' => 1,
'xpressdataloader.php' => 1,
'wplib.php' => 1,
'admin-content-labels.php' => 1,
'wp_pointer.php' => 1,
'options-template.php' => 1,
'options-framework.php' => 1,
'wp_options.php' => 1,
'wp_notify.php' => 1,
'wp_mvc.php' => 1,
'wp_debugbar.php' => 1,
'wp_autoupdate.php' => 1,
'wizadsettingsbundle.php' => 1,
'wizaddoctrinedocbundle.php' => 1,
'wizadcrudbundle.php' => 1,
'wizadapiblueprintbundle.php' => 1,
'defines.php' => 1,
'wps_extend_plugin.php' => 1,
'update-version.sh' => 1,
'json-loader.php' => 1,
'fieldsetinterface.php' => 1,
'metabox.php' => 1,
'boots.php' => 1,
'boots.json' => 1,
'xu.php' => 1,
'wp-sync-db.php' => 1,
'wp-sync-db-media-files.php' => 1,
'wp-sync-db-cli.php' => 1,
'slab' => 1,
'class-imagify.php' => 1,
'wp-lorem-ipsum.php' => 1,
'carelib.php' => 1,
'wps-extend-plugin.php' => 1,
'panel-transaction-history.png' => 1,
'remotedumpbundle.php' => 1,
'wysowarchivemytweetsbundle.php' => 1,
'parameters.yml.sample' => 1,
'bot.png' => 1,
'custom_autoload.php' => 1,
'zermelo.php' => 1,
'video.class.php' => 1,
'embed.class.php' => 1,
'commandr' => 1,
'flyercore' => 1,
'routefacade.php' => 1,
'facadeserviceprovider.php' => 1,
'exceptionizer.php' => 1,
'systeminfoexception.php' => 1,
'wurstpresscorebundle.php' => 1,
'aimb.php' => 1,
'wucdbmwucdbmbundle.php' => 1,
'wucdbmmenubuilderbundle.php' => 1,
'wucdbmlocalebundle.php' => 1,
'wucdbmgallerybundle.php' => 1,
'wucdbmepaybundle.php' => 1,
'wucdbmbannerbundle.php' => 1,
'socks.conf.template' => 1,
'wssysdtogeneratorbundle.php' => 1,
'tabularinput_test.php' => 1,
'tabularasset.php' => 1,
'inputcolumn.php' => 1,
'bfootableasset.php' => 1,
'wreptcpdfbundle.php' => 1,
'fosuserbundlemandrillmailerbundle.php' => 1,
'twigfactory.php' => 1,
'xpressgithubmetadataplugin.php' => 1,
'bytehandapi.php' => 1,
'hashasset.php' => 1,
'mosaicasset.php' => 1,
'mosaic.php' => 1,
'lightbox2asset.php' => 1,
'imagehelper.php' => 1,
'juxtaposeasset.php' => 1,
'zoomasset.php' => 1,
'wscratchpadasset.php' => 1,
'themefullasset.php' => 1,
'structureasset.php' => 1,
'scriptasset.php' => 1,
'iconsvgasset.php' => 1,
'iconpngextasset.php' => 1,
'iconpngasset.php' => 1,
'eraserasset.php' => 1,
'lightboxasset.php' => 1,
'jplayerwidget.php' => 1,
'commonassets.php' => 1,
'circleaudiowidget.php' => 1,
'audiowidget.php' => 1,
'imgareaselectasset.php' => 1,
'imgareaselect.php' => 1,
'holderassets.php' => 1,
'galleriaassets.php' => 1,
'galleria.php' => 1,
'orbit.php' => 1,
'foundationfullasset.php' => 1,
'easingasset.php' => 1,
'duckyasset.php' => 1,
'defaultthemeasset.php' => 1,
'qqexmailauth.php' => 1,
'd3asset.php' => 1,
'actionsheet.php' => 1,
'form.html' => 1,
'formerlyplugin.php' => 1,
'artvandelayplugin.php' => 1,
'xmonsonatamediaprovidervideobundle.php' => 1,
'xmoncolorpickertypebundle.php' => 1,
'easylogger.php' => 1,
'zeptoasset.php' => 1,
'xs.php' => 1,
'weuijsasset.php' => 1,
'weuiasset.php' => 1,
'msgpage.php' => 1,
'griditem.php' => 1,
'actionsheetcell.php' => 1,
'timesheetasset.php' => 1,
'readme.qqexmail' => 1,
'timesheet.php' => 1,
'thumbrule.php' => 1,
'thumbhelper.php' => 1,
'tagitasset.php' => 1,
'tagit.php' => 1,
'supersizedslideshowasset.php' => 1,
'supersizedcoreasset.php' => 1,
'supersized.php' => 1,
'ratchetiosasset.php' => 1,
'ratchetasset.php' => 1,
'ratchetandroidasset.php' => 1,
'pnotifyhelperassets.php' => 1,
'pnotifyassets.php' => 1,
'weixinmpauth.php' => 1,
'duckieasset.php' => 1,
'animoasset.php' => 1,
'xpressmoretag.php' => 1,
'xgclocalebundle.php' => 1,
'c.html' => 1,
'a.html' => 1,
'rql' => 1,
'xierrorbundle.php' => 1,
'xitagbundle.php' => 1,
'xismsbundle.php' => 1,
'xiselectorbundle.php' => 1,
'xisearchbundle.php' => 1,
'xifilelibbundle.php' => 1,
'xifilebrowserbundle.php' => 1,
'xidialogbundle.php' => 1,
'xibreadcrumbsbundle.php' => 1,
'xiarticlebundle.php' => 1,
'yuntongxunsmser.php' => 1,
'ossmanager.php' => 1,
'yunpiansmser.php' => 1,
'webchinesesmser.php' => 1,
'sxtsmser.php' => 1,
'cloudsmser.php' => 1,
'bootstraplanguagesasset.php' => 1,
'met.php' => 1,
'allpositions.php' => 1,
'site.php' => 1,
'restapi' => 1,
'minifyhtml.php' => 1,
'elasticsearchrequest.php' => 1,
'elasticsearchraw.php' => 1,
'smscenter.php' => 1,
'read' => 1,
'ossupload.php' => 1,
'snoopy.php' => 1,
'jqueryxasset.php' => 1,
'.env.sample.php' => 1,
'alauda' => 1,
'default.vcl' => 1,
'modulegenerateprovider.php' => 1,
'php_filter.php' => 1,
'ximaicalbundle.php' => 1,
'ezrbachook.php' => 1,
'xiideaeasymenuaclbundle.php' => 1,
'xiideaeasyformbundle.php' => 1,
'xiideaeasyauditbundle.php' => 1,
'wwwasset.php' => 1,
'toptipsasset.php' => 1,
'toptips.php' => 1,
'jquery2asset.php' => 1,
'uploadoss.php' => 1,
'fullscreenbackgroundasset.php' => 1,
'fullscreenbackground.php' => 1,
'backtopasset.php' => 1,
'backtop.php' => 1,
'statuses.php' => 1,
'companies.php' => 1,
'timer' => 1,
'memory' => 1,
'debugger' => 1,
'weibolist.php' => 1,
'weibo_login.png' => 1,
'saetv2.ex.class.php' => 1,
'testpackage.php' => 1,
'ip2region.php' => 1,
'mongodbphp7tokenmanager.php' => 1,
'mysqltokenmanager.php' => 1,
'vpconfig.defaults.neon' => 1,
'contactactionop.php' => 1,
'documentactionop.php' => 1,
'distributionlistsubscribeop.php' => 1,
'distributionlistgranteeby.php' => 1,
'distributionlistby.php' => 1,
'distributionlistactionop.php' => 1,
'directorysearchtype.php' => 1,
'deployzimletaction.php' => 1,
'dedupaction.php' => 1,
'datasourcetype.php' => 1,
'datasourceby.php' => 1,
'countobjectstype.php' => 1,
'cosby.php' => 1,
'convactionop.php' => 1,
'compactindexaction.php' => 1,
'documentpermission.php' => 1,
'certtype.php' => 1,
'calendarresourceby.php' => 1,
'cachetype.php' => 1,
'cacheentryby.php' => 1,
'csrtype.php' => 1,
'csrkeysize.php' => 1,
'browseby.php' => 1,
'autoprovtaskaction.php' => 1,
'autoprovprincipalby.php' => 1,
'authscheme.php' => 1,
'attrmethod.php' => 1,
'alwaysonclusterby.php' => 1,
'alarmaction.php' => 1,
'documentgranttype.php' => 1,
'domainby.php' => 1,
'acltype.php' => 1,
'iptype.php' => 1,
'rangetype.php' => 1,
'quotasortby.php' => 1,
'queueactionby.php' => 1,
'queueaction.php' => 1,
'participationstatus.php' => 1,
'nameidby.php' => 1,
'msgactionop.php' => 1,
'membertype.php' => 1,
'memberofselector.php' => 1,
'mdsconnectiontype.php' => 1,
'logginglevel.php' => 1,
'lockoutoperation.php' => 1,
'itemactionop.php' => 1,
'invitestatus.php' => 1,
'entrytype.php' => 1,
'inviteclass.php' => 1,
'invitechange.php' => 1,
'interesttype.php' => 1,
'importance.php' => 1,
'granteetype.php' => 1,
'granteeby.php' => 1,
'getsessionssortby.php' => 1,
'galsearchtype.php' => 1,
'galmode.php' => 1,
'galconfigaction.php' => 1,
'frequency.php' => 1,
'freebusystatus.php' => 1,
'folderactionop.php' => 1,
'filtercondition.php' => 1,
'addresstype.php' => 1,
'acerighttype.php' => 1,
'reindexaction.php' => 1,
'zfrmailchimpbundle.php' => 1,
'ypsms.php' => 1,
'wxtsms.php' => 1,
'lsmsms.php' => 1,
'main.js' => 1,
'udpnotifierbundle.php' => 1,
'smaz.php' => 1,
'make_phpdoc.sh' => 1,
'phpflickr.php' => 1,
'development.local.php.dist' => 1,
'developmentmodecontrollerfactory.php' => 1,
'dockerfile-dev' => 1,
'default-configuration.php' => 1,
'.scrutinizr.yml' => 1,
'zettamenubundle.php' => 1,
'compose-laravel.sh' => 1,
'review_1.0_cs' => 1,
'review_1.0' => 1,
'review-1.7-alpha1' => 1,
'review-1.7' => 1,
'review-1.3.4' => 1,
'review-1.6' => 1,
'review-1.3-test-failures' => 1,
'zesk.inc' => 1,
'zesk.application.inc' => 1,
'_zesk_loader_.inc' => 1,
'steamimportuserstates.sh' => 1,
'steamimportuserstates.bat' => 1,
'zeroemdeferredrequestbundle.php' => 1,
'ytxsms.php' => 1,
'yii2debug.php' => 1,
'accountby.php' => 1,
'zikulajqueryminicolorsbundle.php' => 1,
'typedsequence.php' => 1,
'typedmap.php' => 1,
'simplexml.php' => 1,
'admininterface.php' => 1,
'adminfactory.php' => 1,
'accountinterface.php' => 1,
'accountfactory.php' => 1,
'zimcertauthbundle.php' => 1,
'certificatestorageitem.php' => 1,
'certificateitem.php' => 1,
'certificategenerator.php' => 1,
'certificateexpressionvalidator.php' => 1,
'certificateawareuserinterface.php' => 1,
'wizard.png' => 1,
'yii2debuglogroute.php' => 1,
'wizardcompleteinterface.php' => 1,
'injectcontainerinterface.php' => 1,
'formhandlerinterface.php' => 1,
'abortstageexception.php' => 1,
'zikulageneratorbundle.php' => 1,
'sftp.php' => 1,
'local.php' => 1,
'_vimrc' => 1,
'_viminfo' => 1,
'generate-phpstorm-helper.php' => 1,
'phpspec-hhvm.yml.dist' => 1,
'yii2debugviewrenderer.php' => 1,
'yii2debugpanel.php' => 1,
'yii2debugmodule.php' => 1,
'rankingactionop.php' => 1,
'reindextype.php' => 1,
'deferevents.php' => 1,
'uniprop.php' => 1,
'useragent.class.php' => 1,
'test-my-useragent.php' => 1,
'zacsturgessherokuizemebundle.php' => 1,
'zrashwaniarachnidsitemapbundle.php' => 1,
'dfd.php' => 1,
'gfdsgsdfgdfs.php' => 1,
'mylog.php' => 1,
'mylog' => 1,
'mypol.te' => 1,
'mypol.pp' => 1,
'deficient' => 1,
'datagrid' => 1,
'dataform' => 1,
'fetcher.php' => 1,
'zunienumbundle.php' => 1,
'defaultservices.php' => 1,
'commandservices.php' => 1,
'texput.log' => 1,
'mentemformextbundle.php' => 1,
'mentemdatagridbundle.php' => 1,
'sourceinterface.php' => 1,
'rowinterface.php' => 1,
'resolvedtypeinterface.php' => 1,
'resolvedtype.php' => 1,
'gridregistryinterface.php' => 1,
'gridregistry.php' => 1,
'gridinterface.php' => 1,
'gridfactoryinterface.php' => 1,
'zunidatatablebundle.php' => 1,
'zunilogbundle.php' => 1,
'gridevents.php' => 1,
'builder-show.php' => 1,
'dasherizephp.sublime-project' => 1,
'visitor-test.php' => 1,
'template-test.php' => 1,
'strategy-test.php' => 1,
'single-test.php' => 1,
'proxy-test.php' => 1,
'observer-test.php' => 1,
'mediator-test.php' => 1,
'interpreter-show.php' => 1,
'factory-show.php' => 1,
'facade-show.php' => 1,
'delegate-show.php' => 1,
'decorator-show.php' => 1,
'adapter-show.php' => 1,
'zunimenubundle.php' => 1,
'lsyncd.conf.lua.template' => 1,
'twigpath.php' => 1,
'requestevent.php' => 1,
'discovery-shell.php' => 1,
'dummyfilemanager.php' => 1,
'imageattachmentasset.php' => 1,
'elfinderinput.php' => 1,
'imagefileinput.php' => 1,
'watch.rb' => 1,
'gen' => 1,
'gcaljson.php' => 1,
'nfephp.css' => 1,
'grava_config.php' => 1,
'zunimenuevents.php' => 1,
'gridfactory.php' => 1,
'gridevent.php' => 1,
'replytype.php' => 1,
'voicemsgactionop.php' => 1,
'attributeselector.php' => 1,
'attributename.php' => 1,
'accountselector.php' => 1,
'accountnameselector.php' => 1,
'headercontext.php' => 1,
'mailinterface.php' => 1,
'mailfactory.php' => 1,
'zimletstatus.php' => 1,
'zimletexcludetype.php' => 1,
'xmppcomponentby.php' => 1,
'weekday.php' => 1,
'volumetype.php' => 1,
'voicesortby.php' => 1,
'versioncheckaction.php' => 1,
'attrsimpltrait.php' => 1,
'verbtype.php' => 1,
'ucserviceby.php' => 1,
'transparency.php' => 1,
'targettype.php' => 1,
'targetby.php' => 1,
'tagactionop.php' => 1,
'sortby.php' => 1,
'sessiontype.php' => 1,
'serverby.php' => 1,
'sectiontype.php' => 1,
'searchtype.php' => 1,
'rightclass.php' => 1,
'requestformat.php' => 1,
'attributeselectortrait.php' => 1,
'cursorinfo.php' => 1,
'gridbuilderinterface.php' => 1,
'voiceinterface.php' => 1,
'gridbuilder.php' => 1,
'columninterface.php' => 1,
'mentemconfigbundle.php' => 1,
'mentembootstrapbundle.php' => 1,
'mentemadminbundle.php' => 1,
'zk2usefulbundle.php' => 1,
'zk2adminpanelbundle.php' => 1,
'zk2spsbundle.php' => 1,
'generaldigitalpleskbundle.php' => 1,
'vi.php' => 1,
'ziron-api.php' => 1,
'testform.xml' => 1,
'floppybundle.php' => 1,
'voicefactory.php' => 1,
'entrysearchfilterinfo.php' => 1,
'attactment.php' => 1,
'waitsetspec.php' => 1,
'waitsetid.php' => 1,
'waitsetaddspec.php' => 1,
'tzonsetinfo.php' => 1,
'structinterface.php' => 1,
'searchfiltercondition.php' => 1,
'opvalue.php' => 1,
'namedvalue.php' => 1,
'namedelement.php' => 1,
'keyvaluepair.php' => 1,
'granteechooser.php' => 1,
'entrysearchfiltersinglecond.php' => 1,
'entrysearchfiltermulticond.php' => 1,
'deferredrequestinterface.php' => 1,
'zeroemapisecuritybundle.php' => 1,
'flashbasehelper.php' => 1,
'warehouse.class.php' => 1,
'jullocationbundle.php' => 1,
'新建文本文档' => 1,
'rizewaycasbundle.php' => 1,
'anchour.php' => 1,
'.anchour' => 1,
'rizewayjobbundle.php' => 1,
'ameblo.php' => 1,
'shorton.php' => 1,
'spressdataloader.php' => 1,
'spressmoretag.php' => 1,
'rpsguestbookbundle.php' => 1,
'rpscorebundle.php' => 1,
'yosmanygadomainparserbundle.php' => 1,
'v3warehousetest.php' => 1,
'currentsession.php' => 1,
'v3warehousemytest.php' => 1,
'v3warehouse.class.php' => 1,
'v3sdktest.php' => 1,
'v3sdk.class.php' => 1,
'v3application.class.php' => 1,
'mongo.script' => 1,
'binbase.sql' => 1,
'phpbintestmy.php' => 1,
'phpbintestmon.php' => 1,
'phpbintest.php' => 1,
'phpbin.class.php' => 1,
'bin.class.php' => 1,
'mysocial.class.php' => 1,
'apiconnector.php' => 1,
'deletebysaving.php' => 1,
'mydbtest.php' => 1,
'recurringtemplate.php' => 1,
'tpnregionalroutingbundle.php' => 1,
'specs' => 1,
'httpserver.php' => 1,
'cgistream.php' => 1,
'xmlmapper.php' => 1,
'unabletosettleexception.php' => 1,
'taxrate.php' => 1,
'syncobject.php' => 1,
'syncarray.php' => 1,
'storable.php' => 1,
'simplexmlelement.php' => 1,
'servererrorexception.php' => 1,
'sendable.php' => 1,
'payable.php' => 1,
'dirtyaware.php' => 1,
'notvalidexception.php' => 1,
'notloggedinexception.php' => 1,
'logtransportdecorator.php' => 1,
'jsonmapper.php' => 1,
'invoiceprofile.php' => 1,
'invalidstateexception.php' => 1,
'invalidservicetypeexception.php' => 1,
'invalidsequencetypeexception.php' => 1,
'invalidrequestexception.php' => 1,
'invalididexception.php' => 1,
'invalidfilterexception.php' => 1,
'incominginvoice.php' => 1,
'estimate.php' => 1,
'disclosure.php' => 1,
'mylogin.class.php' => 1,
'mydb.class.php' => 1,
'yvinviteevents.php' => 1,
'mysql.scheme.sql' => 1,
'yjvreportrenderingbundle.php' => 1,
'html_screenshot.png' => 1,
'reportrendering.php' => 1,
'filterconstants.php' => 1,
'builderinterfaces.php' => 1,
'targetmodeltrait.php' => 1,
'targetmodel.php' => 1,
'viewrendererstaticclassproxy.php' => 1,
'optimizer.php' => 1,
'yiicaster.php' => 1,
'batchqueryresult.php' => 1,
'togglebuttongroup.php' => 1,
'bootstrapwidgettrait.php' => 1,
'mediafile.php' => 1,
'abstractnamedbuilder.php' => 1,
'etwigviewrenderer.php' => 1,
'estatusbehavior.php' => 1,
'edbmigration.php' => 1,
'efileuploadaction.php' => 1,
'basechart.php' => 1,
'eactiverecordrelationbehaviortest.php' => 1,
'eactiverecordrelationbehavior.php' => 1,
'meritbehavior.php' => 1,
'forum.sql' => 1,
'readme-zh' => 1,
'uploadfilebehavior.php' => 1,
'jwplayerasset.php' => 1,
'jwplayer.php' => 1,
'abstractbuilder.php' => 1,
'buildernotreturnedexception.php' => 1,
'driverdb.class.php' => 1,
'typeregistry.php' => 1,
'test_xml.php' => 1,
'test_timbra.php' => 1,
'test_cancela.php' => 1,
'foxreferencedataloaderbundle.php' => 1,
'yjvvalidatorconstraintgroupbundle.php' => 1,
'yamlgrouploader.php' => 1,
'grouploaderinterface.php' => 1,
'groupfactoryinterface.php' => 1,
'groupfactory.php' => 1,
'groupcreationfailedexception.php' => 1,
'constraintgroup.php' => 1,
'typeresolverinterface.php' => 1,
'typeregistryinterface.php' => 1,
'typenotsupportedexception.php' => 1,
'buildernotsupportedexception.php' => 1,
'typenotfoundexception.php' => 1,
'typefactoryinterface.php' => 1,
'typefactorybuilderinterface.php' => 1,
'typefactorybuilder.php' => 1,
'typefactory.php' => 1,
'typeextensionsnotfoundexception.php' => 1,
'typechaininterface.php' => 1,
'typechain.php' => 1,
'registryextensioninterface.php' => 1,
'optionsresolvernotreturnedexception.php' => 1,
'namedtypefactoryinterface.php' => 1,
'namedtypefactory.php' => 1,
'namedbuilderinterface.php' => 1,
'finalizingtypeinterface.php' => 1,
'yvinvitebundle.php' => 1,
'yvmulticurrencybundle.php' => 1,
'zeroemjsonbundle.php' => 1,
'authmobile.php' => 1,
'testconfiguration.php.travis' => 1,
'testconfiguration.php.dist' => 1,
'phpmetrics.html' => 1,
'zend-blueprint.json' => 1,
'installing-nagios-debian6' => 1,
'foundationpluginasset.php' => 1,
'pryongoogletranslatorbundle.php' => 1,
'zeliard91dynamodbconnectorbundle.php' => 1,
'summernotepluginasset.php' => 1,
'rssview.php' => 1,
'slugifier.php' => 1,
'zelenincqrsbundle.php' => 1,
'authsites.php' => 1,
'authdirect.php' => 1,
'.zf-mkdoc-theme-preserve' => 1,
'constantcontact.php' => 1,
'gitphploy.ini.sample' => 1,
'config.ini.sample.php' => 1,
'zebbavalidatorbundle.php' => 1,
'parameterconverter.php' => 1,
'classutility.php' => 1,
'zebbasecuritybundle.php' => 1,
'config_dist.php' => 1,
'entitymodel.php' => 1,
'paging.php' => 1,
'kcppay.php' => 1,
'bestsms.php' => 1,
'.htdeployment' => 1,
'zf2.bat' => 1,
'bookdown.json' => 1,
'zapoyoktimelinejsbundle.php' => 1,
'kladrbundle.php' => 1,
'zeroemdeferredrequestpersisterbundle.php' => 1,
'millwrightsemaphorebundle.php' => 1,
'codesniffer.sample.conf' => 1,
'phputil.php' => 1,
'numbertostring.php' => 1,
'dateutil.php' => 1,
'update-vendors.sh' => 1,
'millwrighttwitterbootstrapbundle.php' => 1,
'millwrightradbundle.php' => 1,
'millwrightmenubundle.php' => 1,
'millwrightfilterbundle.php' => 1,
'millwrightboilerplatebundle.php' => 1,
'millwrightconfigurationbundle.php' => 1,
'vbv_learn_more.html' => 1,
'my first framework based on composer' => 1,
'robots_example' => 1,
'page_not_found.php' => 1,
'nddbc.html' => 1,
'mcs_learn_more.html' => 1,
'ipn_main_handler.php' => 1,
'init_includes.php' => 1,
'ricjloader.php' => 1,
'loaderhelper.php' => 1,
'cssjsfinder.php' => 1,
'outputcache.php' => 1,
'datacache.php' => 1,
'cachecore.php' => 1,
'turbo' => 1,
'igabuilderbundle.php' => 1,
'zapoyokuserpreferencesbundle.php' => 1,
'zapoyokholidaybundle.php' => 1,
'yvmulticurrencyevents.php' => 1,
'yuccadatabundle.php' => 1,
'install-chardet.sh' => 1,
'simpleldapbundle.php' => 1,
'openvpnmanagementbundle.php' => 1,
'ketch' => 1,
'svnlog' => 1,
'ci.bat' => 1,
'adminyii.sublime-workspace' => 1,
'adminyii.sublime-project' => 1,
'weibo.php' => 1,
'qq.php' => 1,
'smd.js' => 1,
'smd.css' => 1,
'yuccafosuseradapterbundle.php' => 1,
'setup.bat' => 1,
'abstractworkflowexecution.php' => 1,
'gardening' => 1,
'readme.api' => 1,
'dns_record.json' => 1,
'apcpanelbundle.php' => 1,
'ystoolserlangportbundle.php' => 1,
'ystoolsbackurlbundle.php' => 1,
'servicesjsonerror.php' => 1,
'servicesjson.php' => 1,
'rklocalebundle.php' => 1,
'betacieovhbundle.php' => 1,
'yoyelocalizationbundle.php' => 1,
'yvtransactionalemailevents.php' => 1,
'yvtransactionalemailbundle.php' => 1,
'abstractworkflowdefinition.php' => 1,
'abstractworkflowexecutionfactory.php' => 1,
'zanstandarduibundle.php' => 1,
'pico_oembed.php' => 1,
'zanhttpapibundle.php' => 1,
'zancorebundle.php' => 1,
'zancommandbundle.php' => 1,
'tha-theme-hooks.php' => 1,
'tha-example-index.php' => 1,
'zakharovvihumanstxtbundle.php' => 1,
'zz-number.iml' => 1,
'zaederlink4mailingbundle.php' => 1,
'holmes.php' => 1,
'wordnetphp-console' => 1,
'pronounce-php' => 1,
'petrol' => 1,
'pico_scheduled_post.php' => 1,
'doctrine.dbal.hooks.php' => 1,
'awx' => 1,
'ide_helper_mongo.php' => 1,
'hydra.phar' => 1,
'compile.bat' => 1,
'ddns-updater.yml.dist' => 1,
'regexes.yml' => 1,
'yzsupervisorbundle.php' => 1,
'good1' => 1,
'good' => 1,
'filesrc.php' => 1,
'classsrc.php' => 1,
'classmapandfile.php' => 1,
'release_note' => 1,
'jbuild.dist.ini' => 1,
'venom.php' => 1,
'vpconfig.neon' => 1,
'versionpress.php' => 1,
'runpostdeploy' => 1,
'abstractmultiactioncontroller.php' => 1,
'dispatcherawareinterface.php' => 1,
'serverhelper.php' => 1,
'htmlelements.php' => 1,
'htmlelement.php' => 1,
'domelements.php' => 1,
'domelement.php' => 1,
'relationdatamapper.php' => 1,
'abstractdatamapper.php' => 1,
'databasehelper.php' => 1,
'databasefactory.php' => 1,
'datasetinterface.php' => 1,
'datainterface.php' => 1,
'crypthelper.php' => 1,
'abstractconsole.php' => 1,
'eventtriggerableinterface.php' => 1,
'nincompare.php' => 1,
'neqcompare.php' => 1,
'ltecompare.php' => 1,
'ltcompare.php' => 1,
'incompare.php' => 1,
'gtecompare.php' => 1,
'gtcompare.php' => 1,
'eqcompare.php' => 1,
'comparehelper.php' => 1,
'credential.php' => 1,
'abstractwebapplication.php' => 1,
'abstractdaemonapplication.php' => 1,
'abstractcliapplication.php' => 1,
'dispatcherawaretrait.php' => 1,
'listenermapper.php' => 1,
'developmentbundle.php' => 1,
'abstractmiddleware.php' => 1,
'registryhelper.php' => 1,
'nestedrecord.php' => 1,
'queryexpression.php' => 1,
'queryelement.php' => 1,
'connectioncontainer.php' => 1,
'abstractquerybuilder.php' => 1,
'profilerinterface.php' => 1,
'profilerawareinterface.php' => 1,
'nullprofiler.php' => 1,
'databasemodelinterface.php' => 1,
'abstractmodel.php' => 1,
'endmiddleware.php' => 1,
'callbackmiddleware.php' => 1,
'languagenormalize.php' => 1,
'listenerpriority.php' => 1,
'windwalker.xml' => 1,
'jsoninput.php' => 1,
'formdatainput.php' => 1,
'filesinput.php' => 1,
'abstractrequest.php' => 1,
'validatorhelper.php' => 1,
'formhelper.php' => 1,
'fieldhelper.php' => 1,
'fielddefinitioninterface.php' => 1,
'abstractformelementhelper.php' => 1,
'outputfilter.php' => 1,
'inputfilter.php' => 1,
'htmlcleaner.php' => 1,
'listenersqueue.php' => 1,
'abstractapplication.php' => 1,
'mycomposer.php' => 1,
'abstractenginerenderer.php' => 1,
'tpl_package' => 1,
'varspoolwebsocketbundle.php' => 1,
'epub-titlepage.html' => 1,
'epub-page.html' => 1,
'epub-coverimage.html' => 1,
'default.textile' => 1,
'default.rtf' => 1,
'default.opendocument' => 1,
'default.mediawiki' => 1,
'default.latex' => 1,
'default.html5' => 1,
'default.html' => 1,
'default.docbook' => 1,
'vanilla_logo.png' => 1,
'sample_package.php' => 1,
'freq.php' => 1,
'class.exportmodel.php' => 1,
'class.exportcontroller.php' => 1,
'valitonshariffbundle.php' => 1,
'shariffconfig.php' => 1,
'valitonpaymentsaferpaybundle.php' => 1,
'valitonmultisitebundle.php' => 1,
'currentsite.php' => 1,
'valitonpaymentdatatransbundle.php' => 1,
'kwtyahoobossbundle.php' => 1,
'ot-loader.php' => 1,
'macaddressvalidator.php' => 1,
'class-phoenix-framework-form-field-type-base.php' => 1,
'class-phoenix-framework-form-builder.php' => 1,
'diacritic.php' => 1,
'parts.php' => 1,
'arg.php' => 1,
'model.hooks.php' => 1,
'doxport' => 1,
'bootstrap-tests.php' => 1,
'vf_license' => 1,
'application.config.local.php.dist' => 1,
'netsuite toolkit license agreement.docx' => 1,
'vegas.json' => 1,
'voting.i18n.php' => 1,
'voting.hooks.php' => 1,
'voting.class.php' => 1,
'activerecordsetup.php' => 1,
'activerecordormspecial.php' => 1,
'activerecordmediawiki.php' => 1,
'model.i18n.php' => 1,
'ororedisconfigbundle.php' => 1,
'phonetics.php' => 1,
'bots.json' => 1,
'cheburtwigphpfunctionsbundle.php' => 1,
'chebursphinxbundle.php' => 1,
'joubjoubnotificationbundle.php' => 1,
'multipleappkernelbundle.php' => 1,
'w3docslogviewerbundle.php' => 1,
'amgangularjsbundle.php' => 1,
'curlemu.php' => 1,
'vaszevselfadvertbundle.php' => 1,
'vaszevcrudbundle.php' => 1,
'vaszevcrudltebundle.php' => 1,
'vaszevcommonsbundle.php' => 1,
'suffixes.php' => 1,
'prefixes.php' => 1,
'abstractadapterrenderer.php' => 1,
'abstractrenderer.php' => 1,
'modularapp.php' => 1,
'checktypes.php' => 1,
'consumer.php' => 1,
'phpunit.teamcity.xml' => 1,
'phpunit.teamcity.sqlite3.xml' => 1,
'phpunit.teamcity.postgresql.xml' => 1,
'iframe' => 1,
'vincetbasebundle.php' => 1,
'vincetadminconfigurationbundle.php' => 1,
'vincetadminbundle.php' => 1,
'virtualhost.conf' => 1,
'vincetypebundle.php' => 1,
'vincecmssonataadminbundle.php' => 1,
'vincecmsbundle.php' => 1,
'vincecoreidelinkbundle.php' => 1,
'example.svg' => 1,
'signaturemethod.php' => 1,
'example.c4ml' => 1,
'api-autoloader.php' => 1,
'vihuvacrecaptchabundle.php' => 1,
'cpt-base.php' => 1,
'xmlelementinterface.php' => 1,
'xmlelement.php' => 1,
'xmlcollectioninterface.php' => 1,
'xmlcollection.php' => 1,
'xmlattributesinterface.php' => 1,
'xmlattributes.php' => 1,
'xmlarraycollection.php' => 1,
'definitions' => 1,
'appendr.php' => 1,
'hmacsha1.php' => 1,
'behat-client.yml.dist' => 1,
'actors.gif' => 1,
'iphpfilestorebundle.php' => 1,
'abstract_router.php' => 1,
'controller_exception.php' => 1,
'code' => 1,
'squarebitmap.php' => 1,
'pixel.php' => 1,
'imagebitmap.php' => 1,
'ilazybitmap.php' => 1,
'colorbitmap.php' => 1,
'bitmap.php' => 1,
'iphptreebundle.php' => 1,
'iphpsearchbundle.php' => 1,
'iphpredirectnotfoundbundle.php' => 1,
'iphppollbundle.php' => 1,
'iphpcorebundle.php' => 1,
'behat-worker.yml.dist' => 1,
'iphpcontentbundle.php' => 1,
'nds.php' => 1,
'cnzzwidget.php' => 1,
'basegeolocation.php' => 1,
'htmlencodeattributebehavior.php' => 1,
'basetimezone.php' => 1,
'youtubeasset.php' => 1,
'cns.php' => 1,
'queuemails.php' => 1,
'watermark.png' => 1,
'result.jpg' => 1,
'image.jpg' => 1,
'rotor' => 1,
'library' => 1,
'shooting.gif' => 1,
'phpviddler.php' => 1,
'bladerenderer.php' => 1,
'abstractview.php' => 1,
'menu-class-diagram.svg' => 1,
'ob_logo_compacto.png' => 1,
'ob_logo.png' => 1,
'gerar_boleto.php' => 1,
'ob_init.php' => 1,
'plugin' => 1,
'vershsphinxbundle.php' => 1,
'coind.php' => 1,
'veritrans.php' => 1,
'autoload_dist.php' => 1,
'viewinterface.php' => 1,
'simplehtmlview.php' => 1,
'htmlview.php' => 1,
'uriinterface.php' => 1,
'vespolinacommercebundle.php' => 1,
'uriimmutable.php' => 1,
'urihelper.php' => 1,
'psruri.php' => 1,
'abstracturi.php' => 1,
'testenvironment.php' => 1,
'utf8string.php' => 1,
'stringnormalise.php' => 1,
'stringinflector.php' => 1,
'simpletemplate.php' => 1,
'twigrenderer.php' => 1,
'platesrenderer.php' => 1,
'phprenderer.php' => 1,
'mustacherenderer.php' => 1,
'vespolinaadminbundle.php' => 1,
'storeevents.php' => 1,
'mitlicense' => 1,
'abstractsocket.php' => 1,
'phpdoc-md' => 1,
'servedocs.sh' => 1,
'publishdocs.sh' => 1,
'infinitepager.php' => 1,
'vgrelasticsearchhttpfoundationbundle.php' => 1,
'vgrelasticsearchbundle.php' => 1,
'vgrelasticsearchfosoauthserverbundle.php' => 1,
'amazonstoragebundle.php' => 1,
'socketinterface.php' => 1,
'remotesocket.php' => 1,
'localsocket.php' => 1,
'httpssocket.php' => 1,
'httpsocket.php' => 1,
'lxsocketbundle.php' => 1,
'vespolinastorebundle.php' => 1,
'lxjquerybundle.php' => 1,
'jquery-latest.js' => 1,
'lxbootstrapbundle.php' => 1,
'phpunit.sqlite.xml' => 1,
'phpunit.postgresql.xml' => 1,
'phpunit.mysqli.xml' => 1,
'moodlelib.php' => 1,
'class_cloudflare.php' => 1,
'config-empty.php' => 1,
'.htaccess-template' => 1,
'finck.php' => 1,
'upgrade-0.6' => 1,
'vespolinataxonomybundle.php' => 1,
'vespolinataxationbundle.php' => 1,
'systemmodule.php' => 1,
'swaggermodule.php' => 1,
'vivaitauthbundle.php' => 1,
'favicongenerator.php' => 1,
'eshop.php' => 1,
'lazyrouter.php' => 1,
'antique.php' => 1,
'upfront-theme-manager.php' => 1,
'parse' => 1,
'uecodeawsclibundle.php' => 1,
'titlegenerator.php' => 1,
'staticseoitemadapter.php' => 1,
'socialmetatagsgenerator.php' => 1,
'seositeinterface.php' => 1,
'seometatagsgenerator.php' => 1,
'seoiteminterface.php' => 1,
'linksgenerator.php' => 1,
'dynamicseoitem.php' => 1,
'realestate.php' => 1,
'baseseogenerator.php' => 1,
'vagrafonybundle.php' => 1,
'udanadminltebundle.php' => 1,
'license-kohana' => 1,
'ucsfldapormbundle.php' => 1,
'ucsfduoormbundle.php' => 1,
'ucsdmath-logo.png' => 1,
'db.sqlite' => 1,
'conucha' => 1,
'ubcsisapibundle.php' => 1,
'screen 2.png' => 1,
'jquery-1.10.2.min.js' => 1,
'render.phtml' => 1,
'guestbook.php' => 1,
'.zf.ini' => 1,
'uap-core' => 1,
'ldmmodule.php' => 1,
'class-zip.php' => 1,
'class-updraftplus.php' => 1,
'global-hide-brute-force-admin-tool-bar.php' => 1,
'global-hide-admin-tool-bar.php' => 1,
'reeeed_meeee' => 1,
'mockdata' => 1,
'umbrellawebmailerbundle.php' => 1,
'umbrellawebgooglegeocodingapibundle.php' => 1,
'umbrellawebmarkdownbundle.php' => 1,
'fileheaderdocblock' => 1,
'zendesk_app_controller.php' => 1,
'usnnewsletterbundle.php' => 1,
'ulffelasticsearchphpclientbundle.php' => 1,
'hillmodule.php' => 1,
'clean-cache.bat' => 1,
'acemodule.php' => 1,
'ulaboxrulerbundle.php' => 1,
'ulaboxgearmanbundle.php' => 1,
'redisphp.png' => 1,
'enricher.php' => 1,
'emptychildrenexception.php' => 1,
'elementtypenotsupportedexception.php' => 1,
'arrayconverterinterface.php' => 1,
'arrayconverter.php' => 1,
'tpnemailtemplatesbundle.php' => 1,
'start-update.sh' => 1,
'index.css' => 1,
'end-update.sh' => 1,
'clean-cache.sh' => 1,
'update-resources.sh' => 1,
'wagner.cson' => 1,
'restorer.php' => 1,
'dustasset.php' => 1,
'tvisionrackspacecloudfilesbundle.php' => 1,
'liuggiohelpdeskbundle.php' => 1,
'basereflection.php' => 1,
'crudassets.php' => 1,
'gsearch.php' => 1,
'embedwidget.php' => 1,
'codevalidator.php' => 1,
'yiimaterializeasset.php' => 1,
'waves.php' => 1,
'materializeiconsasset.php' => 1,
'actionbutton.php' => 1,
'formbuilderasset.php' => 1,
'fieldbehavior.php' => 1,
'tuxonevalidationbundle.php' => 1,
'wiechertdatatablesbundle.php' => 1,
'tuxonesocialmetatagsbundle.php' => 1,
'tuxonepostmarkbundle.php' => 1,
'bjycompat.classmap.php' => 1,
'style.v1.min.css' => 1,
'gulp' => 1,
'tuskredismqbundle.php' => 1,
'schemacollection.php' => 1,
'identitymap.php' => 1,
'baserecord.php' => 1,
'turretio.php' => 1,
'css-inliner' => 1,
'local-script.sh' => 1,
'runpostdeploy.bat' => 1,
'ctorsfilesystemcachebundle.php' => 1,
'twiftycorebundle.php' => 1,
'license_umc' => 1,
'multilevelselect.php' => 1,
'blaze' => 1,
'carbon-breadcrumbs.php' => 1,
'wp-hydra.php' => 1,
'tystrsendgridbundle.php' => 1,
'tystrreactjsbundle.php' => 1,
'tystrawsbundle.php' => 1,
'thunderbird.jpg' => 1,
'ios.jpg' => 1,
'websites.json' => 1,
'tyhandworkflowbundle.php' => 1,
'tyhanddocumentdownloaderbundle.php' => 1,
'tyhandbackgroundprocessbundle.php' => 1,
'composer-test.php' => 1,
'insurancesdk.php' => 1,
'twiftyformbundle.php' => 1,
'twodudeserrorloggerbundle.php' => 1,
'twodudesaclbundle.php' => 1,
'sortablecolumn.php' => 1,
'compatibility-notice.php' => 1,
'中国银联手机支付枧件使用朇南.pdf' => 1,
'财付通银衜普通限额叚编码(字母分表).xls' => 1,
'财付通支付网关商户开发朇南.doc' => 1,
'财付通wap支付网关商户开发朇南.doc' => 1,
'腾讯公司财付通wap支付网关商户开发朇南v2.1.doc' => 1,
'更新日志.log' => 1,
'手机网页支付枥入丞使用规则.pdf' => 1,
'手机网页即时到账枥口.pdf' => 1,
'dropdock' => 1,
'dropdockrobofile.php' => 1,
'example-decrypt.php' => 1,
'updraftplus.php' => 1,
'cors.php' => 1,
'codeprettifyasset.php' => 1,
'formattedfilelogroute.php' => 1,
'sitechecker' => 1,
'textareaautosizeasset.php' => 1,
'scrolltotopasset.php' => 1,
'scrolltotop.php' => 1,
'appscrolltotopasset.php' => 1,
'pace.php' => 1,
'jqueryscrolltoasset.php' => 1,
'jquerymousewheelasset.php' => 1,
'jqueryformasset.php' => 1,
'jqueryessentialasset.php' => 1,
'igrowlasset.php' => 1,
'igrowl.php' => 1,
'sshot-1.png' => 1,
'selectcolumn.php' => 1,
'uran1980fancyboxbundle.php' => 1,
'game' => 1,
'logentriesbundle.php' => 1,
'eveonlinesso.php' => 1,
'.gitignore.swp' => 1,
'unrlabsecuritybundle.php' => 1,
'unrlabdomainbundle.php' => 1,
'execute-tests.sh' => 1,
'builddefault.xml' => 1,
'sparrow.php' => 1,
'tokenbuffer.php' => 1,
'reflectionannotatedproperty.php' => 1,
'reflectionannotatedparameter.php' => 1,
'jsonfieldsbehavior.php' => 1,
'urodoztranslationunitbundle.php' => 1,
'reflectionannotatedfunction.php' => 1,
'ssh_config.php' => 1,
'queuemodule.php' => 1,
'develmodule.php' => 1,
'preview' => 1,
'metatagscomponent.php' => 1,
'metatagbehavior.php' => 1,
'loopcommandbundle.php' => 1,
'oauthstrategy.php' => 1,
'iso_codes' => 1,
'voelkeldatatablesbundle.php' => 1,
'renderparkingbundle.php' => 1,
'gfprojectinfobundle.php' => 1,
'ushiostumblrbundle.php' => 1,
'ushioselasticsearchbundle.php' => 1,
'ushiosawsbundle.php' => 1,
'urodozcachebundle.php' => 1,
'renderableaddressinterface.php' => 1,
'geography.php' => 1,
'markupwistiabundle.php' => 1,
'markupoembedbundle.php' => 1,
'markupneedlebundle.php' => 1,
'markupjobqueuebundle.php' => 1,
'markupfallbackpasswordencoderbundle.php' => 1,
'markupbarcodebundle.php' => 1,
'markupaddressingbundle.php' => 1,
'rfc' => 1,
'phpunit_composer.xml' => 1,
'phpunit_builtin_autoloader.xml' => 1,
'postpone.php' => 1,
'urodoztimeexecutionstatsbundle.php' => 1,
'reflectionannotatedmethod.php' => 1,
'reflectionannotatedclass.php' => 1,
'undanetextravalidatorbundle.php' => 1,
'shellwrapper.sh' => 1,
'entities.php' => 1,
'detector.php' => 1,
'code.php' => 1,
'char.php' => 1,
'wp-currencies.php' => 1,
'uneaktemplatesmanagerbundle.php' => 1,
'uneakroutesmanagerbundle.php' => 1,
'uneakformsmanagerbundle.php' => 1,
'uneakflatskinbundle.php' => 1,
'cktemplatebundle.php' => 1,
'uneakblocksmanagerbundle.php' => 1,
'uneakassetsmanagerbundle.php' => 1,
'uneakadminbundle.php' => 1,
'undfzoozpaymentbundle.php' => 1,
'specs.php' => 1,
'opentransactionhandler.php' => 1,
'undfformbundle.php' => 1,
'picojade.php' => 1,
'translatenotfound.php' => 1,
'langiterator.php' => 1,
'inlinecss.php' => 1,
'cfg.php' => 1,
'uecmediavideoproviderbundle.php' => 1,
'uecmediapdfbundle.php' => 1,
'extractmode.php' => 1,
'uecmediaimagebundle.php' => 1,
'uecmediaevents.php' => 1,
'uecmediabundle.php' => 1,
'repr.php' => 1,
'cool-faces' => 1,
'reflection.php' => 1,
'headmodule.php' => 1,
'parseexception.php' => 1,
'annotation_build.php' => 1,
'bootstrap.console.php' => 1,
'sqlbuilder.php' => 1,
'sessionhandlerserviceprovider.php' => 1,
'querylogger.php' => 1,
'plugininterface.php' => 1,
'pluggable.php' => 1,
'permissionmodel.php' => 1,
'pagermodule.php' => 1,
'mvcserviceprovider.php' => 1,
'mutator.php' => 1,
'morepagermodule.php' => 1,
'customcontrollerresolver.php' => 1,
'larathon' => 1,
'cookieidentity.php' => 1,
'convertutil.php' => 1,
'beanmodelformatter.php' => 1,
'beanmodel.php' => 1,
'configurationserviceprovider.php' => 1,
'unknownblisszurbfoundationbundle.php' => 1,
'unknownblissbootstrapbundle.php' => 1,
'uamuserbundle.php' => 1,
'uampropelsessionbundle.php' => 1,
'mockerytrait.php' => 1,
'spytrait.php' => 1,
'watchabletrait.php' => 1,
'staticshim.php' => 1,
'react-laravel' => 1,
'router_ini_factory.php' => 1,
'alicecontext.php' => 1,
'versionpress-nginx.conf' => 1,
'wmcstripebundle.php' => 1,
'gfunctions.php' => 1,
'gentry.php' => 1,
'gdefine.php' => 1,
'gconfig.php' => 1,
'pot-generator.php' => 1,
'required-plugins.php' => 1,
'mu-require.php' => 1,
'mu-loader.php' => 1,
'wmcswiftmailertwigbundle.php' => 1,
'wmcmenupartbundle.php' => 1,
'wmcdoctrinenamingstrategybundle.php' => 1,
'phpunit.xml.coverage.dist' => 1,
'wmctemplateinroutebundle.php' => 1,
'wmcmangopaybundle.php' => 1,
'simplelightncandy.php' => 1,
'wmcdirectoryloaderbundle.php' => 1,
'gelfmessage.php' => 1,
'php-util.phar' => 1,
'include.inc.php' => 1,
'changelog_generator.php' => 1,
'swarm.json' => 1,
'wordpress-importer.php' => 1,
'parsers.php' => 1,
'composer-run-script.gif' => 1,
'wcm_lang_switch.class.php' => 1,
'dev_tools.class.php' => 1,
'create-pot.sh' => 1,
'strip-naked-logo.png' => 1,
'abstractlightncandytemplate.php' => 1,
'dobee.php' => 1,
'openpptimelinebundle.php' => 1,
'emoji.png' => 1,
'whyte624sonataadminextraexportbundle.php' => 1,
'auto_prepend.php' => 1,
'whybugfile.ini' => 1,
'readme-tr' => 1,
'bbitbootstrapbundle.php' => 1,
'wp-badge-poser.php' => 1,
'whisllertechdatabundle.php' => 1,
'whisnetircbotbundle.php' => 1,
'whatwedoesrbundle.php' => 1,
'examples.png' => 1,
'nyan.gif' => 1,
'fabify-box.json' => 1,
'fab-box.json' => 1,
'emojis.png' => 1,
'wrpinjectabledoctrinebundle.php' => 1,
'emojis.php' => 1,
'whxeditablebundle.php' => 1,
'whuserbundle.php' => 1,
'whsmartadminbundle.php' => 1,
'whorganisationbundle.php' => 1,
'whmainbundle.php' => 1,
'whcmsbundle.php' => 1,
'whblogbundle.php' => 1,
'what3words.class.php' => 1,
'sli.php' => 1,
'satellizer.php' => 1,
'phoneutils.php' => 1,
'dddvalidator.php' => 1,
'polarbear.php' => 1,
'githooksloader.php' => 1,
'openpppushnotificationbundle.php' => 1,
'widopfixturesbundle.php' => 1,
'migrate-1.5.x' => 1,
'materializejsasset.php' => 1,
'materializecssasset.php' => 1,
'helper' => 1,
'filemodifier' => 1,
'analyzefiles' => 1,
'ipdb.dat' => 1,
'ip.class.php' => 1,
'person.json' => 1,
'webgriffepdftotextbundle.php' => 1,
'directorynotfoundexception.php' => 1,
'migrate-1.8.x' => 1,
'migrate-1.7.x' => 1,
'migrate-1.6.x' => 1,
'migrate-1.10.x' => 1,
'webnetssoauthbundle.php' => 1,
'view.sublime-project' => 1,
'translation.sublime-project' => 1,
'testplate.sublime-project' => 1,
'webforge-testdata-repository.sublime-project' => 1,
'webforge-project-stack.sublime-project' => 1,
'migrate-1.2' => 1,
'migrate-1.1' => 1,
'process.sublime-project' => 1,
'persona.sublime-project' => 1,
'fatal-error-handler.sublime-project' => 1,
'webforge-dom.sublime-project' => 1,
'webforge-console.sublime-project' => 1,
'webforge-configuration-tester.sublime-project' => 1,
'webmiltextlanguagedetectbundle.php' => 1,
'price.sublime-project' => 1,
'openppoauthserverbundle.php' => 1,
'sortercolumn.php' => 1,
'openppmapbundle.php' => 1,
'yii_production' => 1,
'seopanelmodule.php' => 1,
'feedbackmodule.php' => 1,
'jqtreewidgetasset.php' => 1,
'jqtreewidget.php' => 1,
'manymanyupdater.php' => 1,
'littlebighelper.php' => 1,
'gridpagesize.php' => 1,
'gridbulkactions.php' => 1,
'formfieldsvisibility.php' => 1,
'cropperhelper.php' => 1,
'statuscolumn.php' => 1,
'admindefaultcontroller.php' => 1,
'price.sublime-workspace' => 1,
'webuniasseticbundle.php' => 1,
'servers.yml' => 1,
'.gitignore.install' => 1,
'onlines.sql' => 1,
'paypal_ipn.sql' => 1,
'webstronautsreactbundle.php' => 1,
'webstronautspusherbundle.php' => 1,
'instacontent.class.php' => 1,
'.build.xml' => 1,
'.build.properties' => 1,
'.travis.bash' => 1,
'license-gpl-3.0' => 1,
'license-bsd-2-clause' => 1,
'caq.sh' => 1,
'widopfacebookjsbundle.php' => 1,
'widopframeworkextrabundle.php' => 1,
'migrate-1.8' => 1,
'callbackfilteriterator.php' => 1,
'wikibasequery.i18n.php' => 1,
'wikibasequery.i18n.aliases.php' => 1,
'resources.test.php' => 1,
'wikibasedatamodel.php' => 1,
'serialization.php' => 1,
'diff.mw.php' => 1,
'datavaluesjavascript.php' => 1,
'datatypes.mw.php' => 1,
'askserialization.php' => 1,
'ask.php' => 1,
'ask.mw.php' => 1,
'ask.i18n.php' => 1,
'hiera.yaml' => 1,
'wlfrmtwitterbootstrapbundle.php' => 1,
'querycli' => 1,
'webglue.php' => 1,
'wjzijderveldsculpinrelatedcontentbundle.php' => 1,
'smssign.php' => 1,
'smscore.php' => 1,
'ctmsend.php' => 1,
'antglob' => 1,
'wizinsimplecmsbundle.php' => 1,
'wizingeneratorbundle.php' => 1,
'wizinbasebundle.php' => 1,
'wizbiipipelinebundle.php' => 1,
'savchminkpageobjectbundle.php' => 1,
'wizachauniversignbundle.php' => 1,
'staging_bootstrap.php' => 1,
'wikibasequery.php' => 1,
'init.mw.php' => 1,
'development_bootstrap.php' => 1,
'dataset.yaml' => 1,
'versionpress-functions.php' => 1,
'wozberedirectbundle.php' => 1,
'wowoqueuebundle.php' => 1,
'queueimplementationinterface.php' => 1,
'wowonewsletterbundle.php' => 1,
'serializeattributesbehavior.php' => 1,
'symfonyslackbotbundle.php' => 1,
'classlist' => 1,
'wtkvideobundle.php' => 1,
'videofile.php' => 1,
'authchoice.php' => 1,
'plate.php' => 1,
'woppkeyvaluebundle.php' => 1,
'woothee' => 1,
'resources.tests.php' => 1,
'rpcschema.yml' => 1,
'rpc.yml' => 1,
'wwglobalcontainerbundle.php' => 1,
'sessiontable.sql' => 1,
'tinymcecontroller.php' => 1,
'tinymcecodemirrorasset.php' => 1,
'simple-app-task-def.json' => 1,
'nginx-site.conf' => 1,
'smscounter.php' => 1,
'wobblecoderestbundle.php' => 1,
'changelong' => 1,
'.gitingnore' => 1,
'rid.php' => 1,
'wmdsmindbodyapibundle.php' => 1,
'production_bootstrap.php' => 1,
'wispira.php' => 1,
'githubhookprovider.php' => 1,
'articlefeedbackv5.activity.php' => 1,
'specialarticlefeedbackv5.php' => 1,
'articlefeedbackv5.utils.php' => 1,
'articlefeedbackv5.render.php' => 1,
'articlefeedbackv5.php' => 1,
'articlefeedbackv5.permissions.php' => 1,
'articlefeedbackv5.model.php' => 1,
'articlefeedbackv5.mailerjob.php' => 1,
'articlefeedbackv5.log.php' => 1,
'articlefeedbackv5.i18n.php' => 1,
'articlefeedbackv5.hooks.php' => 1,
'articlefeedbackv5.flagging.php' => 1,
'articlefeedbackv5.backend.lbfactory.php' => 1,
'articlefeedbackv5.alias.php' => 1,
'xenon-log.yaml' => 1,
'semantichighcharts.i18n.php' => 1,
'xenon-log.conf' => 1,
'xenon-log' => 1,
'xenon-generate-svgs' => 1,
'arclamp.php' => 1,
'wbgisgraphybundle.php' => 1,
'gisgraphyaddress.php' => 1,
'wbelasticabundle.php' => 1,
'elasticaclient.php' => 1,
'datatablesassets.php' => 1,
'express.class.php' => 1,
'gymrss.php' => 1,
'widoptwigextensionsbundle.php' => 1,
'widopphpbbbundle.php' => 1,
'specialarticlefeedbackv5watchlist.php' => 1,
'semantichighcharts.php' => 1,
'wireshell' => 1,
'bazingajstranslationbundle.php' => 1,
'winzoutntexpressbundle.php' => 1,
'winzoustatemachinebundle.php' => 1,
'winzouebaysdkbundle.php' => 1,
'winzoucachebundle.php' => 1,
'cachefactory.php' => 1,
't.bat' => 1,
'queryadapter.php' => 1,
'phpeffi.cli.php' => 1,
'joke.php' => 1,
'carminatogooglecsebundle.php' => 1,
'hateoas.xsd' => 1,
'bazingarestextrabundle.php' => 1,
'bazingaoauthserverbundle.php' => 1,
'bazingahateoasbundle.php' => 1,
'semantichighcharts.settings.php' => 1,
'bazingafakerbundle.php' => 1,
'amazonproductapi.php' => 1,
'blade' => 1,
'generic.css' => 1,
'infusionsoft.ini.dist' => 1,
'test_keys.json.example' => 1,
'wikppaymentmtgoxbundle.php' => 1,
'formats' => 1,
'sidebarmenu.settings.php' => 1,
'sidebarmenu.php' => 1,
'sidebarmenu.i18n.php' => 1,
'semanticsifter.php' => 1,
'semanticsifter.i18n.php' => 1,
'semanticsifter.i18n.magic.php' => 1,
'config.sublime-project' => 1,
'migrate-1.7' => 1,
'behataliceloader.php' => 1,
'kp.php' => 1,
'anubis.php' => 1,
'jwgl.php' => 1,
'libraryajax.php' => 1,
'eswis.php' => 1,
'vtedpearybundle.php' => 1,
'signpass' => 1,
'unisender_api.php' => 1,
'klbasebundle.php' => 1,
'.maintenance.php' => 1,
'laravel-translation-manager.wiki' => 1,
'generators.wiki' => 1,
'patch.php' => 1,
'vpxseobundle.php' => 1,
'tdnforgebundle.php' => 1,
'baseuser.php' => 1,
'unit_tests' => 1,
'readme_2' => 1,
'purifierbehavior.php' => 1,
'consolerunner.php' => 1,
'xeditableassets.php' => 1,
'tinymcefield.php' => 1,
'select2field.php' => 1,
'select2assets.php' => 1,
'customassets.php' => 1,
'messagerasset.php' => 1,
'messager.php' => 1,
'vfgocardlessenterprisebundle.php' => 1,
'scrollpagerwrapper.php' => 1,
'baseloginform.php' => 1,
'baseuserquery.php' => 1,
'copyvaluebehavior.php' => 1,
'c33smenubundle.php' => 1,
'todo-sql-dump' => 1,
'todo-customer-repair' => 1,
'asapotidybundle.php' => 1,
'whatools.inc.php' => 1,
'holt45.php' => 1,
'simple_test.php' => 1,
'gamifyws.php' => 1,
'stirling' => 1,
'filtertab.php' => 1,
'columnstab.php' => 1,
'softdelete.php' => 1,
'c33ssimplegallerybundle.php' => 1,
'c33ssimplecontentbundle.php' => 1,
'c33scontactformbundle.php' => 1,
'timestampbehavior.php' => 1,
'c33ssymfonyconfigmanipulatorbundle.php' => 1,
'c33sconstructionkitbundle.php' => 1,
'c33sattachmentbundle.php' => 1,
'c33sattachmentadminbundle.php' => 1,
'daemonexception.php' => 1,
'vvgfilterlistbundle.php' => 1,
'testing.php' => 1,
'markdowncacheexception.php' => 1,
'markdowncache.php' => 1,
'boxer.php' => 1,
'hmvcfilter.php' => 1,
'hmvccomponent.php' => 1,
'relatedrecordtrait.php' => 1,
'relatedrecord.php' => 1,
'scrollpagerasset.php' => 1,
'numbers.php' => 1,
'php-array-kit.php' => 1,
'edvfilebundle.php' => 1,
'voce-error-logging.php' => 1,
'voce-color-setting.php' => 1,
'voce-cached-nav.php' => 1,
'post-selection-ui.php' => 1,
'post-selection-ui.js' => 1,
'post-selection-ui.css' => 1,
'objects-to-objects.php' => 1,
'no-stampede-actions.php' => 1,
'nginx-secure-media.php' => 1,
'df' => 1,
'vmelnikdoctrineencryptbundle.php' => 1,
'.psysh.php' => 1,
'edvfileevents.php' => 1,
'cacert.php' => 1,
'voce-image-setting.php' => 1,
'.shippable.yml' => 1,
'featuretogglebundle.php' => 1,
'ladelaslickgridbundle.php' => 1,
'ladelarequirejsbundle.php' => 1,
'ladelajqueryuibundle.php' => 1,
'ladelajquerybundle.php' => 1,
'ladelaformbundle.php' => 1,
'ladelabootstrapbundle.php' => 1,
'phpdocver' => 1,
'adduseraction.php' => 1,
'vivaittagbundle.php' => 1,
'vivaitworkercommandbundle.php' => 1,
'vivaitsmsmailerbundle.php' => 1,
'voce-featured-posts.php' => 1,
'voce-media-setting.php' => 1,
'executioner.php' => 1,
'wp-media-modal.php' => 1,
'editor.php' => 1,
'alive.php' => 1,
'notifiable.php' => 1,
'configregistry.php' => 1,
'yandexstrategy.php' => 1,
'command.example.php' => 1,
'gotopanel.php' => 1,
'extensionslist.php' => 1,
'gettext-extractor.php' => 1,
'wp-twitter-cards.php' => 1,
'metabox.js' => 1,
'pluginloader.php' => 1,
'wp-multisite-sso.php' => 1,
'wp-media-modal.js' => 1,
'voce-post-expiration.php' => 1,
'wp-large-options.php' => 1,
'wp-generate-new-image-sizes.php' => 1,
'wp-composition.php' => 1,
'class-wp-dependency-loader.php' => 1,
'wp-contextual-help.php' => 1,
'wp-cache-bucket.php' => 1,
'voce-widget-cache.php' => 1,
'voce-theme-customizer.php' => 1,
'voce-post-pdfs.php' => 1,
'voce-post-meta.php' => 1,
'voce-post-meta-psu.php' => 1,
'voce-post-meta-media.php' => 1,
'voce-post-meta-colors.php' => 1,
'voce-post-meta-colors.js' => 1,
'viewerpdf.php' => 1,
'uploads.sql' => 1,
'migrate-1.4' => 1,
'webeithspamassassinbundle.php' => 1,
'entity_views.routing.yml' => 1,
'entity_views.module' => 1,
'entity_views.info.yml' => 1,
'circle-checkout.sh' => 1,
'webfactorywfdmetabundle.php' => 1,
'metaqueryfactory.php' => 1,
'metaquery.php' => 1,
'webfactorypiwikbundle.php' => 1,
'webfactorynavigationbundle.php' => 1,
'webfactorylegacyintegrationbundle.php' => 1,
'webfactoryicutranslationbundle.php' => 1,
'webfactoryexceptionsbundle.php' => 1,
'billowrap.php' => 1,
'webeithimapbundle.php' => 1,
'entity_views.views.inc' => 1,
'webeithdnsblbundle.php' => 1,
'webdevviepheanstalktaskqueuebundle.php' => 1,
'webdevviepushoverbundle.php' => 1,
'sanalpos_yapikredi.php' => 1,
'sanalpos_denizbank3d.php' => 1,
'amazons3bundle.php' => 1,
'.conveyor' => 1,
'conveyor.yml.dist' => 1,
'webburzasyliusgoogleecommercebundle.php' => 1,
'webburzasyliusarticlebundle.php' => 1,
'新建 文本文档' => 1,
'updateassets' => 1,
'webdevignformbundle.php' => 1,
'entity_views.services.yml' => 1,
'micro.info.yml' => 1,
'organize' => 1,
'fastbill-api.sublime-project' => 1,
'webforge-collections.sublime-project' => 1,
'webforge-accounting.sublime-project' => 1,
'webforge-serializer.sublime-project' => 1,
'migrate-1.9.xx' => 1,
'migrate-1.8.xx' => 1,
'migrate-1.7.xx' => 1,
'migrate-1.6.xx' => 1,
'migrate-1.5.xx' => 1,
'migrate-1.4.xx' => 1,
'migrate-1.3.xx' => 1,
'migrate-1.2.xx' => 1,
'psc-cms-image.sublime-project' => 1,
'minimock.sublime-project' => 1,
'roboto.scss' => 1,
'micro.links.action.yml' => 1,
'roboto.min.css' => 1,
'roboto.less' => 1,
'roboto.css' => 1,
'open-sans.scss' => 1,
'open-sans.min.css' => 1,
'open-sans.less' => 1,
'open-sans.css' => 1,
'micro.services.yml' => 1,
'micro.routing.yml' => 1,
'micro.permissions.yml' => 1,
'micro.module' => 1,
'micro.links.task.yml' => 1,
'micro.links.menu.yml' => 1,
'micro.links.contextual.yml' => 1,
'geobundle.php' => 1,
'blazy-documentation.html' => 1,
'wnetouseragentbundle.php' => 1,
'function.imagecreatefrombmp.php' => 1,
'options.ru_ru.ini' => 1,
'morphy.php' => 1,
'russianplurality.php' => 1,
'russiannamesdeclension.php' => 1,
'russiangeneraldeclension.php' => 1,
'russiancases.php' => 1,
'russian.php' => 1,
'englishplurality.php' => 1,
'cases.php' => 1,
'basicplurality.php' => 1,
'basicnamesdeclension.php' => 1,
'basicdeclension.php' => 1,
'multithreading.png' => 1,
'imageeditortools.php' => 1,
'serverstat.conf' => 1,
'imageeditor.php' => 1,
'ccomponent.php' => 1,
'fork' => 1,
'wanupsmlrabbitmqbundle.php' => 1,
'mysqldb.class.php' => 1,
'wanadevseobundle.php' => 1,
'walterraj4p5bundle.php' => 1,
'suite.sh' => 1,
'suite.php' => 1,
'elasticsearch-indexer.php' => 1,
'next_version' => 1,
'.phppm.yml' => 1,
'waldodatatablebundle.php' => 1,
'onecloudapi.php' => 1,
'archive.bat' => 1,
'background-size.min.htc' => 1,
'jpusher.php' => 1,
'webridgeoauth2accessbundle.php' => 1,
'eg.yml' => 1,
'bench' => 1,
'corleyrc4bundle.php' => 1,
'corleyversionbundle.php' => 1,
'corleymaintenancebundle.php' => 1,
'configloader.php' => 1,
'nestedsetquerybehavior.php' => 1,
'tradeoffers.php' => 1,
'steamexception.php' => 1,
'steamcommunity.php' => 1,
'market.php' => 1,
'sqlqueue.php' => 1,
'asynctaskasset.php' => 1,
'configurationerror.php' => 1,
'nativepay.php' => 1,
'micropay.php' => 1,
'googleauthenticator.php' => 1,
'igtbatch.php' => 1,
'igetui.php' => 1,
'wasp.class.php' => 1,
'wa72simplelogger.php' => 1,
'prettymin.php' => 1,
'errbit.php' => 1,
'citrix.php' => 1,
'flatasset.php' => 1,
'code-report' => 1,
'networkerror.php' => 1,
'filesystemerror.php' => 1,
'smirikbootstrapbundle.php' => 1,
'pipelineparserbundle.php' => 1,
'bow' => 1,
'falgunphantombundle.php' => 1,
'instancedecoderinterface.php' => 1,
'instancedecoder.php' => 1,
'wixframeworkbundle.php' => 1,
'sampleranjeet.php' => 1,
'rdvmigrationbundle.php' => 1,
'ramseysculpincodeblockbundle.php' => 1,
'convertlistener.php' => 1,
'rampforumbundle.php' => 1,
'raml2html' => 1,
'ramiropdosybasebundle.php' => 1,
'mime.types.php' => 1,
'phpstorm.yml' => 1,
'raksuldoctrinesettypebundle.php' => 1,
'imagetool.php' => 1,
'dumbo.bat' => 1,
'example-webpage.php' => 1,
'example-webpage-new.php' => 1,
'example-plugin-img-resize.php' => 1,
'example-plugin-compress.php' => 1,
'example-nested-loop.php' => 1,
'example-multiple-template-directories.php' => 1,
'example-extend-class.php' => 1,
'example-draw-string.php' => 1,
'example-bootstrap.php' => 1,
'example-all.php' => 1,
'raindropuploadbundle.php' => 1,
'raindroptwigloaderbundle.php' => 1,
'raindroptranslationbundle.php' => 1,
'dumbo' => 1,
'dumbophp.php' => 1,
'raindropsoapbundle.php' => 1,
'fastlivefilterasset.php' => 1,
'authorise-application.php' => 1,
'.config_blank.json' => 1,
'albopenidserverbundle.php' => 1,
'quickstart.sh' => 1,
'baffordelasticaextrabundle.php' => 1,
'twbsmaxlength.php' => 1,
'sidrasset.php' => 1,
'sidr.php' => 1,
'jpanelmenuasset.php' => 1,
'jpanelmenu.php' => 1,
'html5sortable.php' => 1,
'guidersasset.php' => 1,
'guiders.php' => 1,
'fastlivefilter.php' => 1,
'swactiverecord.php' => 1,
'bgswitcherasset.php' => 1,
'bgswitcher.php' => 1,
'scenario' => 1,
'swyedconverterdom.php' => 1,
'swyedconverter.php' => 1,
'swworkflowsource.php' => 1,
'swvalidator.php' => 1,
'swphpworkflowsource.php' => 1,
'swnode.php' => 1,
'swhelper.php' => 1,
'swexception.php' => 1,
'swevent.php' => 1,
'swcomponent.php' => 1,
'swactiverecordbehavior.php' => 1,
'raindropsyntaxhighlightbundle.php' => 1,
'raindroppagebundle.php' => 1,
'test_individual.php' => 1,
'driverfactory.php' => 1,
'tssautomailerbundle.php' => 1,
'tssassetsinstallwindowsbundle.php' => 1,
'contributing.mb' => 1,
'changelog.mb' => 1,
'inflection.php' => 1,
'providerinterface.php' => 1,
'oauthproviderfactory.php' => 1,
'abstractoauthprovider.php' => 1,
'abstractformatter.php' => 1,
'abstractadapter.php' => 1,
'handlerinterface.php' => 1,
'abstracthandler.php' => 1,
'definitionresolver.php' => 1,
'bundles.php' => 1,
'example_hook2.php' => 1,
'categoriesbundle.php' => 1,
'cakeormbundle.php' => 1,
'rbac.php' => 1,
'userdetails.php' => 1,
'authenticationproviderinterface.php' => 1,
'abstractrepository.php' => 1,
'abstractauthenticationprovider.php' => 1,
'radmasvichjmsintegrationbundle.php' => 1,
'caramel.php' => 1,
'licenca' => 1,
'update_1.1.sql' => 1,
'handlebars.php' => 1,
'standardize' => 1,
'example_hook.php' => 1,
'sari.php' => 1,
'raindropmobiledetectbundle.php' => 1,
'virtalimplixapibundle.php' => 1,
'activedevice.php' => 1,
'raindroplocalebundleevents.php' => 1,
'raindroplocalebundle.php' => 1,
'raindropimportbundle.php' => 1,
'raindropgeoipbundle.php' => 1,
'pangulize' => 1,
'pangulizer.php' => 1,
'tweech.php' => 1,
'amazonstrategy.php' => 1,
'jsonrpcresponse.php' => 1,
'jsonrpcrequest.php' => 1,
'jsonrpccall.php' => 1,
'virtalgoogleapibundle.php' => 1,
'settingstrait.php' => 1,
'rcdualloginwpfosbundle.php' => 1,
'settingsform.php' => 1,
'materialdesignliteasset.php' => 1,
'subconta.php' => 1,
'basic' => 1,
'rgoubootstrapbundle.php' => 1,
'rcphpcrseobundle.php' => 1,
'rcphpcrreordernodesbundle.php' => 1,
'rcopensslcryptobundle.php' => 1,
'rcphpcrrouteeventsbundle.php' => 1,
'rcphpcrmenunodefromroutesbundle.php' => 1,
'rcphpcrfileattachinlinebundle.php' => 1,
'rcphpcrautositemapbundle.php' => 1,
'rcgooglebundle.php' => 1,
'rcelasticsearchphpcrproviderbundle.php' => 1,
'redirect-handler.php' => 1,
'sidebarasset.php' => 1,
'beanstalkexception.php' => 1,
'smallgraph.php' => 1,
'tocgen.php' => 1,
'.tocgen' => 1,
'ribcage.php' => 1,
'donate.php' => 1,
'buy.php' => 1,
'complete.php' => 1,
'checker.yml.dist' => 1,
'checker.yml' => 1,
'check-tool' => 1,
'realtyhubinvoicepainterbundle.php' => 1,
'realtyhubbootstrapbundle.php' => 1,
'buildall.cmd' => 1,
'smallstacked.php' => 1,
'naked.php' => 1,
'bases.php' => 1,
'homepage3.php' => 1,
'example9.php' => 1,
'example8.php' => 1,
'example7.php' => 1,
'example6.php' => 1,
'example5.php' => 1,
'example26.php' => 1,
'example25.php' => 1,
'example24.php' => 1,
'example23.php' => 1,
'example22.php' => 1,
'example21.php' => 1,
'example20.php' => 1,
'tocgen.sh' => 1,
'chrono.php' => 1,
'example18.php' => 1,
'beautifyhtml.php' => 1,
'love redkitecms (powered by link)' => 1,
'redkitelabselfinderbundle.php' => 1,
'redkitelabsbootstrapbundle.php' => 1,
'.twigjs.yml.dist' => 1,
'.pre-commit.yaml' => 1,
'redcodecurrencyratebundle.php' => 1,
'templixexception.php' => 1,
'templix.php' => 1,
'markupexception.php' => 1,
'doctype.php' => 1,
'cssselector.php' => 1,
'callermarkup.php' => 1,
'cdata.php' => 1,
'abstraction.php' => 1,
'clicolors.php' => 1,
'matchinterface.php' => 1,
'frontcontroller.php' => 1,
'robots_ssl' => 1,
'robots_cdn' => 1,
'redcat.php' => 1,
'artist' => 1,
'.config.php' => 1,
'gettext_reader.php' => 1,
'__.php' => 1,
'gettextemulator.php' => 1,
'acceptlanguage.php' => 1,
'password-compat.inc.php' => 1,
'expanderinterface.php' => 1,
'calltrait.php' => 1,
'example19.php' => 1,
'example17.php' => 1,
'sidebarnav.php' => 1,
'jeazyuserbundle.php' => 1,
'r.js' => 1,
'razorpay.php' => 1,
'razmomediabundle.php' => 1,
'string-buffer.php' => 1,
'nan.php' => 1,
'leon.php' => 1,
'infinity.php' => 1,
'raynetcrm.php' => 1,
'license.symfony' => 1,
'license.slim' => 1,
'license.phly' => 1,
'jasmini.phar' => 1,
'guzzlejsonauth.php' => 1,
'moderntheme.php' => 1,
'markdownforms.php' => 1,
'symfony2plugin.php' => 1,
'extraplugin.php' => 1,
'ints.php' => 1,
'samples.sh' => 1,
'distill-cli' => 1,
'clashofclansbundle.php' => 1,
'ratepaypaymentbundle.php' => 1,
'ratchetio.php' => 1,
'papprika.php' => 1,
'custom-admin-language.php' => 1,
'rasflashalertbundle.php' => 1,
'basic_functions.php' => 1,
'raplbundle.php' => 1,
'init_autoload.php' => 1,
'phpthumb.config.php' => 1,
'example16.php' => 1,
'reactorcodersymfony2nodesocketbundle.php' => 1,
'example15.php' => 1,
'example14.php' => 1,
'example13.php' => 1,
'example12.php' => 1,
'example11.php' => 1,
'example10.php' => 1,
'markdownify_extra.php' => 1,
'markdownify_cli.php' => 1,
'markdownify.php' => 1,
'license_lgpl' => 1,
'realestatesolrbundle.php' => 1,
'realestateconzapiclientbundle.php' => 1,
'upgrade-0.3' => 1,
'reactjs.php' => 1,
'pico_load_plugins_composer.php' => 1,
'rdrenthtwigextensionbundle.php' => 1,
'rdrenthtvragebundle.php' => 1,
'dmstwigextensionbundle.php' => 1,
'dmsmeetupapibundle.php' => 1,
'asgi' => 1,
'redeyestormpathbundle.php' => 1,
'applicationfinder.php' => 1,
'variations_default.php' => 1,
'rcamchartsbundle.php' => 1,
'rcccsimplepagebundle.php' => 1,
'rcccjqueryautocompletebundle.php' => 1,
'rc2cthecallrbundle.php' => 1,
'rc2cformtwitterbundle.php' => 1,
'pico_markdown_forms.php' => 1,
'consolecontroller.php' => 1,
'beanstalk.php' => 1,
'migrate-an-alphalemon-cms-theme-to-redkite-cms' => 1,
'provisioner_license' => 1,
'psamattservicebuslitebundle.php' => 1,
'withmagicmethodtrait.php' => 1,
'mailfacade.php' => 1,
'langserviceprovider.php' => 1,
'langfacade.php' => 1,
'kerneltrait.php' => 1,
'viewfilenotfoundexception.php' => 1,
'servicealiasnotfoundexception.php' => 1,
'controllernotfoundexception.php' => 1,
'accessnotallowedexception.php' => 1,
'slayercommand.php' => 1,
'proyecto404utilbundle.php' => 1,
'merge_data.php' => 1,
'mixpanelextended.php' => 1,
'jparser.komodoproject' => 1,
'errorlog.html' => 1,
'wai-aria.js' => 1,
'aria-walker-nav-menu.php' => 1,
'protectimus_otp_authentication.php' => 1,
'example.pot.json' => 1,
'prepare_tests.sh' => 1,
'license.phing' => 1,
'license.propel' => 1,
'propelaclbundle.php' => 1,
'pqsdk.php' => 1,
'bz_category_sticky.php' => 1,
'feature_lock.module' => 1,
'feature_lock.info' => 1,
'psamattyamlexportbundle.php' => 1,
'migrate-2.2' => 1,
'prolixmailchimpbundle.php' => 1,
'metatitle.php' => 1,
'pspdfbundle.php' => 1,
'tagswidget.php' => 1,
'tinytable4ward.php' => 1,
'tablewizard4ward.php' => 1,
'settingshelper.php' => 1,
'modulesettings.php' => 1,
'pageerror404_redirect4ward.php' => 1,
'htaccessredirect4ward.php' => 1,
'quickjump4ward.php' => 1,
'tagshelper.php' => 1,
'relatedhelper.php' => 1,
'multicategorieshelper.php' => 1,
'mostreadhelper.php' => 1,
'commentshelper.php' => 1,
'migrate-2.3' => 1,
'categorieshelper.php' => 1,
'authormenuhelper.php' => 1,
'archivemenuhelper.php' => 1,
'contentjslidegallery.php' => 1,
'contaolivereload.php' => 1,
'lesscssmod.php' => 1,
'contentcegroupstop.php' => 1,
'contentcegroup.php' => 1,
'modulelightbox4wardautoopen.php' => 1,
'contentlightbox4ward.php' => 1,
'policytemplateserviceprovider.php' => 1,
'serien-loader-client.sublime-project' => 1,
'psc-cms-word.sublime-project' => 1,
'psc-cms-boot.sublime-project' => 1,
'feature_lock.api.php' => 1,
'restmodelcontroller.php' => 1,
'vagrant.json' => 1,
'config-advanced.ini' => 1,
'datacollectioninterface.php' => 1,
'assetinterface.php' => 1,
'assetcomposerinterface.php' => 1,
'assetcomposer.php' => 1,
'routemanagerinterface.php' => 1,
'routeabstract.php' => 1,
'chainmanagerinterface.php' => 1,
'chainmanager.php' => 1,
'chaineventinterface.php' => 1,
'chaineventabstract.php' => 1,
'stage.php' => 1,
'pecl-manager.php' => 1,
'pear-manager.php' => 1,
'gearmanpeclmanager.php' => 1,
'priorityqueue.php' => 1,
'gearmanpearmanager.php' => 1,
'gearmanmanager.php' => 1,
'extactiverecord.php' => 1,
'extarcontroller.php' => 1,
'privacyidea.json' => 1,
'prismicbundle.php' => 1,
'none_composer_loader.php' => 1,
'prime' => 1,
'devlog' => 1,
'.gitmergetool' => 1,
'.docpx' => 1,
'snapshottablebehaviorobjectbuildermodifier.php' => 1,
'snapshottablebehavior.php' => 1,
'datacollectiontrait.php' => 1,
'mathphp.php' => 1,
'mongodataconnection.php' => 1,
'env' => 1,
'modelloader.php' => 1,
'modelcontroller.php' => 1,
'iosmodelinterpreter.php' => 1,
'generatedrestmodelcontrollerloader.php' => 1,
'errorresponsedictionary.php' => 1,
'errorresponse.php' => 1,
'directorymodelloader.php' => 1,
'directorycontrollerloader.php' => 1,
'defaultapplicationmodel.php' => 1,
'defaultapperrors.php' => 1,
'dataconnection.php' => 1,
'controllerloader.php' => 1,
'pmdocumentationbundle.php' => 1,
'srbacmodule.php' => 1,
'example.vcf' => 1,
'progrupasmsbundle.php' => 1,
'progrupaedifactbundle.php' => 1,
'valuemenu.php' => 1,
'menuoption.php' => 1,
'menuabstract.php' => 1,
'actionmenu.php' => 1,
'uploadurlresponse.php' => 1,
'b2file.php' => 1,
'b2.php' => 1,
'tabledumper.php' => 1,
'databasedumper.php' => 1,
'write-test.php' => 1,
'example3.0.vcf' => 1,
'example2.1.vcf' => 1,
'.env.defaults' => 1,
'easyrequest.php' => 1,
'lazycoding.php' => 1,
'quan-lang.js' => 1,
'quartetpaymentwebpaybundle.php' => 1,
'quartetpaymentmanuallybundle.php' => 1,
'tendo' => 1,
'exemplecli.php' => 1,
'brodevvietipsumbundle.php' => 1,
'user-profile.php' => 1,
'quan-userdata.php' => 1,
'userdata.php' => 1,
'profilepage.php' => 1,
'twitter.png' => 1,
'quan-tweet-to-post.php' => 1,
'postmeta.php' => 1,
'quan-language.php' => 1,
'landing-page.php' => 1,
'configureexception.php' => 1,
'landing-page.js' => 1,
'landingpage.php' => 1,
'quan-jobs.php' => 1,
'quan-jobs.js' => 1,
'opgoogleanalytics.php' => 1,
'quan-image-caption.php' => 1,
'quan-blockquote.php' => 1,
'createcpt.php' => 1,
'boilerplate.php' => 1,
'mage_modman_generator.sh' => 1,
'quaderno_webhook.php' => 1,
'quaderno_tax.php' => 1,
'quaderno_recurring.php' => 1,
'.bump-version.php' => 1,
'mockfunction.php' => 1,
'quaderno_model.php' => 1,
'jpgraph.php' => 1,
'schemando' => 1,
'autoloadforphpunit.php' => 1,
'ingest.php' => 1,
'r1pp3rj4ckgooglebundle.php' => 1,
'ridpagebundle.php' => 1,
'ridimagetestcase.php' => 1,
'ridimagebundle.php' => 1,
'how to create templates' => 1,
'rithisaddthisbundle.php' => 1,
'phpword.php' => 1,
'cloudsearchsearch.php' => 1,
'cloudsearchclient.php' => 1,
'modulenotfoundexception.php' => 1,
'rtmpstream.class.php' => 1,
'mockfunctiontest.php' => 1,
'rtmpsocket.class.php' => 1,
'rtmppacket.class.php' => 1,
'rtmpoperation.class.php' => 1,
'rtmpmessage.class.php' => 1,
'rtmpclient.class.php' => 1,
'language.config.php' => 1,
'wikparser.php' => 1,
'idlabtoolboxbundle.php' => 1,
'quiubas.php' => 1,
' .gitattributes' => 1,
'readme.cmd' => 1,
'ztest.php' => 1,
'splitter.php' => 1,
'qlfontawesomebundle.php' => 1,
'quaderno_payment.php' => 1,
'quaderno_load.php' => 1,
'urlrule.php' => 1,
'keeper.php' => 1,
'introjs.php' => 1,
'pvesseltableconverterbundle.php' => 1,
'opc.php' => 1,
'dns.inc.php' => 1,
'probesysvalidateschemabundle.php' => 1,
'godcodesbundle.php' => 1,
'vcloudsdkforphp-license.docx' => 1,
'license-cc-by' => 1,
'phpunit-stubs.xml' => 1,
'servicefactoryinterface.php' => 1,
'globalcontainer.php' => 1,
'punic.php' => 1,
'wmxml.php' => 1,
'contract.php' => 1,
'parseargs.php' => 1,
'streamer.php' => 1,
'useragents.php' => 1,
'nagios.phar' => 1,
'check_load' => 1,
'dubtureffmpegbundle.php' => 1,
'dubturecustomeriobundle.php' => 1,
'dubtureasyncbundle.php' => 1,
'git-s3' => 1,
'pulibundle.php' => 1,
'pug' => 1,
'pubnub.com.pem' => 1,
'storage.json' => 1,
'charmap.php' => 1,
'commandline.php' => 1,
'dynamodbsession.php' => 1,
'quaderno_json.php' => 1,
'qimnetupdatetrackerbundle.php' => 1,
'quaderno_item.php' => 1,
'quaderno_invoice.php' => 1,
'quaderno_expense.php' => 1,
'quaderno_estimate.php' => 1,
'quaderno_document_item.php' => 1,
'quaderno_document.php' => 1,
'quaderno_credit.php' => 1,
'quaderno_contact.php' => 1,
'quaderno_class.php' => 1,
'quaderno_base.php' => 1,
'vextextension.aux' => 1,
'rifilemanagerbundle.php' => 1,
'qimnetupdatetrackertestbundle.php' => 1,
'qimnettablebundle.php' => 1,
'entityhiddentypebundle.php' => 1,
'qimnetsolrclienttestbundle.php' => 1,
'qimnetsolrclientbundle.php' => 1,
'qimnetpaginatorbundle.php' => 1,
'qimnetcrudbundle.php' => 1,
'videomatacmsimperaviredactorpluginasset.php' => 1,
'tablematacmsimperaviredactorpluginasset.php' => 1,
'linkmatacmsimperaviredactorpluginasset.php' => 1,
'imagematacmsimperaviredactorpluginasset.php' => 1,
'tita.php' => 1,
'cview.php' => 1,
'ccontroller.php' => 1,
'capplication.php' => 1,
'autocomplete2.jquery.json' => 1,
'qckraydibundle.php' => 1,
'migrate-an-alphalemon-cms-block-to-redkite-cms' => 1,
'migrate-from-alphalemon-cms-to-redkite-cms' => 1,
'basecrm.php' => 1,
'run_test.bat' => 1,
'jsr_server.h' => 1,
'jsr_server.c' => 1,
'jsr_list.h' => 1,
'jsr_list.c' => 1,
'jsr_epoll.h' => 1,
'jsr_epoll.c' => 1,
'jsr_curl.h' => 1,
'jsr_curl.c' => 1,
'jsr_client.h' => 1,
'jsr_client.c' => 1,
'jsonrpc.c' => 1,
'boot-sqlite.php' => 1,
'boot-mysql.php' => 1,
'digitalframedatetimepickerbundle.php' => 1,
'jsr_utils.h' => 1,
'delete-branches.sh' => 1,
'ghuntihighchartsphpbundle.php' => 1,
'fly.yaml' => 1,
'get-composer.sh' => 1,
'library.tpl' => 1,
'lib.uuid.php' => 1,
'changelog-prefork' => 1,
'rouffjhowtobundle.php' => 1,
'rotvulpixtransbankbundle.php' => 1,
'productvalidator.class.php' => 1,
'tuckconverterbundle.php' => 1,
'configformatconverter.php' => 1,
'phrocco' => 1,
'jsr_utils.c' => 1,
'jsr_yajl.c' => 1,
'root.extensions.composer.json' => 1,
'bcmath.php' => 1,
'dutchnumbers.php' => 1,
'rubenrubiobsimpleapicallerbundle.php' => 1,
'php_serial.class.php' => 1,
'postalcode.php' => 1,
'ostmanytoonebundle.php' => 1,
'examplecsv.png' => 1,
'happen.php' => 1,
'_.todo' => 1,
'redis-purger.php' => 1,
'purger.php' => 1,
'nginx-helper.php' => 1,
'travis_install_dependencies.sh' => 1,
'timers.class.php' => 1,
'voucherifyclient.php' => 1,
'jsr_yajl.h' => 1,
'voucherbuilder.php' => 1,
'clientexception.php' => 1,
'fuelcell.gemspec' => 1,
'sample.eecli.php' => 1,
'sample.craft-cli.php' => 1,
'github-release.sh' => 1,
'bootstrap-ee3.php' => 1,
'bootstrap-ee2.php' => 1,
'yajl.php' => 1,
'yajl.c' => 1,
'php_yajl.h' => 1,
'php_cjson.h' => 1,
'cjson.c' => 1,
'php_jsonrpc.h' => 1,
'root.workbench.composer.json' => 1,
'pluginable.json' => 1,
'rudakcontactbundle.php' => 1,
'global-smtp.php' => 1,
'document.html' => 1,
'jsajaxfileuploaderasset.php' => 1,
'jsajaxfileuploader.php' => 1,
'jqueryupoadfilepluginasset.php' => 1,
'jqueryupoadfileplugin.php' => 1,
'dropzonefileuploaderasset.php' => 1,
'dropzonefileuploader.php' => 1,
'rfc2397' => 1,
'queryable' => 1,
'rcpaiementcmcicbundle.php' => 1,
'containerinjector.php' => 1,
'rresqueautoloader.php' => 1,
'confighandler.php' => 1,
'readme_pt_br' => 1,
'eauthmodule.php' => 1,
'uberloader.php' => 1,
'php-excel.class.php' => 1,
'jquery.zclip.js' => 1,
'zeroclipboard.swf' => 1,
'box-calculator.js' => 1,
'box-calculator-test.js' => 1,
'tsangularjsbundle.php' => 1,
'rofilsecurityserviceprovider.php' => 1,
'rofilbootstraptemplateserviceprovider.php' => 1,
'rofilcontentserviceprovider.php' => 1,
'rofilcontentrouteserviceprovider.php' => 1,
'class.smarty.php' => 1,
'class.login.php' => 1,
'bookmarksmodule.php' => 1,
'filesmodule.php' => 1,
'rthnotificationbundle.php' => 1,
'findmodeltrait.php' => 1,
'rthmotorbikebundle.php' => 1,
'wp-h5bp-htaccess.php' => 1,
'h5bp-htaccess.conf' => 1,
'soil.php' => 1,
'markdown-on-save.php' => 1,
'telegrambotapi.class.php' => 1,
'ltredisbundle.php' => 1,
'screenshot.jpeg' => 1,
'example-post.php' => 1,
'wp-rocket-cli.php' => 1,
'blinkertest.php' => 1,
'blinker' => 1,
'observe.php' => 1,
'php_56' => 1,
'likesmodule.php' => 1,
'php_55' => 1,
'php_54' => 1,
'snackbarjsnomatasset.php' => 1,
'snackbarjsasset.php' => 1,
'bootmaterialjsasset.php' => 1,
'bootmaterialcssasset.php' => 1,
'romaricdrigonorchestrabundle.php' => 1,
'ainnomixredisbundle.php' => 1,
'ainnomiximagebundle.php' => 1,
'mpr.php' => 1,
'belousovchatbundle.php' => 1,
'urijsasset.php' => 1,
'usersmodule.php' => 1,
'pagesmodule.php' => 1,
'rudakblogbundle.php' => 1,
'rudakdisclaimerbundle.php' => 1,
'.projections.json' => 1,
'datetimei18nbehavior.php' => 1,
'example-proxy-class.php' => 1,
'unsavedformwidget.php' => 1,
'yiismart.php' => 1,
'smartwebmodule.php' => 1,
'smartformmodel.php' => 1,
'smartdbcriteria.php' => 1,
'smartcontroller.php' => 1,
'smartconsolecommand.php' => 1,
'smartactiverecord.php' => 1,
'qtip2.php' => 1,
'yiiphpthumb.php' => 1,
'fullcalendareventgroup.php' => 1,
'i18nbehavior.php' => 1,
'viewaction.php' => 1,
'campfire.php' => 1,
'updateaction.php' => 1,
'deleteaction.php' => 1,
'createaction.php' => 1,
'vcode.php' => 1,
'sysinfo.php' => 1,
'russellkutilsbundle.php' => 1,
'gofsalesbundle.php' => 1,
'gofproductsbundle.php' => 1,
'russellkgallerybundle.php' => 1,
'russellkcategorybundle.php' => 1,
'gofcartbundle.php' => 1,
'countdownasset.php' => 1,
'countdown.php' => 1,
'sparklingadyenbundle.php' => 1,
'ruudkcampfireexceptionbundle.php' => 1,
'stripehelper.php' => 1,
'oauth2-readme' => 1,
'schemadump' => 1,
'db_config_example.json' => 1,
'phpbench' => 1,
'docmd' => 1,
'pupbundle.php' => 1,
'rybakitnavigationbundle.php' => 1,
'dandelion.sample.yml' => 1,
'mixin.php' => 1,
'emitter.php' => 1,
'aware.php' => 1,
'loci.php' => 1,
'chromosome.php' => 1,
'razorviewrenderer.php' => 1,
'eventbrite.php' => 1,
'ruudkmolliebundle.php' => 1,
'simplegeneticalgorithm.php' => 1,
'_mgc-event.php' => 1,
'markupgooglecalendar.module' => 1,
'googleclientapi.module' => 1,
'vocabularybundle.php' => 1,
'atomcmsbundle.php' => 1,
'deployable' => 1,
'test-console' => 1,
'jsonxml.xsd' => 1,
'framework.json' => 1,
'ruudymetroniccrudgeneratorbundle.php' => 1,
'sparklingvatbundle.php' => 1,
'ruudkpostmarkbundle.php' => 1,
'ruudkmoneybirdbundle.php' => 1,
'buttonsgroupinput.php' => 1,
'stripeform.php' => 1,
'layout_exemple' => 1,
'probability.php' => 1,
'test.11nk5.php' => 1,
'env.php.orig' => 1,
'test.vehicles.php' => 1,
'test.session.php' => 1,
'test.fuelups.php' => 1,
'test.fuelup.php' => 1,
'test.edit.php' => 1,
'env.php.original' => 1,
'kakubundle.php' => 1,
'htmlsectionfield.php' => 1,
'rudakpartnerbundle.php' => 1,
'urlmaker.php' => 1,
'syllabeur.php' => 1,
'namer.php' => 1,
'test.br-bounces.php' => 1,
'fakecontentgenerator.php' => 1,
'customcanonicalizer.php' => 1,
'cityhelper.php' => 1,
'baconipsum.php' => 1,
'rudakslugbundle.php' => 1,
'rudakrssbundle.php' => 1,
'rudakresizerbundle.php' => 1,
'rudakownloggerbundle.php' => 1,
'rudakmenubundle.php' => 1,
'rudakmaintenancebundle.php' => 1,
'rudakgallerybundle.php' => 1,
'fakedatageneratorbundle.php' => 1,
'rudakfacturebundle.php' => 1,
'test.br-autohelpdesk.php' => 1,
'test.gherkin.feature.php' => 1,
'stripecheckoutcustom.php' => 1,
'ruianseobundle.php' => 1,
'stripecheckout.php' => 1,
'ipbehavior.php' => 1,
'csvexporter.php' => 1,
'multipleimportstrategy.php' => 1,
'csvreader.php' => 1,
'csvimporter.php' => 1,
'baseimportstrategy.php' => 1,
'arimportstrategy.php' => 1,
'runcomeanvalidationbundle.php' => 1,
'smsproxy.php' => 1,
'portal.php' => 1,
'appserviceprovider.php' => 1,
'daplar' => 1,
'threema-msgapi-tool.php' => 1,
'test.gherkin.tablenode.php' => 1,
'resourceutil.php' => 1,
'moduleutil.php' => 1,
'old.composer.json' => 1,
'readme-jshrink' => 1,
'magicminifier.php' => 1,
'defaultcontroller.php' => 1,
'robo.php' => 1,
'rubiuscontentfulbundle.php' => 1,
'rubiusdatatablesbundle.php' => 1,
'locaload' => 1,
'autoload-dev.php' => 1,
'test.volume.php' => 1,
'test.temperature.php' => 1,
'test.mileage.php' => 1,
'class.geoip.php' => 1,
'symfonycontainerwithzffallback.php' => 1,
'redkitecmsbundle.php' => 1,
'rezzzasecuritybundle.php' => 1,
'rguservoicebundle.php' => 1,
'rgolarkbundle.php' => 1,
'rgmusculabundle.php' => 1,
'guibundle.php' => 1,
'awtbundle.php' => 1,
'guzzleservicedesc2to3.php' => 1,
'exportexcelbundle.php' => 1,
'functionaltests.xml' => 1,
'rfedmundsbundle.php' => 1,
'imagemagick.php' => 1,
'rezzzacommandbusbundle.php' => 1,
'rezzzashortybundle.php' => 1,
'rezzzasepabundle.php' => 1,
'rezzzarulerbundle.php' => 1,
'rhapsodyblogbundle.php' => 1,
'rezzzaprocessonebundle.php' => 1,
'rezzzapaymentbe2billbundle.php' => 1,
'rezzzamodelviolationloggerbundle.php' => 1,
'rezzzamailextrabundle.php' => 1,
'rezzzamailchimpbundle.php' => 1,
'rezzzalocalevoterbundle.php' => 1,
'rezzzajobflowbundle.php' => 1,
'rezzzaflickrbundle.php' => 1,
'slirconfig-sample.class.php' => 1,
'phpunit-debug.sh' => 1,
'wiki' => 1,
'example_simple.php' => 1,
'revinatesequencebundle.php' => 1,
'uservoicehelper.php' => 1,
'rhapsodybootstrapbundle.php' => 1,
'polygonalgraph.jquery.json' => 1,
'gnu-agpl-3.0' => 1,
'extendedcontroller.php' => 1,
'adaptiveview.php' => 1,
'wp-oo-nonces-plugin.php' => 1,
'pluggable-functions.php' => 1,
'rofil-2.php' => 1,
'rofi' => 1,
'rofiltemplatemasterbundle.php' => 1,
'instruction' => 1,
'oauth2client.php' => 1,
'rhosocial_test.bat' => 1,
'rhosocial_test' => 1,
'rhosocial.bat' => 1,
'rhosocial' => 1,
'index.phtml' => 1,
'rhapsodycommonsbundle.php' => 1,
'toaster.php' => 1,
'bitbucket.php' => 1,
'mozart.php' => 1,
'rheckmp3bundle.php' => 1,
'rheckdatatablebundle.php' => 1,
'rheckaccesscontrolbundle.php' => 1,
'rhapsodywikibundle.php' => 1,
'rhapsodysocialevents.php' => 1,
'rhapsodysocialbundle.php' => 1,
'rhapsodysetupbundle.php' => 1,
'rhapsodyphingbundle.php' => 1,
'rhapsodyforumevents.php' => 1,
'rhapsodyforumbundle.php' => 1,
'rhapsodycryptobundle.php' => 1,
'polygonalgraphwidget.js' => 1,
'compy.yml' => 1,
'pixelavengersextravalidatorbundle.php' => 1,
'jquery.checkboxes.js' => 1,
'dapsldapbundle.php' => 1,
'replication.services.yml' => 1,
'replication.info.yml' => 1,
'replication.drush.inc' => 1,
'replicator' => 1,
'git-deployer.sublime-project' => 1,
'najidevjavascriptdatabundle.php' => 1,
'sql23-09-15.sql' => 1,
'.build.yaml' => 1,
'seo_generator.php' => 1,
'docker-laravel.sublime-project' => 1,
'dashboard.css' => 1,
'jquery.timestamper.js' => 1,
'redsuns-timeline.php' => 1,
'easysysconnectormanager.php' => 1,
'quickfaq.php' => 1,
'email-config-sample.php' => 1,
'html_diff.php' => 1,
'nodes.php' => 1,
'rednoseyuibundle.php' => 1,
'rednosekerberosbundle.php' => 1,
'rednosecombohandlerbundle.php' => 1,
'rednoseapidocbundle.php' => 1,
'redmonsterannouncementbundle.php' => 1,
'redkitelabsthemeenginebundle.php' => 1,
'upgrade-to-symfony-2.3' => 1,
'upgrade-from-redkite-cms-1-1-1' => 1,
'update-from-redkite-cms-beta-1' => 1,
'serverloadbundle.php' => 1,
'remdaneasysysconnectorbundle.php' => 1,
'emysqlmutex.php' => 1,
'config.sample.json' => 1,
'efilemutex.php' => 1,
'edbmutex.php' => 1,
'ruleset.xml.dist' => 1,
'pharse_xml2array.php' => 1,
'pharse_tokenizer.php' => 1,
'pharse_selector_html.php' => 1,
'pharse_parser_html.php' => 1,
'pharse_node_html.php' => 1,
'pharse_formatter.php' => 1,
'pharse.php' => 1,
'filetableparser.php' => 1,
'researchsquarestrategy.php' => 1,
'phpnsc' => 1,
'reoringimagebundle.php' => 1,
'remedgeyandextranslatebundle.php' => 1,
'renusmediabundle.php' => 1,
'renuslasttweetbundle.php' => 1,
'themebootstrapbundle.php' => 1,
'phpexcelformatter.php' => 1,
'phpdoc.bat' => 1,
'depipe.yml.dist' => 1,
'configen' => 1,
'routeros_api.class.php' => 1,
'maremetlbundle.php' => 1,
'.qualitychecker.yml.dist' => 1,
'.qualitychecker.yml' => 1,
'bootstrapdatepicker.php' => 1,
'smartloader.php' => 1,
'riakbundle.php' => 1,
'restfulrouter.php' => 1,
'ricbradiscogsbundle.php' => 1,
'containerbridge.php' => 1,
'license.newbsd' => 1,
'rbadminbundle.php' => 1,
'doyoubuzzstrategy.php' => 1,
'ext-neptune.js' => 1,
'ext-neptune-debug.js' => 1,
'ext-neptune-debug-w-comments.js' => 1,
'timecircles.jquery.json' => 1,
'soap-wsa.php' => 1,
'soap-server-wsse.php' => 1,
'wp_import.php' => 1,
'html_to_markdown.php' => 1,
'slim.concept-class' => 1,
'r47twitter.php' => 1,
'r47sensioconnect.php' => 1,
'phpunittests.xml.dist' => 1,
'rbblogbundle.php' => 1,
'phpmanipulator.xml' => 1,
'checker.sh' => 1,
'git_contributor-activity.png' => 1,
'frontend.png' => 1,
'test.dat' => 1,
'project.sh' => 1,
'bcrypt_generator.php' => 1,
'xf' => 1,
'tinymceelfinderpopupaction.php' => 1,
'serverfileinputelfinderpopupaction.php' => 1,
'elfinderhelper.php' => 1,
'themoneyconverterexchangerates.php' => 1,
'redimlive.php' => 1,
'rbadminbundle___.php' => 1,
'rbbowerbundle.php' => 1,
'rnijveldsf2codebundle.php' => 1,
'parser.y' => 1,
'rodgermdstravaclientbundle.php' => 1,
'sofortbundle.php' => 1,
'contestnominationsbundle.php' => 1,
'rodgermduniquenotnullentitybundle.php' => 1,
'rodgermdsftoolsbundle.php' => 1,
'rodgermdmailchimpwrapperbundle.php' => 1,
'rodgermdibanapidebundle.php' => 1,
'rodgermdcompassbundle.php' => 1,
'pwgen.php' => 1,
'stc.php' => 1,
'short-tag-converter' => 1,
'growlnotifier.php' => 1,
'dbusnotifier.php' => 1,
'rodchynelephantbundle.php' => 1,
'rbcorebundle.php' => 1,
'tecbotamfbundle.php' => 1,
'rbuserbundle.php' => 1,
'rbtransbundle.php' => 1,
'rbshopbundle.php' => 1,
'rbproductbundle.php' => 1,
'rbproductadminbundle.php' => 1,
'rborderbundle.php' => 1,
'rborderadminbundle.php' => 1,
'rbnotebundle.php' => 1,
'rbmenubundle.php' => 1,
'rbfrontbundle.php' => 1,
'rbfixbundle.php' => 1,
'rbfixadminbundle.php' => 1,
'rbdevbundle.php' => 1,
'giftvoucher.php' => 1,
'steamstrategy.php' => 1,
'ricbrakissmetricsbundle.php' => 1,
'liveui.php' => 1,
'rithiswebsiteindexbundle.php' => 1,
'rithisbootstrapbundle.php' => 1,
'rutkaifeatureflipperbundle.php' => 1,
'sphinx-tool.php' => 1,
'help-img.png' => 1,
'banhmi-framework.php' => 1,
'ringophpredmonbundle.php' => 1,
'gh-pages_deploy.sh' => 1,
'oz.sql' => 1,
'bootstrap-paginator.latte' => 1,
'riki34symfonyangularentitiesbundle.php' => 1,
'sail-theme.yaml' => 1,
'liveui_html_page.php' => 1,
'class.liveui.php' => 1,
'yahoojpstrategy.php' => 1,
'magentoconnect.html' => 1,
'numbers2wordsbundle.php' => 1,
'notificatobundle.php' => 1,
'wiki.php' => 1,
'socialsecuritynumbervalidator.php' => 1,
'socialsecuritynumber.php' => 1,
'test-extensions.php' => 1,
'sassloader.php' => 1,
'tokenizerasset.php' => 1,
'box.json.sample' => 1,
'rdfjobdefinitionformatbundle.php' => 1,
'defaultautoload.php' => 1,
'ricbrarobotstxtbundle.php' => 1,
'mixistrategy.php' => 1,
'helper_functions.php' => 1,
'redditstrategy.php' => 1,
'letterexception.php' => 1,
'rmzamoraoauthbundle.php' => 1,
'rmzamorajquerybundle.php' => 1,
'rmzamoraformextensionbundle.php' => 1,
'rmzamorabootstrapbundle.php' => 1,
'cryptxxtea.php' => 1,
'ulogin.php' => 1,
'socicon.php' => 1,
'si.php' => 1,
'rbacmigration.php' => 1,
'rbacfactory.php' => 1,
'powermigration.php' => 1,
'viewletter.php' => 1,
'rawletter.php' => 1,
'letter.php' => 1,
'yuccainsituupdaterbundle.php' => 1,
'ionicon.php' => 1,
'fa.php' => 1,
'cdnassetbundle.php' => 1,
'imagewrapper.php' => 1,
'favicon.php' => 1,
'nmadflybundle.php' => 1,
'.travis.database.yml' => 1,
'saxfactory.php' => 1,
'raisenowsaxbundle.php' => 1,
'randomkeybehavior.php' => 1,
'data-sample.php' => 1,
'ip.lib.php' => 1,
'combine.sh' => 1,
'readme_without_lines' => 1,
'errorhandlerbundle.php' => 1,
'build.views.xml' => 1,
'rzblockbundle.php' => 1,
'mopabarcodebundle.php' => 1,
'localasset.php' => 1,
'backboneasset.php' => 1,
'philippeaelliguikitbundle.php' => 1,
'kitpagesgooglemapsbundle.php' => 1,
'wp-ajax-helper.php' => 1,
'widget-output-filters.php' => 1,
'vagrant_transient.phar' => 1,
'sanitize.phar' => 1,
'sanitize.json' => 1,
'mnsqueue.php' => 1,
'readme-symfony-standard' => 1,
'mopawsseauthenticationbundle.php' => 1,
'moparemoteupdatebundle.php' => 1,
'i18nurlmanager.php' => 1,
'jqmobileasset.php' => 1,
'geophp.inc' => 1,
'widgetfy.php' => 1,
'tman.example' => 1,
'pharmonic' => 1,
'imageprocessing.php' => 1,
'fileprocessing.php' => 1,
'footerwidget.php' => 1,
'headerwidget.php' => 1,
'brood' => 1,
'install-nosudo' => 1,
'windows' => 1,
'db_model.erm' => 1,
'sansiscorebasebundle.php' => 1,
'yii2dynatable.php' => 1,
'yiijquerytoc.php' => 1,
'philgeolocationbundle.php' => 1,
'yii2pinitasset.php' => 1,
'p2bootstrapbundle.php' => 1,
'core-builder.xml' => 1,
'yiiwymeditor.php' => 1,
'yii2visjs.php' => 1,
'yii2tooltipsterasset.php' => 1,
'yii2tooltipster.php' => 1,
'yii2toolbarbuttonasset.php' => 1,
'yii2toolbarbutton.php' => 1,
'yii2snapsvg.php' => 1,
'yii2sly.php' => 1,
'slyasset.php' => 1,
'yii2slidebars.php' => 1,
'slidebarsasset.php' => 1,
'yii2pinit.php' => 1,
'yii2textareaautosize.php' => 1,
'yii2masonryasset.php' => 1,
'yii2masonry.php' => 1,
'yii2imagesloadedasset.php' => 1,
'yii2instafeedasset.php' => 1,
'yii2instafeed.php' => 1,
'yii2imagesliderasset.php' => 1,
'yii2imageslider.php' => 1,
'yii2fullpagejsasset.php' => 1,
'yii2fullpagejs.php' => 1,
'yii2fullcalendarscheduler.php' => 1,
'yii2feedback.php' => 1,
'yii2extblocksitasset.php' => 1,
'yii2extblocksit.php' => 1,
'yii2elfinder.php' => 1,
'philguzzlebundle.php' => 1,
'philbasebundle.php' => 1,
'mediastorageinterface.php' => 1,
'phpdoctor.html' => 1,
'performervagrantbundle.php' => 1,
'performerreruserbundle.php' => 1,
'perficocorebundle.php' => 1,
'domcreator.php' => 1,
'google-places.png' => 1,
'beet' => 1,
'yiidebugcacheproxy.php' => 1,
'yiicsol.php' => 1,
'sagesignerbundle.php' => 1,
'peg.php' => 1,
'peg.bat' => 1,
'peg' => 1,
'phpdoc.php' => 1,
'phpdoctor.tags.html' => 1,
'message.png' => 1,
'pkj-page-source.pot' => 1,
'pkj-page-source-nb_no.po' => 1,
'pkj-page-source-nb_no.mo' => 1,
'linuxbackups' => 1,
'siterfrontendeditingbundle.php' => 1,
'loaddatabase.php' => 1,
'limp' => 1,
'appcache.manifest' => 1,
'assets-database.sspak' => 1,
'api-0.1.0' => 1,
'release-1.0.0a5' => 1,
'release-1.0.0a4' => 1,
'release-1.0.0a3' => 1,
'leo.png' => 1,
'concurrent.png' => 1,
'qrcode2.png' => 1,
'pagevisibilityasset.php' => 1,
'qrcode.png' => 1,
'ruiantwitterbootstrapbundle.php' => 1,
'prgportabledocumentbundle.php' => 1,
'ineatconseildynamicbundle.php' => 1,
'commandexception.php' => 1,
'pfhomesteadbundle.php' => 1,
'webfinger.php' => 1,
'bondoraapi.php' => 1,
'statsd-console' => 1,
'starcraftconnectionlayerbundle.php' => 1,
'cargallerycorebundle.php' => 1,
'blizzardapibundle.php' => 1,
'petitpflotbundle.php' => 1,
'goreblogbundle.php' => 1,
'dot.png' => 1,
'paginationpagerbundle.php' => 1,
'clipcloptest.php' => 1,
'clipclop.php' => 1,
'credittransfer.php' => 1,
'yii2getid3.php' => 1,
'scorchasset.php' => 1,
'cities' => 1,
'cidr_optim' => 1,
'arraytransformer.php' => 1,
'perimetercachebundle.php' => 1,
'vhost.dist.conf' => 1,
'output-sample.png' => 1,
'watcher.gif' => 1,
'usage.png' => 1,
'googlegeocoding.php' => 1,
'p2ratchetbundle.php' => 1,
'release-1.0.0a1' => 1,
'file.source.txt.twig' => 1,
'update-components.php' => 1,
'stree.sh' => 1,
'page_header.xsl' => 1,
'package.html.twig' => 1,
'method.html.twig' => 1,
'search.xsl' => 1,
'parse_markers.xsl' => 1,
'menu.xsl' => 1,
'markers.xsl' => 1,
'file.xsl' => 1,
'classgraph.xsl' => 1,
'ajax_search.php' => 1,
'interface.html.twig' => 1,
'file.html.twig' => 1,
'phpassert' => 1,
'report_parse_markers.xsl' => 1,
'report_markers.xsl' => 1,
'report_deprecated.xsl' => 1,
'helpers.xsl' => 1,
'graph_class.xsl' => 1,
'api-doc.xsl' => 1,
'vcrvcrbundle.php' => 1,
'main.sh' => 1,
'php_riak_stub.iml' => 1,
'resquebundle.php' => 1,
'.alias' => 1,
'pletnevprojectmanagerbundle.php' => 1,
'jautoload.php' => 1,
'run_examples.php' => 1,
'subscriptions.php' => 1,
'luguibundle.php' => 1,
'phpbrew.asc' => 1,
'namiadminbundle.php' => 1,
'entityrepository.php' => 1,
'doctrinehelper.php' => 1,
'gearsdoc' => 1,
'flags.png' => 1,
'flags.css' => 1,
'fixer.bat' => 1,
'bootstrap.dist.php' => 1,
'update-constants.php' => 1,
'sonarqube-ant-task-2.4.jar' => 1,
'phpcq.main.xml' => 1,
'license.bsd-3-clause' => 1,
'revert.php' => 1,
'phpbrew' => 1,
'tracking.php' => 1,
'readme.pt-br' => 1,
'viewonline_helper.php' => 1,
'version_helper.php' => 1,
'user_loader.php' => 1,
'symfony_request.php' => 1,
'recursive_dot_prefix_filter_iterator.php' => 1,
'path_helper.php' => 1,
'file_downloader.php' => 1,
'error_collector.php' => 1,
'content_visibility.php' => 1,
'config_php_file.php' => 1,
'class_loader.php' => 1,
'phpbbsessionsauthbundle.php' => 1,
'versions.php' => 1,
'curl.xml' => 1,
'lugstoragebundle.php' => 1,
'p2securitybundle.php' => 1,
'phoxy.js' => 1,
'singletone.ejs' => 1,
'require.ejs' => 1,
'head.ejs' => 1,
'empty.ejs' => 1,
'echo.ejs' => 1,
'each.ejs' => 1,
'delay.ejs' => 1,
'data_download.ejs' => 1,
'chain.ejs' => 1,
'virtual_namespace_helper.php' => 1,
'rpc_string_parser.php' => 1,
'phoxy_return_worker.php' => 1,
'phoxy.php' => 1,
'enjs.php' => 1,
'abstractcachepool.php' => 1,
'coldstart.php' => 1,
'enjs.js' => 1,
'repositoryserviceprovider.php' => 1,
'whmhypebundle.php' => 1,
'namedparameters.php' => 1,
'cqchecks.json' => 1,
'settings.dist.yml' => 1,
'phillip' => 1,
'.phillip.yml' => 1,
'voterinterface.php' => 1,
'voteableinterface.php' => 1,
'voteinterface.php' => 1,
'votealgorithminterface.php' => 1,
'php-doc notes' => 1,
'hasexpirationdateinterface.php' => 1,
'lugregistrybundle.php' => 1,
'taggableiteminterface.php' => 1,
'lugadminbundle.php' => 1,
'httplugfactory.php' => 1,
'httplugbundle.php' => 1,
'helix' => 1,
'documenting' => 1,
'.php_cs_psr2r' => 1,
'commonvalueobjectbundle.php' => 1,
'generate_messages.sh' => 1,
'voidcachepool.php' => 1,
'taggablepooltrait.php' => 1,
'taggablepoolinterface.php' => 1,
'taggablepsr6pooladapter.php' => 1,
'taggablepsr6itemadapter.php' => 1,
'psr6sessionhandler.php' => 1,
'apccachepool.php' => 1,
'rediscachepool.php' => 1,
'prediscachepool.php' => 1,
'namespacedcachepool.php' => 1,
'mongodbcachepool.php' => 1,
'memcachedcachepool.php' => 1,
'memcachecachepool.php' => 1,
'hierarchicalpoolinterface.php' => 1,
'hierarchicalcachepooltrait.php' => 1,
'filesystemcachepool.php' => 1,
'doctrinecachebridge.php' => 1,
'doctrinecachepool.php' => 1,
'cachepoolchain.php' => 1,
'arraycachepool.php' => 1,
'apcucachepool.php' => 1,
'release-1.0.0a2' => 1,
'release-1.0.0b5' => 1,
'nami.postman_collection' => 1,
'how-to-test' => 1,
'openpayudomain.php' => 1,
'openpayubase.php' => 1,
'palapimagetagbundle.php' => 1,
'test.properties' => 1,
'serviceinjection.php' => 1,
'functionaltestcase.php' => 1,
'imap.php' => 1,
'remotefileloaderinterface.php' => 1,
'remotefileloaderfactory.php' => 1,
'partkeeprremotefileloaderbundle.php' => 1,
'nousableremotefileloaderexception.php' => 1,
'curlloader.php' => 1,
'mailobfuscator.php' => 1,
'persiandatepickerasset.php' => 1,
'openpayuoauth.php' => 1,
'persiandatepicker.php' => 1,
'sendloop.php' => 1,
'exam.php' => 1,
'twuzzleclient.php' => 1,
'parkjitwitterloginbundle.php' => 1,
'bundle-readme' => 1,
'parasyslogreaderbundle.php' => 1,
'cs-ruleset.xml' => 1,
'paramonovavspresshtmlcompress.php' => 1,
'errata' => 1,
'pharaoh' => 1,
'phpbuiltinwebserver.php' => 1,
'presenterexception.php' => 1,
'openpayunetwork.php' => 1,
'pasintercmsbundle.php' => 1,
'noticeserviceprovider.php' => 1,
'page_example.info.yml' => 1,
'signrequestinterface.php' => 1,
'signrequest.php' => 1,
'registerresponseinterface.php' => 1,
'registerresponse.php' => 1,
'registerrequestinterface.php' => 1,
'registerrequest.php' => 1,
'authenticationresponseinterface.php' => 1,
'authenticationresponse.php' => 1,
'travis.bootstrap.php' => 1,
'page_example.routing.yml' => 1,
'page_example.permissions.yml' => 1,
'page_example.module' => 1,
'page_example.links.menu.yml' => 1,
'mcgroovinmultivariatetestsbundle.php' => 1,
'pasinterredisohmbundle.php' => 1,
'postinstall.php' => 1,
'exacttargetlaravelconfig.php' => 1,
'flatline' => 1,
'requests.php' => 1,
'oca.php' => 1,
'patlenaingasjqueryuibundle.php' => 1,
'patlenaingasjquerybundle.php' => 1,
'phpdoc2rst.php' => 1,
'patgod85phpdoc2rstbundle.php' => 1,
'bgpersonabundle.php' => 1,
'license.tcpdf' => 1,
'base2dbarcode.php' => 1,
'base1dbarcode.php' => 1,
'barcodebundle.php' => 1,
'presentable.php' => 1,
'noticefacade.php' => 1,
'u2f_interface.php' => 1,
'mediadb.php' => 1,
'box_catalog_navigation.css' => 1,
'box_catalog_limited_content.css' => 1,
'box_catalog_azlist.css' => 1,
'box_calendar.css' => 1,
'basic.css' => 1,
'dist.papaya.php' => 1,
'dist.build.properties' => 1,
'xmltree.php' => 1,
'phrases.php' => 1,
'msgbox.php' => 1,
'modglyph.php' => 1,
'mediamime.php' => 1,
'mediafilebrw.php' => 1,
'log_auth.php' => 1,
'box_categteaser.css' => 1,
'linktypes.php' => 1,
'inc.version.php' => 1,
'inc.glyphs.php' => 1,
'inc.func.php' => 1,
'inc.footer.php' => 1,
'inc.conf.php' => 1,
'inc.auth.php' => 1,
'inc.application.php' => 1,
'imggen.php' => 1,
'glyphview.php' => 1,
'end.php' => 1,
'cronexec.php' => 1,
'boxes.php' => 1,
'box_catalog_related_list.css' => 1,
'box_contact_list.css' => 1,
'mailableinterface.php' => 1,
'page_faq.css' => 1,
'global.css' => 1,
'tinymce.css' => 1,
'page_wiki.css' => 1,
'page_thumbs.css' => 1,
'page_stickers.css' => 1,
'page_sitemap.css' => 1,
'page_quiz.css' => 1,
'page_poll.css' => 1,
'page_mnogo.css' => 1,
'page_include.css' => 1,
'page_forum.css' => 1,
'page_files.css' => 1,
'page_feedback.css' => 1,
'page_community.css' => 1,
'box_contact_online.css' => 1,
'page_catalog.css' => 1,
'page_calendar.css' => 1,
'ie7.css' => 1,
'ie6win.css' => 1,
'default48.jpg' => 1,
'default100.jpg' => 1,
'colors.css' => 1,
'box_stickers.css' => 1,
'box_quiz.css' => 1,
'box_poll.css' => 1,
'box_navigation.css' => 1,
'box_mnogo.css' => 1,
'box_linkdb.css' => 1,
'box_forum.css' => 1,
'u2f.php' => 1,
'index.dist.php' => 1,
'release-1.0.0b4' => 1,
'amqp_exchange.h' => 1,
'build-phing.xml' => 1,
'combinatorics.php' => 1,
'sync-php4' => 1,
'logon.php' => 1,
'live_phpunit.sh.example' => 1,
'example_subset_ruleset.xml' => 1,
'samlbundle.php' => 1,
'test-report.sh' => 1,
'php_amqp.h' => 1,
'php7_support.h' => 1,
'php5_support.h' => 1,
'amqp_queue.h' => 1,
'amqp_queue.c' => 1,
'amqp_exchange.c' => 1,
'local.win.properties' => 1,
'amqp_envelope.h' => 1,
'amqp_envelope.c' => 1,
'amqp_connection_resource.h' => 1,
'amqp_connection_resource.c' => 1,
'amqp_connection.h' => 1,
'amqp_connection.c' => 1,
'amqp_channel.h' => 1,
'amqp_channel.c' => 1,
'amqp.c' => 1,
'snidetravisbundle.php' => 1,
'snidetravinizerbundle.php' => 1,
'snidescrutinizerbundle.php' => 1,
'snidemonitorbundle.php' => 1,
'fo-custom.xsl' => 1,
'license_plugins' => 1,
'pcaws4authbundle.php' => 1,
'make-pear-bundle.php' => 1,
'release-1.0.0b3' => 1,
'release-1.0.0b2' => 1,
'release-1.0.0b1' => 1,
'release-0.2.1' => 1,
'release-0.2.0' => 1,
'release-0.1.3' => 1,
'release-0.1.2' => 1,
'release-0.1.1' => 1,
'test-modified.php' => 1,
'template.spec' => 1,
'package.dtd' => 1,
'package-manpages.xml' => 1,
'package-errorstack.xml' => 1,
'make-installpear-nozlib-phar.php' => 1,
'package_pfm1.php' => 1,
'make-gopear-phar.php' => 1,
'make-command-xml.php' => 1,
'install-pear' => 1,
'install-pear.php' => 1,
'go-pear-phar.php' => 1,
'go-pear-list.php' => 1,
'catalog' => 1,
'readme.contributing' => 1,
'makefile.frag' => 1,
'copy-from-pear-core.sh' => 1,
'license-bsd' => 1,
'package_plugins.xml' => 1,
'package_plugins.php' => 1,
'package_pfm1.xml' => 1,
'snideextraformbundle.php' => 1,
'vars.less' => 1,
'rest-api-plugin-endpoints.php' => 1,
'select2adminlteasset.php' => 1,
'paynet_processor_aggregate.php' => 1,
'paynet.xml' => 1,
'paynet.php' => 1,
'guzzleclient.php' => 1,
'requestexample' => 1,
'tk_tm.csv' => 1,
'listingview.php' => 1,
'listingfactory.php' => 1,
'listing.php' => 1,
'datatableslistingbundle.php' => 1,
'run_specs' => 1,
'enviromenteavbundle.php' => 1,
'selector.png' => 1,
'modelselectorasset.php' => 1,
'php_loc' => 1,
'modelselector.php' => 1,
'kuceramonologextensionsbundle.php' => 1,
'dgisapibundle.php' => 1,
'dgsphinxsearch.php' => 1,
'nestedsetsquerytrait.php' => 1,
'nestedintervalsquerytrait.php' => 1,
'nestedintervalsbehavior.php' => 1,
'materializedpathquerytrait.php' => 1,
'autotreetrait.php' => 1,
'adjacencylistquerytrait.php' => 1,
'wikicreole.php' => 1,
'badasstubeexample.php' => 1,
'sql_for_db_creation.sql' => 1,
'update.sql' => 1,
'run-server.bat' => 1,
'padding.less' => 1,
'menufy.jquery.js' => 1,
'objects.less' => 1,
'margin.less' => 1,
'list.less' => 1,
'font.less' => 1,
'common.less' => 1,
'clear.less' => 1,
'animation.less' => 1,
'vhax.jquery.js' => 1,
'vha.jquery.js' => 1,
'responsify.jquery.js' => 1,
'openify.jquery.js' => 1,
'navigateto.jquery.js' => 1,
'movify.jquery.js' => 1,
'httpify.js' => 1,
'pbebasebundle.php' => 1,
'heighten.jquery.js' => 1,
'devicify.js' => 1,
'developify.jquery.js' => 1,
'pcdummyajaxcompletebundle.php' => 1,
'mbtuserbundle.php' => 1,
'pcastrotigretsecuritybundle.php' => 1,
'whatsappresponse.php' => 1,
'whatsappapi.php' => 1,
'userserviceplugin.php' => 1,
'pbhtechnocommunicatorbundle.php' => 1,
'fork.php' => 1,
'users.example.yml' => 1,
'screenshot-top-menu.png' => 1,
'screenshot-top-menu-with-directly-loaded-locations.png' => 1,
'namicorebundle.php' => 1,
'link_header.php' => 1,
'build.securepages.xml' => 1,
'pmapasswordencoderbundle.php' => 1,
'jquery.countdown-ca.js' => 1,
'jquery.countdown-bs.js' => 1,
'jquery.countdown-bn.js' => 1,
'jquery.countdown-bg.js' => 1,
'jquery.countdown-ar.js' => 1,
'countdownled.png' => 1,
'countdownglowing.gif' => 1,
'countdownbasic.html' => 1,
'pmzeroclipboardbundle.php' => 1,
'pmyubikeyotpbundle.php' => 1,
'pmtoolbundle.php' => 1,
'pmmonitoringbundle.php' => 1,
'pmgoogleauthenticatorbundle.php' => 1,
'keypadbasic.html' => 1,
'jquery.countdown-cy.js' => 1,
'keypad.png' => 1,
'jquery.keypad.min.js' => 1,
'jquery.keypad.js' => 1,
'jquery.keypad.css' => 1,
'jquery.keypad.alt.css' => 1,
'jquery.keypad-tr.js' => 1,
'jquery.keypad-pt-br.js' => 1,
'jquery.keypad-nl.js' => 1,
'jquery.keypad-it.js' => 1,
'jquery.keypad-fr.js' => 1,
'jquery.keypad-es.js' => 1,
'jquery.keypad-de.js' => 1,
'jquery.keypad-cs.js' => 1,
'jquery.countdown-cs.js' => 1,
'jquery.countdown-da.js' => 1,
'ppvbasebundle.php' => 1,
'jquery.countdown-kn.js' => 1,
'jquery.countdown-sk.js' => 1,
'jquery.countdown-ru.js' => 1,
'jquery.countdown-ro.js' => 1,
'jquery.countdown-pt-br.js' => 1,
'jquery.countdown-pl.js' => 1,
'jquery.countdown-nl.js' => 1,
'jquery.countdown-nb.js' => 1,
'jquery.countdown-my.js' => 1,
'jquery.countdown-ms.js' => 1,
'jquery.countdown-ml.js' => 1,
'jquery.countdown-lv.js' => 1,
'jquery.countdown-lt.js' => 1,
'jquery.countdown-ko.js' => 1,
'jquery.countdown-ja.js' => 1,
'jquery.countdown-de.js' => 1,
'jquery.countdown-it.js' => 1,
'jquery.countdown-id.js' => 1,
'jquery.countdown-hy.js' => 1,
'jquery.countdown-hu.js' => 1,
'jquery.countdown-hr.js' => 1,
'jquery.countdown-he.js' => 1,
'jquery.countdown-gu.js' => 1,
'jquery.countdown-gl.js' => 1,
'jquery.countdown-fr.js' => 1,
'jquery.countdown-fi.js' => 1,
'jquery.countdown-fa.js' => 1,
'jquery.countdown-et.js' => 1,
'jquery.countdown-es.js' => 1,
'jquery.countdown-el.js' => 1,
'jquery.keypad-ca.js' => 1,
'cdz' => 1,
'jquery.countdown-sq.js' => 1,
'basex.php' => 1,
'sorting.php' => 1,
'errorsummary.php' => 1,
'planit.php' => 1,
'configurations.php' => 1,
'carbon-field-number.php' => 1,
'carbon_field_number.php' => 1,
'quickquery.php' => 1,
'qq.utils.php' => 1,
'urldispatcher.php' => 1,
'siteaccessfactory.php' => 1,
'siteaccess.php' => 1,
'fc.php' => 1,
'basexfactory.php' => 1,
'assertxpathmatch.php' => 1,
'shell-config.rc' => 1,
'accumulator.php' => 1,
'kindeditor.js' => 1,
'kindeditor-min.js' => 1,
'kindeditor-all.js' => 1,
'kindeditor-all-min.js' => 1,
'services_json.php' => 1,
'kindeditoraction.php' => 1,
'plantuml.php' => 1,
'syliustaxonomiesbundle.php' => 1,
'syliuspromotionsbundle.php' => 1,
'syliuspaymentsbundle.php' => 1,
'syliuspaymentevents.php' => 1,
'pjentityextendbundle.php' => 1,
'platform' => 1,
'platformsh.php' => 1,
'pluessdoctrinetrxbundle.php' => 1,
'createsettingtablemigration.php' => 1,
'phpiredis_functions.php' => 1,
'validationexception.hh' => 1,
'messagebag.hh' => 1,
'build-win.xml' => 1,
'plehatronlimoncellobundle.php' => 1,
'class.mysqli.php' => 1,
'msysgit的配置叚中文支朁' => 1,
'git常用命令' => 1,
'git五分é’ÿ教程' => 1,
'uploadsaction.php' => 1,
'settingsmigration.php' => 1,
'settingform.php' => 1,
'settingaction.php' => 1,
'relativeselect2asset.php' => 1,
'magento-build.php' => 1,
'relativeselect2.php' => 1,
'httperror.php' => 1,
'eastereggaction.php' => 1,
'datalogmigration.php' => 1,
'datalogform.php' => 1,
'datalogbehavior.php' => 1,
'datalog.php' => 1,
'copyattributesbehavior.php' => 1,
'platinumpixssimplepaginationbundle.php' => 1,
'platinumpixsgoogleclosurelibrarybundle.php' => 1,
'platinumpixsawsbundle.php' => 1,
'bootstrap1.php' => 1,
'my_yii2_adv (1).sql' => 1,
'magento-deploy.php' => 1,
'jquery.countdown-sl.js' => 1,
'jquery.countdown-sr-sr.js' => 1,
'adyengatewayfactory.php' => 1,
'googleanalyticsapi.php' => 1,
'polish.sh' => 1,
'function_smarty_modifier_ago.php' => 1,
'atom.png' => 1,
'test.cmd' => 1,
'super-cpt-loader.php' => 1,
'_ide_helper.php.sample' => 1,
'parrots-logo-250.png' => 1,
'wechatsdk.php' => 1,
'wechataction.php' => 1,
'qiyesdk.php' => 1,
'subdomainurlmanager.php' => 1,
'redisfilter.php' => 1,
'saeassetmanager.php' => 1,
'test_services.json' => 1,
'composer.list' => 1,
'requestcore.class.php' => 1,
'examples.yml' => 1,
'transmission-cli.dist.yml' => 1,
'phpunit_without_commands.xml' => 1,
'pchatmodule.php' => 1,
'chatwithoutnodeassets.php' => 1,
'chatassets.php' => 1,
'phpunit-imagick.xml' => 1,
'phpunit-gmagick.xml' => 1,
'plrapibundle.php' => 1,
'bernardschedulerbundle.php' => 1,
'pmxrrdbundle.php' => 1,
'polygramphpcrbundle.php' => 1,
'yql.php' => 1,
'desperadoxmlbundle.php' => 1,
'apimethods.php' => 1,
'prestainitializerbundle.php' => 1,
'build.securelogin.xml' => 1,
'build.overlay.xml' => 1,
'build.maint.xml' => 1,
'build.error.xml' => 1,
'build.environment_indicator.xml' => 1,
'build.devel.xml' => 1,
'build.acquia.xml' => 1,
'behat.local.yml' => 1,
'readme_remove_cms' => 1,
'prestasonatanavigationbundle.php' => 1,
'prestasonataadminextendedbundle.php' => 1,
'prestasitemapbundle.php' => 1,
'prestapimpmysonatabundle.php' => 1,
'prestadeploymentbundle.php' => 1,
'pwasset.php' => 1,
'prestacomposerpublicbundle.php' => 1,
'prestacmsuserbundle.php' => 1,
'prestacmsthemebasicbundle.php' => 1,
'prestacmssocialbundle.php' => 1,
'prestacmssitemapbridgebundle.php' => 1,
'prestacmsmediabundle.php' => 1,
'prestacmsfaqbundle.php' => 1,
'prestacmscorebundle.php' => 1,
'prestacmscontactbundle.php' => 1,
'prestacmsckeditorbundle.php' => 1,
'templates.vars.json.travis' => 1,
'templates.vars.json.init' => 1,
'buttonajax.php' => 1,
'videojs.php' => 1,
'polyfonypaymentbundle.php' => 1,
'chatworkbundle.php' => 1,
'jquery.countdown-sr.js' => 1,
'class-clockworkexception.php' => 1,
'error_trace.php' => 1,
'elastic_search.php' => 1,
'default_forward.php' => 1,
'debug_store.php' => 1,
'debug_console.php' => 1,
'debug_cli.php' => 1,
'cache_header.php' => 1,
'cacheheaderhelper.php' => 1,
'app_action_router.php' => 1,
'file_sign.php' => 1,
'original.html' => 1,
'adr.png' => 1,
'pminnieurspritesbundle.php' => 1,
'class-clockwork.php' => 1,
'file_info.php' => 1,
'flexible-orm.doxyfile' => 1,
'kbw.countdown.jquery.json' => 1,
'jquery.countdown.min.js' => 1,
'jquery.countdown.js' => 1,
'jquery.countdown.css' => 1,
'jquery.countdown-zh-tw.js' => 1,
'jquery.countdown-zh-cn.js' => 1,
'jquery.countdown-vi.js' => 1,
'jquery.countdown-uz.js' => 1,
'jquery.countdown-uk.js' => 1,
'jquery.countdown-tr.js' => 1,
'jquery.countdown-th.js' => 1,
'jquery.countdown-sv.js' => 1,
'fast_route.php' => 1,
'file_list.php' => 1,
'vaddybundle.php' => 1,
'view_html.php' => 1,
'aws-ses-wp-mail.php' => 1,
'polemdepartementsbundle.php' => 1,
'polemmultipassbundle.php' => 1,
'modulecontaopiwikvisitoroptout.php' => 1,
'pokpooldbmbundle.php' => 1,
'blackuserbundle.php' => 1,
'foursquarestrategy.php' => 1,
'flickrstrategy.php' => 1,
'vendor' => 1,
'hello.html' => 1,
'yo_swagger.php' => 1,
'view_react.php' => 1,
'view_json.php' => 1,
'view_config_helper.php' => 1,
'flickr.php' => 1,
'view_cli.php' => 1,
'tmp.php' => 1,
'supervisor.php' => 1,
'static_map.php' => 1,
'ssdb.php' => 1,
'rethinkdb.php' => 1,
'otp.php' => 1,
'googleauthenticator' => 1,
'minions.php' => 1,
'latlon.php' => 1,
'http_auth.php' => 1,
'html_parser.php' => 1,
'clean.sh' => 1,
'getenv.php' => 1,
'paymillgatewayfactory.php' => 1,
'zerion_autoload.php' => 1,
'shopify.php' => 1,
'dbexport.php' => 1,
'sequences.php' => 1,
'schemas.php' => 1,
'privileges.php' => 1,
'operators.php' => 1,
'opclasses.php' => 1,
'multiactionform.js' => 1,
'links.js' => 1,
'intro.php' => 1,
'indexes.php' => 1,
'indexes.js' => 1,
'groups.php' => 1,
'functions.js' => 1,
'fulltext.php' => 1,
'dataimport.php' => 1,
'sqledit.php' => 1,
'dataexport.php' => 1,
'conversions.php' => 1,
'constraints.php' => 1,
'colproperties.php' => 1,
'casts.php' => 1,
'all_db.php' => 1,
'ajax-ac-insert.php' => 1,
'aggregates.php' => 1,
'translators' => 1,
'developers' => 1,
'textviewmodel.php' => 1,
'permutationviewmodel.php' => 1,
'abstractviewmodel.php' => 1,
'servers.php' => 1,
'tables.js' => 1,
'streamserver.php' => 1,
'extensionmanager.php' => 1,
'boundform.php' => 1,
'defaultroutes.php' => 1,
'configurable.php' => 1,
'recursiveassetfinder.php' => 1,
'assetserver.php' => 1,
'pushar.php' => 1,
'phpugltwitterbootstrapbundle.php' => 1,
'dimetimetrackerfrontendbundle.php' => 1,
'dimetimetrackerbundle.php' => 1,
'dimereportbundle.php' => 1,
'noahglaserentitybundle.php' => 1,
'noahglaserpaginationbundle.php' => 1,
'passthru.php' => 1,
'extensioninterface.php' => 1,
'tablespaces.php' => 1,
'containerhelper.php' => 1,
'read_config.php' => 1,
'phpsysinfo3.xsd' => 1,
'phpsysinfo.xslt' => 1,
'phpsysinfo.ini.new' => 1,
'readme_plugin' => 1,
'prophecytestcase.php' => 1,
'magicscopesbehavior.php' => 1,
'magicactivequery.php' => 1,
'app.phpsgi' => 1,
'grumphp.yml.dist' => 1,
'viewproperties.php' => 1,
'triggers.php' => 1,
'tblproperties.php' => 1,
'wrapperclient.php' => 1,
'streamclientoptionstrait.php' => 1,
'unboundform.php' => 1,
'benchmark-plural.php' => 1,
'aredisset.php' => 1,
'aredissession.php' => 1,
'aredisrecord.php' => 1,
'aredismutex.php' => 1,
'aredislogroute.php' => 1,
'aredislist.php' => 1,
'aredisiterableentity.php' => 1,
'aredishash.php' => 1,
'aredisentity.php' => 1,
'arediscounter.php' => 1,
'aredisconnection.php' => 1,
'aredischannel.php' => 1,
'arediscache.php' => 1,
'benchmark-context.php' => 1,
'aredisstatepersister.php' => 1,
'mvexportformbundle.php' => 1,
'mverrorlogbundle.php' => 1,
'mvcrudgeneratorresourcesbundle.php' => 1,
'mvcrudgeneratorbundle.php' => 1,
'mvcontactbundle.php' => 1,
'mvblogbundle.php' => 1,
'mvfreesmsapibundle.php' => 1,
'constants.php.dist' => 1,
'cp.php' => 1,
'lucidframe' => 1,
'assets-legendary.sublime-workspace' => 1,
'assets-legendary.sublime-project' => 1,
'webmention.php' => 1,
'aredissortedset.php' => 1,
'abstractaresponder.php' => 1,
'streamclient.php' => 1,
'filepermissions.php' => 1,
'swrappermanager.php' => 1,
'sresource.php' => 1,
'sfiltermanager.php' => 1,
'logdatacontext.php' => 1,
'resourcemaptrait.php' => 1,
'resourcemapresolver.php' => 1,
'pathstacktrait.php' => 1,
'pathstackresolver.php' => 1,
'aggregatetrait.php' => 1,
'aggregateloader.php' => 1,
'reqmethod.php' => 1,
'browserrequestoptions.php' => 1,
'browseroptions.php' => 1,
'exeprocutedpipes.php' => 1,
'functoraresponder.php' => 1,
'exeprocuted.php' => 1,
'exeproc.php' => 1,
'exedescriptor.php' => 1,
'eventstrait.php' => 1,
'eventbuilder.php' => 1,
'baseevents.php' => 1,
'containerserviceinitializer.php' => 1,
'freflection.php' => 1,
'abstractaresolver.php' => 1,
'anamedresolver.php' => 1,
'sapiservice.php' => 1,
'sapihttp.php' => 1,
'sapicli.php' => 1,
'abstractsapi.php' => 1,
'recordsetform.php' => 1,
'paginatedrecordset.php' => 1,
'socials.yml' => 1,
'widgetserviceprovider.php' => 1,
'applicationerror.php' => 1,
'loader_metno.php' => 1,
'metnosymbol.php' => 1,
'metnoprecipitation.php' => 1,
'metnoforecast.php' => 1,
'metnofactory.php' => 1,
'metnoday.php' => 1,
'metnocustomsymbol.php' => 1,
'metno.php' => 1,
'pinkfirebundle.php' => 1,
'pinkeenapidebugbundle.php' => 1,
'apievents.php' => 1,
'moneybundle.php' => 1,
'widgetfacade.php' => 1,
'pslabyrinthbundle.php' => 1,
'themesserviceprovider.php' => 1,
'themefacade.php' => 1,
'shortcodeserviceprovider.php' => 1,
'shortcodefacade.php' => 1,
'presentabletrait.php' => 1,
'.env.testing.php' => 1,
'pingen.php' => 1,
'arteober2doctrinebundle.php' => 1,
'install_php_weak_ext.sh' => 1,
'uuid-stub.php' => 1,
'pinanoselect2bundle.php' => 1,
'pinanodatatablesbundle.php' => 1,
'pinanobootstrap3bundle.php' => 1,
'fatalerror.php' => 1,
'antqapayubundle.php' => 1,
'license-faq' => 1,
'db-pdosql.php' => 1,
'searchengines.yml' => 1,
'sample-merlion.php' => 1,
'merlionwsdlclass.php' => 1,
'merlionclassmap.php' => 1,
'merlionautoload.php' => 1,
'cfb.php' => 1,
'pirastruformbuilderbundle.php' => 1,
'loop-limiter.sh' => 1,
'limiter.sql' => 1,
'limiter-script.php' => 1,
'limiter-console.php' => 1,
'limiter-config.php' => 1,
'limiter-browser.php' => 1,
'db-mongo.php' => 1,
'antqapaymentevents.php' => 1,
'cms' => 1,
'-' => 1,
'xteamslackmessengerbundle.php' => 1,
'xteamhighfiveslackbundle.php' => 1,
'object_def.php' => 1,
'pmdworkflowbundle.php' => 1,
'statemachineinterface.php' => 1,
'statemachine.php' => 1,
'pmdstatemachinebundle.php' => 1,
'pmdroutingbundle.php' => 1,
'pmdresourceresolverbundle.php' => 1,
'pmdfrontendbundle.php' => 1,
'pmddoctrinebundle.php' => 1,
'antqadataexporterbundle.php' => 1,
'dkim.php' => 1,
'3rd-party-licenses' => 1,
'recordset.php' => 1,
'log_firebugjson.php' => 1,
'.travis.xml' => 1,
'frypestrategy.php' => 1,
'pi.courier.php' => 1,
'ff_pdo_tests.class.php' => 1,
'ff_pdo.class.php' => 1,
'tool.php' => 1,
'layout.example.html' => 1,
'action.example.php' => 1,
'license_ardent' => 1,
'docker-compose.override-dist.yml' => 1,
'tnetstring.php' => 1,
'testdox.html' => 1,
'result.xml' => 1,
'code-standard.xml' => 1,
'smoneyapi.php' => 1,
'readme-zh-cn' => 1,
'serialcolumntrait.php' => 1,
'kartikserialcolumn.php' => 1,
'auth.tmp' => 1,
'vimeo.tmp' => 1,
'mail-input.sh' => 1,
'nginx.example.conf' => 1,
'apache.example.htaccess' => 1,
'templateexception.php' => 1,
'partialhelper.php' => 1,
'partial.php' => 1,
'applicationexception.php' => 1,
'treerecordset.php' => 1,
'picosssmoneybundle.php' => 1,
'picosssonataextraadminbundle.php' => 1,
'area.xml' => 1,
'coordinatespickerasset.php' => 1,
'userprofile.php' => 1,
'fbbotapp.php' => 1,
'key-value-api.php' => 1,
'wkhtmltopdf-i386' => 1,
'wkhtmltopdf-amd64' => 1,
'andreyboloninchartjsbundle.php' => 1,
'pilotogonepaymentbundle.php' => 1,
'jungithemebundle.php' => 1,
'sfynxspecificationbundle.php' => 1,
'sfynxcurrencybundle.php' => 1,
'sfynxcircuitbreakerbundle.php' => 1,
'sfynxcachebundle.php' => 1,
'locationpickerwidget.php' => 1,
'coordinatespicker.php' => 1,
'picossmangopaybundle.php' => 1,
'nailthumbasset.php' => 1,
'nailthumb.php' => 1,
'pickleblogbundle.php' => 1,
'pierrrememcachedbundle.php' => 1,
'memcachedfactory.php' => 1,
'pierrreencrypterbundle.php' => 1,
'pierrreautomaticvalidatorbundle.php' => 1,
'rollandimagickbundle.php' => 1,
'site.dtd' => 1,
'di.phar' => 1,
'travis-composer-configure' => 1,
'piecevalidationdirectoryloaderbundle.php' => 1,
'piecequestetrabundle.php' => 1,
'picossyousignbundle.php' => 1,
'rzadminbundle.php' => 1,
'rzbootstrapbundle.php' => 1,
'salutation.sublime-project' => 1,
'helperinterface.php' => 1,
'example_v3.php' => 1,
'example_v2_template.php' => 1,
'example_v2.php' => 1,
'.env_sample' => 1,
'senailibraryreportbundle.php' => 1,
'slevltreeextensionbundle.php' => 1,
'demo.jpg' => 1,
'goto-source.php' => 1,
'pharstub.php' => 1,
'resize.php' => 1,
'jalali.php' => 1,
'seifferthelperbundle.php' => 1,
'helperset.php' => 1,
'helperbroker.php' => 1,
'.travis_nginx.conf' => 1,
'seiffertcrowdrestbundle.php' => 1,
'crowd.php' => 1,
'seiffertcrowdauthbundle.php' => 1,
'seiffertcontrollerhelperbundle.php' => 1,
'seiffertconsoleextrabundle.php' => 1,
'commandregistry.php' => 1,
'authorsextension.php' => 1,
'authorregistry.php' => 1,
'httpfull.php' => 1,
'ews.php' => 1,
'seferovdeployerbundle.php' => 1,
'seferovblogbundle.php' => 1,
'seferovawsbundle.php' => 1,
'deptrac.php' => 1,
'sensiobuzzbundle.php' => 1,
'seegnobootstrapbundle.php' => 1,
'esphinxquery.php' => 1,
'fsvsortablecollectiontypebundle.php' => 1,
'nbitranslationbundle.php' => 1,
'sligittoolsbundle.php' => 1,
'sliextjslocalizationbundle.php' => 1,
'sliextjsintegrationbundle.php' => 1,
'slidoctrineentitydatamapperbundle.php' => 1,
'slidoctrinearrayquerybuilderbundle.php' => 1,
'sliauxbundle.php' => 1,
'sliexpanderbundle.php' => 1,
'sphinxapi-2.1.1.php' => 1,
'sphinxapi-2.0.9.php' => 1,
'esphinxsearchcriteria.php' => 1,
'esphinxresult.php' => 1,
'esphinxmysqlconnection.php' => 1,
'sensiodistributionbundle.php' => 1,
'esphinxexception.php' => 1,
'esphinxbaseconnection.php' => 1,
'esphinxapiconnection.php' => 1,
'rowparser.php' => 1,
'rownode.php' => 1,
'columnparser.php' => 1,
'columnnode.php' => 1,
'buildphp' => 1,
'mobile_detect.php' => 1,
'mobile_detect.json' => 1,
'connectserviceprovider.php' => 1,
'sensiolabsdoctrinequerystatisticsbundle.php' => 1,
'sensiolabsconnectbundle.php' => 1,
'sensioframeworkextrabundle.php' => 1,
'seegnotestbundle.php' => 1,
'sedrouteexporterbundle.php' => 1,
'repo.go' => 1,
'pediatric-physical-therapy.csl' => 1,
'physiological-and-biochemical-zoology.csl' => 1,
'phyllomedusa.csl' => 1,
'phycological-research.csl' => 1,
'philosophiques.csl' => 1,
'philosophia-scientiae.csl' => 1,
'philippika.csl' => 1,
'pharmacoepidemiology-and-drug-safety.csl' => 1,
'petit-chicago-author-date.csl' => 1,
'perspectives-on-politics.csl' => 1,
'permafrost-and-periglacial-processes.csl' => 1,
'periodontology-2000.csl' => 1,
'peerj.csl' => 1,
'pediatric-research.csl' => 1,
'pediatric-blood-and-cancer.csl' => 1,
'plant-biology.csl' => 1,
'pediatric-anesthesia.csl' => 1,
'pediatric-allergy-and-immunology.csl' => 1,
'past-and-present.csl' => 1,
'parasitology.csl' => 1,
'paleobiology.csl' => 1,
'palaios.csl' => 1,
'palaeontology.csl' => 1,
'palaeontologia-electronica.csl' => 1,
'pain.csl' => 1,
'padagogische-hochschule-vorarlberg.csl' => 1,
'padagogische-hochschule-heidelberg.csl' => 1,
'padagogische-hochschule-fachhochschule-nordwestschweiz.csl' => 1,
'oxford-university-press-scimed-numeric.csl' => 1,
'pisa-university-press.csl' => 1,
'plant-pathology.csl' => 1,
'secotrustsabredavbundle.php' => 1,
'primary-care-clinics-in-office-practice.csl' => 1,
'secotrustroutestatisticsbundle.php' => 1,
'secotrusthtmlinspectorbundle.php' => 1,
'dipper.php' => 1,
'psychosomatics.csl' => 1,
'psychological-medicine.csl' => 1,
'psychiatry-and-clinical-neurosciences.csl' => 1,
'psychiatric-services.csl' => 1,
'psychiatric-clinics-of-north-america.csl' => 1,
'proteomics.csl' => 1,
'protein-science.csl' => 1,
'protein-engineering-design-and-selection.csl' => 1,
'proinflow.csl' => 1,
'proceedings-of-the-royal-society-b.csl' => 1,
'presses-universitaires-de-rennes.csl' => 1,
'plant-physiology.csl' => 1,
'preslia.csl' => 1,
'pour-reussir-note.csl' => 1,
'poultry-science.csl' => 1,
'population.csl' => 1,
'population-space-and-place.csl' => 1,
'pontifical-gregorian-university.csl' => 1,
'pontifical-biblical-institute.csl' => 1,
'pontifical-athenaeum-regina-apostolorum.csl' => 1,
'politische-vierteljahresschrift.csl' => 1,
'political-studies.csl' => 1,
'polish-legal.csl' => 1,
'podzemna-voda.csl' => 1,
'pnas.csl' => 1,
'plos.csl' => 1,
'normalizerinterface.php' => 1,
'repo_test.go' => 1,
'oxford-university-press-humsoc.csl' => 1,
'themegroup.class.php' => 1,
'tannauserbundleevents.php' => 1,
'tannauserbundle.php' => 1,
'sfbrouteactivebundle.php' => 1,
'seyoneajaxcrudbundle.php' => 1,
'seyonteamspeak3viewerbundle.php' => 1,
'seyonphpbb3userbundle.php' => 1,
'seyonphpbb3adminbundle.php' => 1,
'seyonnodejschatbundle.php' => 1,
'sexyboysinflexiblebundle.php' => 1,
'twittermanager.class.php' => 1,
'tinymceexcerpt.class.php' => 1,
'themeutils.class.php' => 1,
'themehelpers.class.php' => 1,
'testsmanager.class.php' => 1,
'tannaproductbundleevents.php' => 1,
'templatechecker.class.php' => 1,
'substitutiontemplate.class.php' => 1,
'specialofferssnippetcached.class.php' => 1,
'specialofferssnippetajax.class.php' => 1,
'specialofferssnippet.class.php' => 1,
'singleton.class.php' => 1,
'simplemetabox.class.php' => 1,
'simplefieldsquickconfig.class.php' => 1,
'showcaseslider.class.php' => 1,
'showtitlethumbexcerptwalkernavmenu.class.php' => 1,
'showitemexcerptwalkernavmenu.class.php' => 1,
'shortcodefortabs.class.php' => 1,
'runtimeinfos.class.php' => 1,
'tannaproductbundle.php' => 1,
'sfsadminbundle.php' => 1,
'removespaceswalkernavmenu.class.php' => 1,
'settings_backup.php' => 1,
'datetimeconverter.php' => 1,
'fenomadapter.php' => 1,
'shcloudopenstackbundle.php' => 1,
'brunopsselect24entitybundle.php' => 1,
'license-ja' => 1,
'sogenombundle.php' => 1,
'wp-cli.local.yml' => 1,
'.gitignore-sample' => 1,
'.deployignore' => 1,
'nepali.datepicker.js' => 1,
'nepali.datepicker.css' => 1,
'shanejquerybundle.php' => 1,
'.pharorver.example.json' => 1,
'imapsource.php' => 1,
'testvishal.php' => 1,
'a4-junghans.pdf' => 1,
'junk.php' => 1,
'recommenderbundle.php' => 1,
'recommender.php' => 1,
'php_browscap.ini' => 1,
'gilleshacksessionbundle.php' => 1,
'adldap2bundle.php' => 1,
'ucotwigextensionsbundle.php' => 1,
'sspguardbundle.php' => 1,
'jsonbundle.php' => 1,
'demo.csv' => 1,
'sglfltsbundle.php' => 1,
'dataprovideriterator.php' => 1,
'expioneo4jfixturesbundle.php' => 1,
'responsiveimagesmanager.class.php' => 1,
'photogallerythumbwithfancybox.class.php' => 1,
'pluginguestcomments.class.php' => 1,
'htmlintegratorbootstrapasset.php' => 1,
'automaticassetsmanager.class.php' => 1,
'ajaximagegenerator.class.php' => 1,
'legacy.php' => 1,
'sescandellpaymentbitpaybundle.php' => 1,
'sescandellsimplenewsletterbundle.php' => 1,
'sescandellcontextrestrictorbundle.php' => 1,
'sgcli.phar' => 1,
'servergroveshellaliasbundle.php' => 1,
'servergrovelocalebundle.php' => 1,
'servergrovekbbundle.php' => 1,
'sgcontrolbundle.php' => 1,
'seriusmediabundle.php' => 1,
'includefileextra.php' => 1,
'htmlintegratorasset.php' => 1,
'classautoloader.class.php' => 1,
'arraysearch.php' => 1,
'rudate.php' => 1,
'filepath.php' => 1,
'.editorcondig' => 1,
'alborada.scheduler.js' => 1,
'alborada.scheduler.css' => 1,
'ororedisbundle.php' => 1,
'socialwidget.php' => 1,
'socialasset.php' => 1,
'semaminifierbundle.php' => 1,
'sergeymvidequebundle.php' => 1,
'sergeymreceiptbundle.php' => 1,
'create_guset_user.sql' => 1,
'bootstrapcarousel.class.php' => 1,
'debugutils.class.php' => 1,
'oneimageforall.class.php' => 1,
'imagepreload.class.php' => 1,
'offersmanager.class.php' => 1,
'newbloginitializator.class.php' => 1,
'minigallerythumbslinktobig.class.php' => 1,
'minigallerybigimagewiththumbs.class.php' => 1,
'metaboxescontroller.class.php' => 1,
'metaboxinfo.class.php' => 1,
'mergedslideshow.class.php' => 1,
'mediamanager.class.php' => 1,
'loremipsumdictionary.class.php' => 1,
'lipsumgenerator.class.php' => 1,
'linksmanager.class.php' => 1,
'levelwalkernavmenu.class.php' => 1,
'imageprogressiveloading.class.php' => 1,
'imagegenerator.class.php' => 1,
'defaultassets.class.php' => 1,
'htmlhelper.class.php' => 1,
'hotelmanager.class.php' => 1,
'headhelper.class.php' => 1,
'hashanchorwalkernavmenu.class.php' => 1,
'generatordictionary.class.php' => 1,
'gaussianmath.class.php' => 1,
'galleryhelper.class.php' => 1,
'gmapdataretriever.example.json' => 1,
'gmapdataretriever.class.php' => 1,
'forcedownload.class.php' => 1,
'featurewithassets.class.php' => 1,
'escaperoute.class.php' => 1,
'emptyassets.class.php' => 1,
'defaultassetscdn.class.php' => 1,
'oxford-university-press-scimed-author-date.csl' => 1,
'oxford-the-university-of-new-south-wales.csl' => 1,
'jsrenderasset.php' => 1,
'journal-of-roman-archaeology-b.csl' => 1,
'journal-of-the-american-ceramic-society.csl' => 1,
'journal-of-the-american-association-of-laboratory-animal-science.csl' => 1,
'journal-of-the-american-academy-of-orthopaedic-surgeons.csl' => 1,
'journal-of-the-air-and-waste-management-association.csl' => 1,
'journal-of-studies-on-alcohol-and-drugs.csl' => 1,
'journal-of-strength-and-conditioning-research.csl' => 1,
'journal-of-spinal-disorders-and-techniques.csl' => 1,
'journal-of-social-archaeology.csl' => 1,
'journal-of-sleep-research.csl' => 1,
'journal-of-simulation.csl' => 1,
'journal-of-shoulder-and-elbow-surgery.csl' => 1,
'journal-of-separation-science.csl' => 1,
'journal-of-science-and-medicine-in-sport.csl' => 1,
'journal-of-roman-archaeology-a.csl' => 1,
'journal-of-the-american-college-of-surgeons.csl' => 1,
'journal-of-rheumatology.csl' => 1,
'journal-of-retailing.csl' => 1,
'journal-of-reconstructive-microsurgery.csl' => 1,
'journal-of-psychiatry-and-neuroscience.csl' => 1,
'journal-of-psychiatric-and-mental-health-nursing.csl' => 1,
'journal-of-product-innovation-management.csl' => 1,
'journal-of-pollination-ecology.csl' => 1,
'journal-of-plant-nutrition-and-soil-science.csl' => 1,
'journal-of-physical-therapy-science.csl' => 1,
'journal-of-phycology.csl' => 1,
'journal-of-pharmacy-and-pharmacology.csl' => 1,
'journal-of-petrology.csl' => 1,
'journal-of-perinatal-medicine.csl' => 1,
'journal-of-the-american-college-of-cardiology.csl' => 1,
'journal-of-the-american-society-of-brewing-chemists.csl' => 1,
'journal-of-peace-research.csl' => 1,
'journal-of-zoology.csl' => 1,
'kritische-ausgabe.csl' => 1,
'korean-journal-of-anesthesiology.csl' => 1,
'kommunikation-und-recht.csl' => 1,
'kolner-zeitschrift-fur-soziologie-und-sozialpsychologie.csl' => 1,
'knee-surgery-sports-traumatology-arthroscopy.csl' => 1,
'kindheit-und-entwicklung.csl' => 1,
'kidney-research-and-clinical-practice.csl' => 1,
'kidney-international.csl' => 1,
'karger-journals.csl' => 1,
'karger-journals-author-date.csl' => 1,
'juristische-zitierweise.csl' => 1,
'juristische-schulung.csl' => 1,
'journalistica.csl' => 1,
'journal-of-zoo-and-wildlife-medicine.csl' => 1,
'journal-of-the-american-society-of-nephrology.csl' => 1,
'journal-of-wildlife-diseases.csl' => 1,
'journal-of-visualized-experiments.csl' => 1,
'journal-of-veterinary-cardiology.csl' => 1,
'journal-of-vertebrate-paleontology.csl' => 1,
'journal-of-vegetation-science.csl' => 1,
'journal-of-urban-and-environmental-engineering.csl' => 1,
'journal-of-universal-computer-science.csl' => 1,
'journal-of-tropical-ecology.csl' => 1,
'journal-of-thrombosis-and-haemostasis.csl' => 1,
'journal-of-the-royal-anthropological-institute.csl' => 1,
'journal-of-the-electrochemical-society.csl' => 1,
'journal-of-the-brazilian-chemical-society.csl' => 1,
'journal-of-the-association-for-information-systems.csl' => 1,
'journal-of-the-american-water-resources-association.csl' => 1,
'journal-of-peptide-science.csl' => 1,
'journal-of-paleontology.csl' => 1,
'kth-royal-institute-of-technology-school-of-computer-science-and-communication.csl' => 1,
'journal-of-field-ornithology.csl' => 1,
'journal-of-hypertension.csl' => 1,
'journal-of-human-evolution.csl' => 1,
'journal-of-hospital-infection.csl' => 1,
'journal-of-hearing-science.csl' => 1,
'journal-of-glaciology.csl' => 1,
'journal-of-geriatric-psychiatry-and-neurology.csl' => 1,
'journal-of-genetic-engineering-and-biotechnology.csl' => 1,
'journal-of-frailty-and-aging.csl' => 1,
'journal-of-forensic-sciences.csl' => 1,
'journal-of-forensic-and-legal-medicine.csl' => 1,
'journal-of-food-protection.csl' => 1,
'journal-of-fish-diseases.csl' => 1,
'journal-of-finance.csl' => 1,
'journal-of-experimental-botany.csl' => 1,
'journal-of-industrial-ecology.csl' => 1,
'journal-of-evolutionary-biology.csl' => 1,
'journal-of-european-public-policy.csl' => 1,
'journal-of-endodontics.csl' => 1,
'journal-of-elections-public-opinion-and-parties.csl' => 1,
'journal-of-dental-research.csl' => 1,
'journal-of-crohns-and-colitis.csl' => 1,
'journal-of-crohns-and-colitis-supplements.csl' => 1,
'journal-of-consumer-research.csl' => 1,
'journal-of-computational-chemistry.csl' => 1,
'journal-of-common-market-studies.csl' => 1,
'journal-of-combinatorics.csl' => 1,
'journal-of-clinical-oncology.csl' => 1,
'journal-of-chiropractic-medicine.csl' => 1,
'journal-of-industrial-and-engineering-chemistry.csl' => 1,
'journal-of-infection.csl' => 1,
'journal-of-orthopaedics-trauma-and-rehabilitation.csl' => 1,
'journal-of-molecular-endocrinology.csl' => 1,
'journal-of-orthopaedic-trauma.csl' => 1,
'journal-of-orthopaedic-research.csl' => 1,
'journal-of-oral-and-maxillofacial-surgery.csl' => 1,
'journal-of-nutrition.csl' => 1,
'journal-of-neurotrauma.csl' => 1,
'journal-of-neurosurgery.csl' => 1,
'journal-of-neuroscience-and-neuroengineering.csl' => 1,
'journal-of-neurophysiology.csl' => 1,
'journal-of-neurological-disorders.csl' => 1,
'journal-of-neurochemistry.csl' => 1,
'journal-of-nanoscience-and-nanotechnology.csl' => 1,
'journal-of-music-technology-and-education.csl' => 1,
'journal-of-morphology.csl' => 1,
'journal-of-minimally-invasive-gynecology.csl' => 1,
'journal-of-infectious-diseases.csl' => 1,
'journal-of-medical-internet-research.csl' => 1,
'journal-of-medical-genetics.csl' => 1,
'journal-of-management.csl' => 1,
'journal-of-management-information-systems.csl' => 1,
'journal-of-mammalogy.csl' => 1,
'journal-of-magnetic-resonance-imaging.csl' => 1,
'journal-of-lipid-research.csl' => 1,
'journal-of-investigative-dermatology.csl' => 1,
'journal-of-international-business-studies.csl' => 1,
'journal-of-internal-medicine.csl' => 1,
'journal-of-interactive-marketing.csl' => 1,
'journal-of-integrated-omics.csl' => 1,
'journal-of-institutional-and-theoretical-economics.csl' => 1,
'journal-of-information-technology.csl' => 1,
'kth-royal-institute-of-technology-school-of-computer-science-and-communication-sv.csl' => 1,
'landes-bioscience-journals.csl' => 1,
'oxford-studies-on-the-roman-economy.csl' => 1,
'nature-no-et-al.csl' => 1,
'neurology.csl' => 1,
'neurology-india.csl' => 1,
'neurologia.csl' => 1,
'neurologia-argentina.csl' => 1,
'neuroimaging-clinics-of-north-america.csl' => 1,
'neue-juristische-wochenschrift.csl' => 1,
'nephrology-dialysis-transplantation.csl' => 1,
'nehet.csl' => 1,
'nccr-mediality.csl' => 1,
'navigation.csl' => 1,
'nature.csl' => 1,
'nature-publishing-group-vancouver.csl' => 1,
'nature-no-superscript.csl' => 1,
'nature-neuroscience-brief-communications.csl' => 1,
'neurorehabilitation-and-neural-repair.csl' => 1,
'national-science-foundation-grant-proposals.csl' => 1,
'national-library-of-medicine-grant-proposals.csl' => 1,
'national-institute-of-health-research.csl' => 1,
'national-archives-of-australia.csl' => 1,
'nano-biomedicine-and-engineering.csl' => 1,
'myrmecological-news.csl' => 1,
'mycologia.csl' => 1,
'mutagenesis.csl' => 1,
'multiple-sclerosis-journal.csl' => 1,
'multidisciplinary-digital-publishing-institute.csl' => 1,
'moorlands-college.csl' => 1,
'moore-theological-college.csl' => 1,
'mondes-en-developpement.csl' => 1,
'neuropsychopharmacology.csl' => 1,
'neuroreport.csl' => 1,
'molecular-psychiatry-letters.csl' => 1,
'optometry-and-vision-science.csl' => 1,
'oxford-studies-in-ancient-philosophy.csl' => 1,
'oxford-centre-for-mission-studies-harvard.csl' => 1,
'oxford-art-journal.csl' => 1,
'owbarth-verlag.csl' => 1,
'osterreichische-zeitschrift-fur-politikwissenschaft.csl' => 1,
'oscola.csl' => 1,
'oscola-no-ibid.csl' => 1,
'oryx.csl' => 1,
'orthopedic-clinics-of-north-america.csl' => 1,
'ornitologia-neotropical.csl' => 1,
'organization.csl' => 1,
'organization-science.csl' => 1,
'oral-diseases.csl' => 1,
'ophthalmology.csl' => 1,
'neurosurgery-clinics-of-north-america.csl' => 1,
'onderstepoort-journal-of-veterinary-research.csl' => 1,
'oikos.csl' => 1,
'occupational-medicine.csl' => 1,
'obesity.csl' => 1,
'nucleic-acids-research.csl' => 1,
'nowa-audiofonologia.csl' => 1,
'northeastern-naturalist.csl' => 1,
'norma-portuguesa-405.csl' => 1,
'new-zealand-veterinary-journal.csl' => 1,
'new-zealand-plant-protection.csl' => 1,
'new-testament-studies.csl' => 1,
'new-solutions.csl' => 1,
'new-phytologist.csl' => 1,
'new-harts-rules-the-oxford-style-guide.csl' => 1,
'molecular-therapy.csl' => 1,
'molecular-plant-pathology.csl' => 1,
'language-in-society.csl' => 1,
'liver-international.csl' => 1,
'mcgill-en.csl' => 1,
'mcdonald-institute-monographs.csl' => 1,
'mathematics-and-computers-in-simulation.csl' => 1,
'mastozoologia-neotropical.csl' => 1,
'manchester-university-press.csl' => 1,
'mammal-review.csl' => 1,
'magnetic-resonance-materials-in-physics-biology-and-medicine.csl' => 1,
'magnetic-resonance-in-medicine.csl' => 1,
'macromolecular-reaction-engineering.csl' => 1,
'lund-university-school-of-economics-and-management.csl' => 1,
'london-south-bank-university-numeric.csl' => 1,
'lluelles.csl' => 1,
'lluelles-no-ibid.csl' => 1,
'limnology-and-oceanography.csl' => 1,
'medecine-sciences.csl' => 1,
'leviathan.csl' => 1,
'lettres-et-sciences-humaines-fr.csl' => 1,
'lethaia.csl' => 1,
'les-journees-de-la-recherche-porcine.csl' => 1,
'les-journees-de-la-recherche-avicole.csl' => 1,
'leidraad-voor-juridische-auteurs.csl' => 1,
'le-tapuscrit-note.csl' => 1,
'le-tapuscrit-author-date.csl' => 1,
'le-mouvement-social.csl' => 1,
'law-and-society-review.csl' => 1,
'latin-american-research-review.csl' => 1,
'latin-american-perspectives.csl' => 1,
'language.csl' => 1,
'mcgill-fr.csl' => 1,
'media-culture-and-society.csl' => 1,
'molecular-plant-microbe-interactions.csl' => 1,
'mis-quarterly.csl' => 1,
'molecular-microbiology.csl' => 1,
'molecular-metabolism.csl' => 1,
'molecular-ecology.csl' => 1,
'molecular-biology-of-the-cell.csl' => 1,
'molecular-biology-and-evolution.csl' => 1,
'molecular-and-cellular-proteomics.csl' => 1,
'mohr-siebeck-recht.csl' => 1,
'modern-language-association.csl' => 1,
'modern-language-association-with-url.csl' => 1,
'modern-language-association-underline.csl' => 1,
'modern-language-association-6th-edition-note.csl' => 1,
'modern-humanities-research-association.csl' => 1,
'modern-humanities-research-association-author-date.csl' => 1,
'mineralogical-magazine.csl' => 1,
'medical-dosimetry.csl' => 1,
'middle-east-critique.csl' => 1,
'microscopy-and-microanalysis.csl' => 1,
'microbial-drug-resistance.csl' => 1,
'metropolitiques.csl' => 1,
'methods-of-information-in-medicine.csl' => 1,
'methods-in-ecology-and-evolution.csl' => 1,
'meteorological-applications.csl' => 1,
'meteoritics-and-planetary-science.csl' => 1,
'metallurgical-and-materials-transactions.csl' => 1,
'memorias-do-instituto-oswaldo-cruz.csl' => 1,
'melbourne-school-of-theology.csl' => 1,
'medicine-and-science-in-sports-and-exercise.csl' => 1,
'medical-physics.csl' => 1,
'medical-history.csl' => 1,
'easy.php' => 1,
'qrcode-terminal' => 1,
'journal-of-chemistry-and-chemical-engineering.csl' => 1,
'themecomponent.php' => 1,
'app-web.php' => 1,
'app-console.php' => 1,
'app-config.php' => 1,
'changelog-old' => 1,
'yasharewidget.php' => 1,
'yashasset.php' => 1,
'vkcommunitywidget.php' => 1,
'vkcommunityassetinnerfile.php' => 1,
'vkcommunityasset.php' => 1,
'vkcommentswidget.php' => 1,
'vkasset.php' => 1,
'viewcomponentsettings.php' => 1,
'viewcomponent.php' => 1,
'cmsseomodule.php' => 1,
'atroposasset.php' => 1,
'cmsseocomponent.php' => 1,
'cmssearchmodule.php' => 1,
'cmssearchcomponent.php' => 1,
'intlformatter.php' => 1,
'exchangeratescbrf.php' => 1,
'cmsmarketplacemodule.php' => 1,
'cmsmarketplacecomponent.php' => 1,
'mailersettings.php' => 1,
'logdbtarget.php' => 1,
'i18ndbmodule.php' => 1,
'i18ndbcomponent.php' => 1,
'cmssettingsexternallinkscomponent.php' => 1,
'cmsexternallinkscomponent.php' => 1,
'auto-config.php' => 1,
'boomerangasset.php' => 1,
'dbdumpercomponent.php' => 1,
'skillbertogitbundle.php' => 1,
'onesky' => 1,
'sevenoneskybundle.php' => 1,
'magebuild.phar' => 1,
'skimiaangularbundle.php' => 1,
'jquery.form.min.js' => 1,
'update-3.0' => 1,
'update-2.0' => 1,
'update-1.0' => 1,
'commandhandler.php' => 1,
'skillbertosonatapagemenubundle.php' => 1,
'skillbertosonataextendedadminbundle.php' => 1,
'skillbertoroutingextrabundle.php' => 1,
'skillbertolesscssbundle.php' => 1,
'skillbertoconsoleextendbundle.php' => 1,
'cubeasset.php' => 1,
'skillatwigmarkdownbundle.php' => 1,
'execute.php' => 1,
'highstock.php' => 1,
'highmaps.php' => 1,
'proxmoxcomponent.php' => 1,
'httpbasicauthcomponent.php' => 1,
'googleapicomponent.php' => 1,
'externallinksmodule.php' => 1,
'externallinkscomponent.php' => 1,
'ckeditorpresets.php' => 1,
'unifyasset.php' => 1,
'tshopasset.php' => 1,
'smartyasset.php' => 1,
'smartyadminasset.php' => 1,
'dbdumpermodule.php' => 1,
'_settingsfrom.php' => 1,
'typeserializer.php' => 1,
'zmqbroker.php' => 1,
'areachart.php' => 1,
'fuzzydatebehavior.php' => 1,
'datelineasset.php' => 1,
'dateline.php' => 1,
'bandoneonasset.php' => 1,
'bandoneon.php' => 1,
'_alphatrait.php' => 1,
'arraydataprovider.php' => 1,
'alphapager.php' => 1,
'spec4php.php' => 1,
'spec4php.bat' => 1,
'sixdaysopcachebundle.php' => 1,
'zmqworker.php' => 1,
'whereparser.php' => 1,
'columnchart.php' => 1,
'cachehelper.php' => 1,
'cacheactivequery.php' => 1,
'activequerycachehelper.php' => 1,
'smtoolsplugin.php' => 1,
'kphoensitemapbundle.php' => 1,
'framework2.sql' => 1,
'siriuslabaccountmanagerbundle.php' => 1,
'textutils.php' => 1,
'bvrbundle.php' => 1,
'sircampgooglemapformtypebundle.php' => 1,
'siphocpdfbundle.php' => 1,
'vadmin.php' => 1,
'listjs.php' => 1,
'bubblechart.php' => 1,
'geochart.php' => 1,
'cmsauthclientsettings.php' => 1,
'jquery.jqicon.js' => 1,
'cmsauthclientmodule.php' => 1,
'cmsauthclientcollection.php' => 1,
'settingsassetsautocompress.php' => 1,
'cmsagentmodule.php' => 1,
'cmsagentcomponent.php' => 1,
'daemonsbundle.php' => 1,
'fix_syle.sh' => 1,
'fix_style.sh' => 1,
'skautisbundle.php' => 1,
'min.jquery.jqdesktop.js' => 1,
'jquery.jqwindow.js' => 1,
'jquery.jqtaskbar.js' => 1,
'jquery.jqlayout.js' => 1,
'jquery.jqdesktop.js' => 1,
'linechart.php' => 1,
'jqdesktop.jquery.json' => 1,
'telexasset.php' => 1,
'telex.php' => 1,
'tagsuggestaction.php' => 1,
'tageditorasset.php' => 1,
'tageditor.php' => 1,
'tagbehavior.php' => 1,
'symbolpicker.php' => 1,
'symbolcolorsasset.php' => 1,
'spatialhelper.php' => 1,
'uploaderasset.php' => 1,
'illustration.php' => 1,
'illustrated.php' => 1,
'scatterchart.php' => 1,
'onesky.phar' => 1,
'rpcbundle.php' => 1,
'chatjs.php' => 1,
'monologbridge.php' => 1,
'linux0uidcontentfinderbundle.php' => 1,
'staticwp.php' => 1,
'whoopsbridge.php' => 1,
'viewmanager.php' => 1,
'servicefactory.php' => 1,
'ruleinterface.php' => 1,
'mimetypestore.php' => 1,
'errorstore.php' => 1,
'rsscollector.php' => 1,
'articleextractor.php' => 1,
'routerfactory.php' => 1,
'routebuildertrait.php' => 1,
'httpmethod.php' => 1,
'listenerpriorityqueue.php' => 1,
'default-avatar.png' => 1,
'listenerinterface.php' => 1,
'callbacklistener.php' => 1,
'servicedependency.php' => 1,
'dependencyinterface.php' => 1,
'helperregistry.php' => 1,
'helpcommand.php' => 1,
'dataobject.php' => 1,
'cakebridge.php' => 1,
'memcachedcache.php' => 1,
'memcachecache.php' => 1,
'arraycache.php' => 1,
'abstractcache.php' => 1,
'eventstore.php' => 1,
'smacharahtml2pdfbundle.php' => 1,
'smadasymfonytoolsbundle.php' => 1,
'apigen-config.neon' => 1,
'ezimagecropbundle.php' => 1,
'controller_front.php' => 1,
'controller_back.php' => 1,
'standardloader.php' => 1,
'standardformatter.php' => 1,
'iformatter.php' => 1,
'control.php' => 1,
'echartasset.php' => 1,
'echart.php' => 1,
'bar.php' => 1,
'phpunit_hhvm.sh' => 1,
'phpunit-coverage.bat' => 1,
'phpunit_smarty.php' => 1,
'smartivehandlebarsbundle.php' => 1,
'ezcontenttypemanagerbundle.php' => 1,
'smadasymfonytypeextrasbundle.php' => 1,
'flashmessage.php' => 1,
'monologlogroute.php' => 1,
'monologerrorhandler.php' => 1,
'monologcomponent.php' => 1,
'codemelli.php' => 1,
'jalali_date.php' => 1,
'magentoexception.php' => 1,
'magentoevents.php' => 1,
'magentobundle.php' => 1,
'drushrc.php.sample' => 1,
'cerbere.info' => 1,
'sample.yml' => 1,
'ajaxasset.php' => 1,
'smallteamimagebundle.php' => 1,
'custom.ini' => 1,
'cahngelog' => 1,
'skonsoftlftpdeployementbundle.php' => 1,
'abstracttransactionalproducer.php' => 1,
'zh_hk.csv.20160221' => 1,
'zh_hk.csv' => 1,
'demo_database.sqlite' => 1,
'skydiablophpseclibbundle.php' => 1,
'phpseclibautoloadersf21.php' => 1,
'phpseclibautoloadersf20.php' => 1,
'crypt_random.interface' => 1,
'skuolasitemapbundle.php' => 1,
'bcapi.class.php' => 1,
'skphp.php' => 1,
'skrzbunnybundle.php' => 1,
'bunnymanager.php' => 1,
'bunnyexception.php' => 1,
'abstractproducer.php' => 1,
'zh_hk.csv.20160320' => 1,
'skrzautowiringbundle.php' => 1,
'scaffolding.html' => 1,
'javascript.html' => 1,
'getting-started.html' => 1,
'extend.html' => 1,
'customize.html' => 1,
'components.html' => 1,
'base-css.html' => 1,
'skonsoftvehiclemanagerbundle.php' => 1,
'skonsofttranslatorbundle.php' => 1,
'skonsoftredirectorbundle.php' => 1,
'skonsoftpostaladdressbundle.php' => 1,
'skonsoftcompanyhierarchybundle.php' => 1,
'zh_hk.csv.20160222' => 1,
'license-cc0' => 1,
'out' => 1,
'class.router.php' => 1,
'recordlist.php' => 1,
'.scruninizer.yml' => 1,
'singletoninterface.php' => 1,
'basesingleton.php' => 1,
'basemethods.php' => 1,
'examplelogger.php' => 1,
'phpstan.neon' => 1,
'performance.php' => 1,
'sleepy.php' => 1,
'router.web.config' => 1,
'router.htaccess' => 1,
'class.template.php' => 1,
'class.sm.php' => 1,
'class.hooks.php' => 1,
'license-unlicense' => 1,
'class.debug.php' => 1,
'fancyguytodomvcclientbundle.php' => 1,
'update0.4.0' => 1,
'eovzmicrosofttranslatorapiclientbundle.php' => 1,
'hellowordplsimpleentitygeneratorbundle.php' => 1,
'environment.ini' => 1,
'update_app' => 1,
'init_update_app' => 1,
'bp-default-data.php' => 1,
'spdx-licenses.json' => 1,
'service_listing.php' => 1,
'template.twig' => 1,
'mimetypes.json' => 1,
'customize.json' => 1,
'chatroom.php' => 1,
'whatsappjs.php' => 1,
'zphp_jg.jpg' => 1,
'ltmain.sh' => 1,
'zmq_device.lo' => 1,
'zmq_device.c' => 1,
'zmq_clock.lo' => 1,
'zmq_clock.c' => 1,
'zmq.lo' => 1,
'zmq.la' => 1,
'zmq.c' => 1,
'php_zmq_private.h' => 1,
'php_zmq_pollset.h' => 1,
'php_zmq.h' => 1,
'php-zmq.spec' => 1,
'mkinstalldirs' => 1,
'missing' => 1,
'libtool' => 1,
'zmq_fd_stream.lo' => 1,
'install-sh' => 1,
'configure.in' => 1,
'config.sub' => 1,
'config.status' => 1,
'config.nice' => 1,
'config.log' => 1,
'config.h.in' => 1,
'config.h' => 1,
'config.guess' => 1,
'aclocal.m4' => 1,
'acinclude.m4' => 1,
'makefile.objects' => 1,
'makefile.global' => 1,
'zmq_fd_stream.c' => 1,
'zmq_pollset.c' => 1,
'.deps' => 1,
'pugpig_logging.php' => 1,
'phploc.bat' => 1,
'phpcpd.php' => 1,
'phpcpd.bat' => 1,
'sw' => 1,
'timber-rewrite-image-domain.php' => 1,
'croissant-sane-setup.php' => 1,
'croissant-admin-theme.php' => 1,
'shortlist-manifest-generator.php' => 1,
'pugpig_url_rewrites.php' => 1,
'pugpig_settings.php' => 1,
'pugpig_notifications_wordpress.php' => 1,
'pugpig_metaboxes.php' => 1,
'pugpig_manifests_wordpress.php' => 1,
'pugpig_html_manifest.php' => 1,
'zmq_pollset.lo' => 1,
'pugpig_filesystem.php' => 1,
'pugpig_change_hooks.php' => 1,
'pugpig_article_rewrite.php' => 1,
'pugpig_admin.php' => 1,
'pugpig_ad_bundles.php' => 1,
'old_pugpig.php' => 1,
'acf-typography.php' => 1,
'eula_en' => 1,
'eula' => 1,
'viewbundle.php' => 1,
'errorbundle.php' => 1,
'twitchapibundle.php' => 1,
'zmq_sockopt.lo' => 1,
'zmq_sockopt.c' => 1,
'makefile.fragments' => 1,
'timelinebundle.php' => 1,
'sami-md.cfg.php' => 1,
'httpauth.php' => 1,
'markupsolariumbundle.php' => 1,
'xml_doc.php' => 1,
'xml_curl.php' => 1,
'xml_api_call.php' => 1,
'urlsearchparams.php' => 1,
'systemcall.php' => 1,
'server_event.php' => 1,
'searchparams.php' => 1,
'namespacedfunction.php' => 1,
'magic_object.php' => 1,
'magic_cache.php' => 1,
'jsoncurl.php' => 1,
'ieconditionalcomment.php' => 1,
'html_element.php' => 1,
'hostbase-ansible.phar' => 1,
'html_el.php' => 1,
'html_doc.php' => 1,
'githubwebhook.php' => 1,
'exceptionlog.php' => 1,
'error_reporter.php' => 1,
'error_event.php' => 1,
'creative_commons_license.php' => 1,
'acimagepng.php' => 1,
'acimagejpg.php' => 1,
'acimagegif.php' => 1,
'acimage.php' => 1,
'accolor.php' => 1,
'seocontroller.php' => 1,
'haproxycc.phar' => 1,
'hostbase-manifest.json' => 1,
'keepassphp-cli.php' => 1,
'httpexceptiontest.php' => 1,
'ajaxopen.php' => 1,
'phpfun.php' => 1,
'statementbuilderinterface.php' => 1,
'objectcontainerinterface.php' => 1,
'jsonobjectcontainer.php' => 1,
'psr4autoloader.php' => 1,
'shivasversioningbundle.php' => 1,
'shivasbouncerbundle.php' => 1,
'shivasphealbundle.php' => 1,
'shiroyukiroutebundle.php' => 1,
'nature.functiontest.php' => 1,
'configuretest.php' => 1,
'curltest.php' => 1,
'apptest.php' => 1,
'hostbase.phar' => 1,
'nature.function.php' => 1,
'templatedesignerlayoutbundle.php' => 1,
'legendary_creatures_from_japan.json' => 1,
'dotdeb.list' => 1,
'docker-test.sh' => 1,
'docker-run.sh' => 1,
'docker-build.sh' => 1,
'loaderio-runner' => 1,
'heroku_create' => 1,
'spallocinebundle.php' => 1,
'noshreminder' => 1,
'noshfax' => 1,
'noshbackup' => 1,
'.google1' => 1,
'phploc.php' => 1,
'sami.cfg.php' => 1,
'whatsapp.php' => 1,
'maintenance.html.template' => 1,
'webbot.php' => 1,
'superthumb.jpg' => 1,
'validate.sh' => 1,
'run-caketests.php' => 1,
'urlcheck.php' => 1,
'spider.php' => 1,
'simgroepconcurrentspiderbundle.php' => 1,
'persistabledocument.php' => 1,
'invalidcontentexception.php' => 1,
'crawljob.php' => 1,
'terena_ssl_ca.pem' => 1,
'mollom-captcha-player.swf' => 1,
'.platform.yml' => 1,
'maintenance.htaccess.template' => 1,
'gumdrop.php' => 1,
'git-deploy.sh' => 1,
'environment.template' => 1,
'capfile.template' => 1,
'_configure_database.php' => 1,
'node_web.yml' => 1,
'node_ha.yml' => 1,
'node_deploynaut.yml' => 1,
'framework.patch' => 1,
'dependent-modules' => 1,
'buildfile.xml' => 1,
'symlinktask.php' => 1,
'silverstripetesttask.php' => 1,
'silverstripedeploytask.php' => 1,
'launch.sh' => 1,
'travis_build.sh' => 1,
'loadmodulestask.php' => 1,
'simplethingsformextrabundle.php' => 1,
'ageapibundle.php' => 1,
'sinencoallopasspaymentbundle.php' => 1,
'sinencoallopassapibundle.php' => 1,
'sineflowelasticsearchbundle.php' => 1,
'gifcreator.php' => 1,
'.simpspector.yml' => 1,
'stripeevents.php' => 1,
'simplewebstripebundle.php' => 1,
'simplewebsaasbundle.php' => 1,
'saasevents.php' => 1,
'simplewebbugsnagbundle.php' => 1,
'simpspector.yml' => 1,
'simplethingssolrbundle.php' => 1,
'simplethingsdistributionbundle.php' => 1,
'atom.xml.twig' => 1,
'simplesms.php' => 1,
'alipaybundle.php' => 1,
'deployer' => 1,
'mvc.sql' => 1,
'quickrbac.php' => 1,
'baseassetbundle.php' => 1,
'slamewhitelabelbundle.php' => 1,
'justgageassets.php' => 1,
'justgage.php' => 1,
'anonymoususercomponent.php' => 1,
'sitemap.xsl' => 1,
'sitemap.xml.twig' => 1,
'search_db.json.twig' => 1,
'page_db.json.twig' => 1,
'silverstripebuildtask.php' => 1,
'copyfolderstask.php' => 1,
'workflux.xsd' => 1,
'ndy' => 1,
'sikindustriesbundlestrobauserbundle.php' => 1,
'sikindustriesbundlesfacebookbundle.php' => 1,
'header.png' => 1,
'ico.php' => 1,
'start-redis-servers.sh' => 1,
'installdefaultapp.php' => 1,
'phpunit_db_config.travis.sqlite.php' => 1,
'phpunit_db_config.travis.mysql.php' => 1,
'phpunit_db_config.php.dist' => 1,
'siciarekphotogallerybundle.php' => 1,
'getresponseapibundle.php' => 1,
'siciarekchatbundle.php' => 1,
'properties.cnf.dist' => 1,
'trashquerybehavior.php' => 1,
'lumoon' => 1,
'trashquery.php' => 1,
'trashbehavior.php' => 1,
'translitinput.php' => 1,
'standartcontroller.php' => 1,
'urlcolumn.php' => 1,
'translatetrait.php' => 1,
'formfooter.php' => 1,
'userdatabehavior.php' => 1,
'lockedbehavior.php' => 1,
'dynamicquery.php' => 1,
'beforequerytrait.php' => 1,
'_intellij_phpunit_launcher.php' => 1,
'laravelblog' => 1,
'browserconfig.xml' => 1,
'lessc-adminlte' => 1,
'applypatchestask.php' => 1,
'monologserviceprovider.php' => 1,
'sisocontentloaderbundle.php' => 1,
'castanet.php' => 1,
'removetemplates.sh' => 1,
's3-expand' => 1,
'opsworks-deploy' => 1,
'local.env.dist' => 1,
'ecs-deploy' => 1,
'vardumperserviceprovider.php' => 1,
'twigserviceprovider.php' => 1,
'swiftmailerserviceprovider.php' => 1,
'servicecontrollerserviceprovider.php' => 1,
'securityserviceprovider.php' => 1,
'remembermeserviceprovider.php' => 1,
'localeserviceprovider.php' => 1,
'jenkins.yml' => 1,
'httpkernelserviceprovider.php' => 1,
'httpfragmentserviceprovider.php' => 1,
'httpcacheserviceprovider.php' => 1,
'exceptionhandlerserviceprovider.php' => 1,
'doctrineserviceprovider.php' => 1,
'csrfserviceprovider.php' => 1,
'assetserviceprovider.php' => 1,
'eventlistenerproviderinterface.php' => 1,
'controllerproviderinterface.php' => 1,
'bootableproviderinterface.php' => 1,
'read_me.html' => 1,
'amfphp_updates.php' => 1,
'lessc' => 1,
'.karma' => 1,
'journal-of-child-and-adolescent-psychopharmacology.csl' => 1,
'journal-of-cellular-and-molecular-medicine.csl' => 1,
'rzcalendarbundle.php' => 1,
'locales-hr-hr.xml' => 1,
'locales-nn-no.xml' => 1,
'locales-nl-nl.xml' => 1,
'locales-nb-no.xml' => 1,
'locales-mn-mn.xml' => 1,
'locales-lv-lv.xml' => 1,
'locales-lt-lt.xml' => 1,
'locales-ko-kr.xml' => 1,
'locales-km-kh.xml' => 1,
'locales-ja-jp.xml' => 1,
'locales-it-it.xml' => 1,
'locales-is-is.xml' => 1,
'locales-id-id.xml' => 1,
'locales-hu-hu.xml' => 1,
'locales-he-il.xml' => 1,
'locales-pt-br.xml' => 1,
'locales-fr-fr.xml' => 1,
'locales-fr-ca.xml' => 1,
'locales-fi-fi.xml' => 1,
'locales-fa-ir.xml' => 1,
'locales-eu.xml' => 1,
'locales-et-ee.xml' => 1,
'locales-es-mx.xml' => 1,
'locales-es-es.xml' => 1,
'locales-es-cl.xml' => 1,
'locales-en-us.xml' => 1,
'locales-en-gb.xml' => 1,
'locales-el-gr.xml' => 1,
'locales-de-de.xml' => 1,
'locales-pl-pl.xml' => 1,
'locales-pt-pt.xml' => 1,
'locales-de-at.xml' => 1,
'acm-sigchi-proceedings-extended-abstract-format.csl' => 1,
'acta-polytechnica.csl' => 1,
'acta-philosophica.csl' => 1,
'acta-pharmaceutica.csl' => 1,
'acta-pharmaceutica-sinica-b.csl' => 1,
'acta-palaeontologica-polonica.csl' => 1,
'acta-ophthalmologica.csl' => 1,
'acta-neurochirurgica.csl' => 1,
'acta-naturae.csl' => 1,
'acta-anaesthesiologica-taiwanica.csl' => 1,
'acta-anaesthesiologica-scandinavica.csl' => 1,
'acs-nano.csl' => 1,
'acm-siggraph.csl' => 1,
'acm-sigchi-proceedings.csl' => 1,
'acm-sig-proceedings.csl' => 1,
'locales-ro-ro.xml' => 1,
'acm-sig-proceedings-long-author-list.csl' => 1,
'academy-of-management-review.csl' => 1,
'locales.json' => 1,
'locales-zh-tw.xml' => 1,
'locales-zh-cn.xml' => 1,
'locales-vi-vn.xml' => 1,
'locales-uk-ua.xml' => 1,
'locales-tr-tr.xml' => 1,
'locales-th-th.xml' => 1,
'locales-sv-se.xml' => 1,
'locales-sr-rs.xml' => 1,
'locales-sl-si.xml' => 1,
'locales-sk-sk.xml' => 1,
'locales-ru-ru.xml' => 1,
'locales-de-ch.xml' => 1,
'locales-da-dk.xml' => 1,
'acta-societatis-botanicorum-poloniae.csl' => 1,
'adminpage.php' => 1,
'djjob.php' => 1,
'phpwee.php' => 1,
'abstractquery.php' => 1,
'iniconfig.php' => 1,
'extending' => 1,
'metricbundle.php' => 1,
'pimprestashopconnectorbundle.php' => 1,
'frozone.jpg' => 1,
'twitterstreambundle.php' => 1,
'requestevents.php' => 1,
'load-composer.php' => 1,
'postmetabox.php' => 1,
'boxespage.php' => 1,
'url-query.php' => 1,
'crosswalkquery.php' => 1,
'side.php' => 1,
'side-user.php' => 1,
'side-post.php' => 1,
'side-attachment.php' => 1,
'shortcodes.php' => 1,
'reciprocal-connection-type.php' => 1,
'query-user.php' => 1,
'query-post.php' => 1,
'list-renderer.php' => 1,
'item-user.php' => 1,
'item-post.php' => 1,
'item-attachment.php' => 1,
'item-any.php' => 1,
'crosswalk.php' => 1,
'crosswalkresponse.php' => 1,
'locales-cy-gb.xml' => 1,
'changelog-4.6' => 1,
'locales-cs-cz.xml' => 1,
'locales-ca-ad.xml' => 1,
'locales-bg-bg.xml' => 1,
'locales-ar.xml' => 1,
'locales-af-za.xml' => 1,
'generate-api-local.sh' => 1,
'changelog-5.4' => 1,
'changelog-5.3' => 1,
'changelog-5.2' => 1,
'changelog-5.1' => 1,
'changelog-5.0' => 1,
'changelog-4.8' => 1,
'changelog-4.7' => 1,
'changelog-4.5' => 1,
'dbunit' => 1,
'changelog-4.4' => 1,
'changelog-4.3' => 1,
'changelog-4.2' => 1,
'changelog-4.1' => 1,
'phptok' => 1,
'phploc' => 1,
'phpdcd' => 1,
'phpcpd' => 1,
'phpcov' => 1,
'changelog-3.3' => 1,
'changelog-2.2' => 1,
'pdepend-process' => 1,
'hhvm-wrapper' => 1,
'de-legacy-fy' => 1,
'acta-psychiatrica-scandinavica.csl' => 1,
'acta-universitatis-agriculturae-sueciae.csl' => 1,
'indeterminate-connection-type.php' => 1,
'annual-review-of-nuclear-and-particle-science.csl' => 1,
'apa-no-ampersand.csl' => 1,
'apa-fr-universite-de-montreal.csl' => 1,
'apa-fr-provost.csl' => 1,
'apa-cv.csl' => 1,
'apa-annotated-bibliography.csl' => 1,
'apa-5th-edition.csl' => 1,
'antiquity.csl' => 1,
'anticancer-research.csl' => 1,
'antarctic-science.csl' => 1,
'annual-reviews.csl' => 1,
'annual-reviews-without-titles.csl' => 1,
'annual-reviews-author-date.csl' => 1,
'annual-reviews-alphabetical.csl' => 1,
'annual-review-of-medicine.csl' => 1,
'apa-single-spaced.csl' => 1,
'annual-review-of-astronomy-and-astrophysics.csl' => 1,
'annals-of-the-association-of-american-geographers.csl' => 1,
'annals-of-oncology.csl' => 1,
'annals-of-neurology.csl' => 1,
'annals-of-botany.csl' => 1,
'annals-of-biomedical-engineering.csl' => 1,
'annals-of-applied-biology.csl' => 1,
'annales.csl' => 1,
'annalen-des-naturhistorischen-museums-in-wien.csl' => 1,
'animal-welfare.csl' => 1,
'angiologia.csl' => 1,
'angewandte-chemie.csl' => 1,
'anesthesiology.csl' => 1,
'apa-no-doi-no-issue.csl' => 1,
'apa-tr.csl' => 1,
'analytical-sciences.csl' => 1,
'asa-cssa-sssa.csl' => 1,
'associacao-nacional-de-pesquisa-e-ensino-em-transportes.csl' => 1,
'associacao-brasileira-de-normas-tecnicas.csl' => 1,
'associacao-brasileira-de-normas-tecnicas-usp-fmvz.csl' => 1,
'associacao-brasileira-de-normas-tecnicas-ufpr.csl' => 1,
'associacao-brasileira-de-normas-tecnicas-ufmg-face-initials.csl' => 1,
'associacao-brasileira-de-normas-tecnicas-ufmg-face-full.csl' => 1,
'associacao-brasileira-de-normas-tecnicas-ufjf.csl' => 1,
'associacao-brasileira-de-normas-tecnicas-note.csl' => 1,
'associacao-brasileira-de-normas-tecnicas-ipea.csl' => 1,
'associacao-brasileira-de-normas-tecnicas-eceme.csl' => 1,
'asian-studies-review.csl' => 1,
'asia-and-the-pacific-policy-studies.csl' => 1,
'asaio-journal.csl' => 1,
'arzneimitteltherapie.csl' => 1,
'apa.csl' => 1,
'arthritis-and-rheumatism.csl' => 1,
'artery-research.csl' => 1,
'art-history.csl' => 1,
'archivos-de-la-sociedad-espanola-de-oftalmologia.csl' => 1,
'archives-of-physical-medicine-and-rehabilitation.csl' => 1,
'archiv-fur-geschichte-der-philosophie.csl' => 1,
'archiv-fur-die-civilistische-praxis.csl' => 1,
'archeologie-medievale.csl' => 1,
'archaeometry.csl' => 1,
'arachnology.csl' => 1,
'arachne.csl' => 1,
'aquatic-living-resources.csl' => 1,
'aquatic-conservation.csl' => 1,
'applied-spectroscopy.csl' => 1,
'anesthesia-and-analgesia.csl' => 1,
'american-veterinary-medical-association.csl' => 1,
'administrative-science-quarterly.csl' => 1,
'ameghiniana.csl' => 1,
'american-geophysical-union.csl' => 1,
'american-fisheries-society.csl' => 1,
'american-chemical-society.csl' => 1,
'american-chemical-society-with-titles.csl' => 1,
'american-chemical-society-with-titles-sentence-case.csl' => 1,
'american-chemical-society-with-titles-sentence-case-doi.csl' => 1,
'american-chemical-society-with-titles-page-first.csl' => 1,
'american-chemical-society-with-titles-no-et-al.csl' => 1,
'american-chemical-society-page-first.csl' => 1,
'american-chemical-society-author-date.csl' => 1,
'american-association-of-petroleum-geologists.csl' => 1,
'american-association-for-cancer-research.csl' => 1,
'american-anthropological-association.csl' => 1,
'ambio.csl' => 1,
'american-institute-of-aeronautics-and-astronautics.csl' => 1,
'alternatives-to-animal-experimentation.csl' => 1,
'allergy.csl' => 1,
'allergology-international.csl' => 1,
'alexandria-journal-of-medicine.csl' => 1,
'aids.csl' => 1,
'aging-cell.csl' => 1,
'african-zoology.csl' => 1,
'african-journal-of-emergency-medicine.csl' => 1,
'advances-in-complex-systems.csl' => 1,
'advances-in-alzheimers-disease.csl' => 1,
'advanced-materials.csl' => 1,
'advanced-functional-materials.csl' => 1,
'advanced-engineering-materials.csl' => 1,
'american-heart-association.csl' => 1,
'american-institute-of-physics.csl' => 1,
'american-sociological-association.csl' => 1,
'american-medical-association-alphabetical.csl' => 1,
'american-society-of-mechanical-engineers.csl' => 1,
'american-society-of-civil-engineers.csl' => 1,
'american-society-for-pharmacology-and-experimental-therapeutics.csl' => 1,
'american-society-for-microbiology.csl' => 1,
'american-political-science-association.csl' => 1,
'american-phytopathological-society.csl' => 1,
'american-physiological-society.csl' => 1,
'american-physics-society.csl' => 1,
'american-mineralogist.csl' => 1,
'american-meteorological-society.csl' => 1,
'american-medical-association.csl' => 1,
'american-medical-association-no-url.csl' => 1,
'american-medical-association-no-et-al.csl' => 1,
'american-marketing-association.csl' => 1,
'american-journal-of-agricultural-economics.csl' => 1,
'american-journal-of-surgical-pathology.csl' => 1,
'american-journal-of-respiratory-and-critical-care-medicine.csl' => 1,
'american-journal-of-primatology.csl' => 1,
'american-journal-of-political-science.csl' => 1,
'american-journal-of-plant-sciences.csl' => 1,
'american-journal-of-orthodontics-and-dentofacial-orthopedics.csl' => 1,
'american-journal-of-neuroradiology.csl' => 1,
'american-journal-of-medical-genetics.csl' => 1,
'american-journal-of-human-genetics.csl' => 1,
'american-journal-of-health-behavior.csl' => 1,
'american-journal-of-epidemiology.csl' => 1,
'american-journal-of-clinical-pathology.csl' => 1,
'american-journal-of-botany.csl' => 1,
'american-journal-of-archaeology.csl' => 1,
'indeterminate-directed-connection-type.php' => 1,
'direction-strategy.php' => 1,
'association-for-computing-machinery.csl' => 1,
'tinybox2.js' => 1,
'network.php' => 1,
'emailstatus.php' => 1,
'ya_search.js' => 1,
'yasearch.php' => 1,
'iurl.php' => 1,
'smscua.php' => 1,
'scalecontroller.php' => 1,
'letsads.php' => 1,
'mixin.less' => 1,
'media.less' => 1,
'lessc.php' => 1,
'esputnik.php' => 1,
'coffeescript.php' => 1,
'tinybox.js' => 1,
'badcowaddressbundle.php' => 1,
'tinybox.css' => 1,
'smoothscroll.js' => 1,
'sjsslider.js' => 1,
'select.less' => 1,
'select.js' => 1,
'searchfilter.js' => 1,
'sjsmd5.js' => 1,
'sjslighbox.js' => 1,
'trim.js' => 1,
'sizzle.js' => 1,
'events.js' => 1,
'dom.js' => 1,
'compatibility.js' => 1,
'helloworld.class.php' => 1,
'__fff__.php' => 1,
'_samsonjs.js' => 1,
'inputswitch.php' => 1,
'definitions.php' => 1,
'simplefilter.php' => 1,
'spresssitemapxml.php' => 1,
'xmpp-enabled.php' => 1,
'juick-xp.php' => 1,
'license.fixtures' => 1,
'wcurl.php' => 1,
'wp-less.php' => 1,
'sparkpost-wp-mail.php' => 1,
'storageasset.php' => 1,
'themebootstrap.php' => 1,
'itemselectasset.php' => 1,
'itemselect.php' => 1,
'gridkeyval.php' => 1,
'social.html' => 1,
'daterangecolumn.php' => 1,
'fieldsetasset.php' => 1,
'ckeditorpackagepluginasset.php' => 1,
'browserasset.php' => 1,
'manytomanybehavior.php' => 1,
'areaasset.php' => 1,
'area.php' => 1,
'tag-and-release.sh' => 1,
'traverser.php' => 1,
'genealogy.php' => 1,
'genealogy.i18n.php' => 1,
'genealogy.i18n.magic.php' => 1,
'jimdojimflowprintticketbundle.php' => 1,
'swift-mail.php' => 1,
'binder.js' => 1,
'shoppingcartitem.php' => 1,
'mainform.java' => 1,
'rzredirectbundle.php' => 1,
'olixserverbundle.php' => 1,
'olixsecuritybundle.php' => 1,
'olixformsextbootstrapbundle.php' => 1,
'olixdatatablesbootstrapbundle.php' => 1,
'saadtazigchartbundle.php' => 1,
'rzusersecuritybundle.php' => 1,
'rzuserevents.php' => 1,
'rzuserbundle.php' => 1,
'rztimelinebundle.php' => 1,
'rztaxonomiesbundle.php' => 1,
'rzseobundle.php' => 1,
'rzsearchbundle.php' => 1,
'rzpiwikbundle.php' => 1,
'rzpagebundle.php' => 1,
'sdresthookbundle.php' => 1,
'rzoauthbundle.php' => 1,
'rznewsbundle.php' => 1,
'rzmediabundle.php' => 1,
'rzjquerybundle.php' => 1,
'rzgoogleapiclientbundle.php' => 1,
'rzformatterbundle.php' => 1,
'rzfieldtypebundle.php' => 1,
'rzdoctrineormadminbundle.php' => 1,
'rzcorebundle.php' => 1,
'rzcommentbundle.php' => 1,
'rzcodemirrorbundle.php' => 1,
'rzclassificationbundle.php' => 1,
'rzckeditorbundle.php' => 1,
'olixtestbundle.php' => 1,
'sachoocrudgenbundle.php' => 1,
'cmssearch.less' => 1,
'salbertsrecaptcha2bundle.php' => 1,
'cmssearch.js' => 1,
'samsoncms.sql.gz' => 1,
'psql.sql' => 1,
'config.bat' => 1,
'versioner' => 1,
'webshellasset.php' => 1,
'jqueryterminalasset.php' => 1,
'phpgsb.class.php' => 1,
'lookup.php' => 1,
'listupdater.php' => 1,
'savant3.php' => 1,
'jdatetime.class.php' => 1,
'tableprinter.php' => 1,
'wp_bootstrap_navwalker.php' => 1,
'operationstate.php' => 1,
'.brackets.json' => 1,
'test-sshkey' => 1,
'config.sh.sample' => 1,
'run-inspections' => 1,
'tomatomatombundle.php' => 1,
'linkedin_3.2.0.1.class.php' => 1,
'logger.class.php' => 1,
'juithemeselectwidget.php' => 1,
'juithemeselectasset.php' => 1,
'juithemeselect.js' => 1,
'actrack' => 1,
'basic-http-authentication.php' => 1,
'operationstatemanager.php' => 1,
'operationstateexception.php' => 1,
'test_bridge.php' => 1,
'architect.log' => 1,
'directed-connection-type.php' => 1,
'p3widgetsmodule.php' => 1,
'samples_docs.php' => 1,
'createtest.php' => 1,
'release-list' => 1,
'sugared-sami' => 1,
'sugared-phpunit' => 1,
'sugared-phpmd' => 1,
'sugared-phpcs' => 1,
'sugared-phpcbf' => 1,
'schnittstabil-phpunit-starter' => 1,
'giic-config.php' => 1,
'sakilamodule.php' => 1,
'ckeditorconfiguratormodule.php' => 1,
'phinflector.php' => 1,
'p3pagesmodule.php' => 1,
'phlop' => 1,
'p3mediamodule.php' => 1,
'p3adminmodule.php' => 1,
'emultithememanager.php' => 1,
'giic.xsl' => 1,
'giic.php' => 1,
'shellcolors.php' => 1,
'giiccommand.php' => 1,
'giicapplication.php' => 1,
'edatabasecommand.php' => 1,
'jmstwigjsbundle.php' => 1,
'jmssecurityextrabundle.php' => 1,
'jmspaymentpaypalbundle.php' => 1,
'jmspaymentcorebundle.php' => 1,
'samples_views.php' => 1,
'phlop.json' => 1,
'jmsdiextrabundle.php' => 1,
'.htaccess-sample' => 1,
'determinate-connection-type.php' => 1,
'connection-type.php' => 1,
'connection-type-factory.php' => 1,
'scribepheanstalkbundle.php' => 1,
'pheanstalklocator.php' => 1,
'code-climate-coverage.sh' => 1,
'ant.properties' => 1,
'pom-main.xml' => 1,
'scribestripebundle.php' => 1,
'scribeclockworkbundle.php' => 1,
'zuolikebundle.php' => 1,
'generate-config.sh' => 1,
'remote-uploads.sh' => 1,
'database-update.sh' => 1,
'hookrunner.php' => 1,
'database-prepare.sh' => 1,
'database-import.sh' => 1,
'database-export.sh' => 1,
'tzid.json' => 1,
'timezone_dump.php' => 1,
'timezone-select-screenshot.png' => 1,
'scorpiosphinxsearchbundle.php' => 1,
'scoreyacinderellasdkbundle.php' => 1,
'phpunit_onlyreduceruntime.xml' => 1,
'phpunit_onlyenvironment.xml' => 1,
'scigrouptinymcepluploadfilemanagerbundle.php' => 1,
'traits.php' => 1,
'facades.php' => 1,
'precommit.yml' => 1,
'jmsgoogleclosurebundle.php' => 1,
'jmsdebuggingbundle.php' => 1,
'architect.log.1' => 1,
'mediaapibundle.php' => 1,
'rutvalidatorasset.php' => 1,
'rutvalidator.php' => 1,
'rutformatbehavior.php' => 1,
'excelview.php' => 1,
'test3.php' => 1,
'layout.macro' => 1,
'example-template3.macro' => 1,
'example-template2.macro' => 1,
'example-template.php' => 1,
'example-element1.php' => 1,
'ods.php' => 1,
'pclzip.php' => 1,
'nanophp' => 1,
'applog.log' => 1,
'rutwidgetasset.php' => 1,
'ahservicearchivingbundle.php' => 1,
'history.js' => 1,
'santhapanepalidateconverterbundle.php' => 1,
'monstabox.php' => 1,
'lotteryresultbundle.php' => 1,
'.pomm_cli_bootstrap.php' => 1,
'sangkilbiz.backup' => 1,
'sangkilbiz-3 data model.architect' => 1,
'init_db_schema_only.sql' => 1,
'init_db_data_only3.sql' => 1,
'init_db_data_only2.sql' => 1,
'init_db_data_only.sql' => 1,
'db_schemas.sql' => 1,
'rutwidget.php' => 1,
'jquery.rut.js' => 1,
'jmscommandbundle.php' => 1,
'scandiopaginatorbundle.php' => 1,
'jmsaopbundle.php' => 1,
'api-key.local.php.dist' => 1,
'asins.php' => 1,
'flexiblecallback.php' => 1,
'local-config.php.dist' => 1,
'readme_fork' => 1,
'noticeexception.php' => 1,
'invalidexception.php' => 1,
'tombstone.php' => 1,
'tombstone' => 1,
'schebstockpanelbundle.php' => 1,
'copying.phalcon' => 1,
'scandiotrobabridgebundle.php' => 1,
'scabbia.bat' => 1,
'rut-widget.js' => 1,
'xmlstr_to_array.php' => 1,
'saymegulprevbundle.php' => 1,
'saxulum-collection.js' => 1,
'vsavritskymorpherbundle.php' => 1,
'saulswidgetbundle.php' => 1,
'mooflashcardbundle.php' => 1,
'mooflashcardadminbundle.php' => 1,
'log4php.xml' => 1,
'rss_utils.inc' => 1,
'rss_parse.inc' => 1,
'rss_fetch.inc' => 1,
'rss_cache.inc' => 1,
'troubleshooting' => 1,
'satelliteudeploybundle.php' => 1,
'association-for-computational-linguistics.csl' => 1,
'atencion-primaria.csl' => 1,
'journal-of-cardiothoracic-and-vascular-anesthesia.csl' => 1,
'harvard-leeds-metropolitan-university.csl' => 1,
'harvard-the-university-of-melbourne.csl' => 1,
'harvard-swinburne-university-of-technology.csl' => 1,
'harvard-stellenbosch-university.csl' => 1,
'harvard-staffordshire-university.csl' => 1,
'harvard-southampton-solent-university.csl' => 1,
'harvard-pontificia-universidad-catolica-del-ecuador.csl' => 1,
'harvard-oxford-brookes-university-faculty-of-health-and-life-sciences.csl' => 1,
'harvard-north-west-university.csl' => 1,
'harvard-newcastle-university.csl' => 1,
'harvard-manchester-metropolitan-university.csl' => 1,
'harvard-manchester-business-school.csl' => 1,
'harvard-london-south-bank-university.csl' => 1,
'harvard-limerick.csl' => 1,
'harvard-leeds-beckett-university.csl' => 1,
'harvard-the-university-of-sheffield-school-of-east-asian-studies.csl' => 1,
'harvard-kings-college-london.csl' => 1,
'harvard-institut-fur-praxisforschung-de.csl' => 1,
'harvard-imperial-college-london.csl' => 1,
'harvard-gesellschaft-fur-bildung-und-forschung-in-europa.csl' => 1,
'harvard-fachhochschule-salzburg.csl' => 1,
'harvard-european-archaeology.csl' => 1,
'harvard-edge-hill-university.csl' => 1,
'harvard-durham-university-business-school.csl' => 1,
'harvard-dundalk-institute-of-technology.csl' => 1,
'harvard-cranfield-university.csl' => 1,
'harvard-coventry-university.csl' => 1,
'harvard-cite-them-right.csl' => 1,
'harvard-cardiff-university.csl' => 1,
'harvard-the-university-of-northampton.csl' => 1,
'harvard-the-university-of-sheffield-town-and-regional-planning.csl' => 1,
'harvard-cape-peninsula-university-of-technology.csl' => 1,
'harvard-university-of-worcester.csl' => 1,
'hematology-oncology-clinics-of-north-america.csl' => 1,
'heart-rhythm.csl' => 1,
'heart-failure-clinics.csl' => 1,
'health-services-research.csl' => 1,
'health-reform-observer-observatoire-des-reformes-de-sante.csl' => 1,
'health-policy-and-planning.csl' => 1,
'health-economics.csl' => 1,
'health-economics-policy-and-law.csl' => 1,
'health-and-social-care-in-the-community.csl' => 1,
'hawaii-international-conference-on-system-sciences-proceedings.csl' => 1,
'harvard7de.csl' => 1,
'harvard1.csl' => 1,
'harvard-york-st-john-university.csl' => 1,
'harvard-university-of-wolverhampton.csl' => 1,
'harvard-universiti-tunku-abdul-rahman.csl' => 1,
'harvard-university-of-westminster.csl' => 1,
'harvard-university-of-west-london.csl' => 1,
'harvard-university-of-the-west-of-scotland.csl' => 1,
'harvard-university-of-the-west-of-england.csl' => 1,
'harvard-university-of-sunderland.csl' => 1,
'harvard-university-of-leeds.csl' => 1,
'harvard-university-of-kent.csl' => 1,
'harvard-university-of-greenwich.csl' => 1,
'harvard-university-of-gloucestershire.csl' => 1,
'harvard-university-of-cape-town.csl' => 1,
'harvard-university-of-brighton-school-of-environment-and-technology.csl' => 1,
'harvard-university-of-birmingham.csl' => 1,
'harvard-university-of-abertay-dundee.csl' => 1,
'harvard-university-for-the-creative-arts.csl' => 1,
'harvard-cardiff-university-biosi.csl' => 1,
'harvard-bournemouth-university.csl' => 1,
'heredity.csl' => 1,
'food-and-agriculture-organization-of-the-united-nations.csl' => 1,
'frontiers-in-optics.csl' => 1,
'frontiers-in-ecology-and-the-environment.csl' => 1,
'freshwater-science.csl' => 1,
'freshwater-biology.csl' => 1,
'french4.csl' => 1,
'french3.csl' => 1,
'french2.csl' => 1,
'french1.csl' => 1,
'french-politics.csl' => 1,
'freie-universitat-berlin-geographische-wissenschaften.csl' => 1,
'free-radical-research.csl' => 1,
'forest-science.csl' => 1,
'forensic-science-review.csl' => 1,
'fold-and-r.csl' => 1,
'frontiers-medical-journals.csl' => 1,
'foerster-geisteswissenschaft.csl' => 1,
'florida-entomologist.csl' => 1,
'flavour-and-fragrance-journal.csl' => 1,
'fish-and-fisheries.csl' => 1,
'first-monday.csl' => 1,
'finanzarchiv.csl' => 1,
'fertility-and-sterility.csl' => 1,
'ferdinand-porsche-fern-fachhochschule.csl' => 1,
'facial-plastic-surgery-clinics-of-north-america.csl' => 1,
'fachhochschule-vorarlberg.csl' => 1,
'fachhochschule-kiel-fachbereich-medien.csl' => 1,
'eye.csl' => 1,
'experimental-dermatology.csl' => 1,
'frontiers-in-physics.csl' => 1,
'frontiers.csl' => 1,
'harvard-anglia-ruskin-university.csl' => 1,
'geological-magazine.csl' => 1,
'hand.csl' => 1,
'hamburg-school-of-food-science.csl' => 1,
'grasas-y-aceites.csl' => 1,
'gost-r-7-0-5-2008.csl' => 1,
'gost-r-7-0-5-2008-numeric.csl' => 1,
'gost-r-7-0-5-2008-numeric-alphabetical.csl' => 1,
'global-ecology-and-biogeography.csl' => 1,
'global-change-biology.csl' => 1,
'gewerblicher-rechtsschutz-und-urheberrecht.csl' => 1,
'gesellschaft-fur-popularmusikforschung.csl' => 1,
'georg-august-universitat-gottingen-institut-fur-ethnologie-und-ethnologische-sammlung.csl' => 1,
'geopolitics.csl' => 1,
'geology.csl' => 1,
'geografie-sbornik-cgs.csl' => 1,
'future-science-group.csl' => 1,
'geochimica-et-cosmochimica-acta.csl' => 1,
'geobiology.csl' => 1,
'geoarchaeology.csl' => 1,
'genome-biology-and-evolution.csl' => 1,
'genetics.csl' => 1,
'genetics-and-molecular-biology.csl' => 1,
'geneses.csl' => 1,
'genes-to-cells.csl' => 1,
'geistes-und-kulturwissenschaften-heilmann.csl' => 1,
'gastrointestinal-intervention.csl' => 1,
'gastrointestinal-endoscopy-clinics-of-north-america.csl' => 1,
'gastroenterology.csl' => 1,
'gallia.csl' => 1,
'g3.csl' => 1,
'hepatology.csl' => 1,
'hiob-ludolf-centre-for-ethiopian-studies-with-url-doi.csl' => 1,
'evolutionary-ecology-research.csl' => 1,
'investigative-radiology.csl' => 1,
'iso690-numeric-cs.csl' => 1,
'iso690-numeric-brackets-cs.csl' => 1,
'iso690-note-fr.csl' => 1,
'iso690-note-cs.csl' => 1,
'iso690-full-note-sk.csl' => 1,
'iso690-author-date-sk.csl' => 1,
'iso690-author-date-fr.csl' => 1,
'iso690-author-date-fr-no-abstract.csl' => 1,
'iso690-author-date-es.csl' => 1,
'iso690-author-date-en.csl' => 1,
'iso690-author-date-cs.csl' => 1,
'irish-historical-studies.csl' => 1,
'invisu.csl' => 1,
'invertebrate-biology.csl' => 1,
'iso690-numeric-fr.csl' => 1,
'international-union-of-crystallography.csl' => 1,
'international-studies-association.csl' => 1,
'international-pig-veterinary-society-congress-proceedings.csl' => 1,
'international-organization.csl' => 1,
'international-microbiology.csl' => 1,
'international-labour-organization.csl' => 1,
'international-journal-of-wildland-fire.csl' => 1,
'international-journal-of-sports-medicine.csl' => 1,
'international-journal-of-radiation-oncology-biology-physics.csl' => 1,
'international-journal-of-quantum-chemistry.csl' => 1,
'international-journal-of-plant-sciences.csl' => 1,
'international-journal-of-osteopathic-medicine.csl' => 1,
'international-journal-of-osteoarchaeology.csl' => 1,
'iso690-numeric-en.csl' => 1,
'iso690-numeric-lt.csl' => 1,
'international-journal-of-occupational-medicine-and-environmental-health.csl' => 1,
'journal-of-applied-ecology.csl' => 1,
'journal-of-business-logistics.csl' => 1,
'journal-of-burn-care-and-research.csl' => 1,
'journal-of-brachial-plexus-and-peripheral-nerve-injury.csl' => 1,
'journal-of-bone-and-mineral-research.csl' => 1,
'journal-of-biomedical-materials-research-part-a.csl' => 1,
'journal-of-biological-chemistry.csl' => 1,
'journal-of-biogeography.csl' => 1,
'journal-of-basic-microbiology.csl' => 1,
'journal-of-avian-biology.csl' => 1,
'journal-of-atrial-fibrillation.csl' => 1,
'journal-of-archaeological-research.csl' => 1,
'journal-of-applied-philosophy.csl' => 1,
'journal-of-applied-entomology.csl' => 1,
'journal-of-applied-animal-science.csl' => 1,
'iso690-numeric-sk.csl' => 1,
'journal-of-antimicrobial-chemotherapy.csl' => 1,
'journal-of-animal-science.csl' => 1,
'journal-of-animal-physiology-and-animal-nutrition.csl' => 1,
'journal-of-analytical-toxicology.csl' => 1,
'journal-of-alzheimers-disease.csl' => 1,
'journal-of-aerosol-medicine-and-pulmonary-drug-delivery.csl' => 1,
'journal-of-adolescent-health.csl' => 1,
'journal-for-the-history-of-astronomy.csl' => 1,
'javnost-the-public.csl' => 1,
'jahrbuch-fur-evangelikale-theologie.csl' => 1,
'jahrbuch-der-osterreichischen-byzantinischen-gesellschaft.csl' => 1,
'jacc-cardiovascular-imaging.csl' => 1,
'ithaque.csl' => 1,
'israel-medical-association-journal.csl' => 1,
'international-journal-of-oral-and-maxillofacial-surgery.csl' => 1,
'international-journal-of-obstetric-anesthesia.csl' => 1,
'hiob-ludolf-centre-for-ethiopian-studies.csl' => 1,
'hydrobiologia.csl' => 1,
'indian-journal-of-medical-research.csl' => 1,
'immunological-reviews.csl' => 1,
'im-gesprach.csl' => 1,
'iica-catie.csl' => 1,
'igaku-toshokan.csl' => 1,
'ieee.csl' => 1,
'ieee-with-url.csl' => 1,
'ie-comunicaciones.csl' => 1,
'ices-journal-of-marine-science.csl' => 1,
'hypotheses-in-the-life-sciences.csl' => 1,
'hypertension-research.csl' => 1,
'hydrological-sciences-journal.csl' => 1,
'hydrological-processes.csl' => 1,
'humboldt-state-university-environmental-resources-engineering.csl' => 1,
'infectio.csl' => 1,
'human-wildlife-interactions.csl' => 1,
'human-resource-management-journal.csl' => 1,
'human-reproduction.csl' => 1,
'human-reproduction-update.csl' => 1,
'human-mutation.csl' => 1,
'human-brain-mapping.csl' => 1,
'hong-kong-journal-of-radiology.csl' => 1,
'hochschule-fur-wirtschaft-und-recht-berlin.csl' => 1,
'history-of-the-human-sciences.csl' => 1,
'history-and-theory.csl' => 1,
'histoire-et-mesure.csl' => 1,
'histoire-at-politique.csl' => 1,
'hipertension-y-riesgo-vascular.csl' => 1,
'indoor-air.csl' => 1,
'infectious-disease-clinics-of-north-america.csl' => 1,
'international-journal-of-nuclear-security.csl' => 1,
'interdisziplinare-zeitschrift-fur-technologie-und-lernen.csl' => 1,
'international-journal-of-lexicography.csl' => 1,
'international-journal-of-infectious-diseases.csl' => 1,
'international-journal-of-humanoid-robotics.csl' => 1,
'international-journal-of-geriatric-psychiatry.csl' => 1,
'international-journal-of-food-science-and-technology.csl' => 1,
'international-journal-of-exercise-science.csl' => 1,
'international-journal-of-epidemiology.csl' => 1,
'international-journal-of-electronic-commerce.csl' => 1,
'international-journal-of-climatology.csl' => 1,
'international-journal-of-cancer.csl' => 1,
'international-journal-of-audiology.csl' => 1,
'international-conference-on-information-systems-development.csl' => 1,
'international-atomic-energy-agency.csl' => 1,
'interaction-design-and-architectures.csl' => 1,
'inflammatory-bowel-diseases.csl' => 1,
'inter-ro.csl' => 1,
'inter-research-science-center.csl' => 1,
'instituto-superior-de-teologia-de-las-islas-canarias.csl' => 1,
'instituto-de-pesquisas-tecnologicas.csl' => 1,
'institute-of-physics-numeric.csl' => 1,
'institute-of-physics-harvard.csl' => 1,
'institut-national-de-sante-publique-du-quebec-topo.csl' => 1,
'institut-national-de-sante-publique-du-quebec-napp.csl' => 1,
'institut-national-de-la-recherche-scientifique-sciences-sociales.csl' => 1,
'ingenieria-agricola.csl' => 1,
'information-systems-research.csl' => 1,
'infoclio-fr-smallcaps.csl' => 1,
'infoclio-fr-nocaps.csl' => 1,
'infoclio-de.csl' => 1,
'exercer.csl' => 1,
'evolutionary-anthropology.csl' => 1,
'ausonius-editions.csl' => 1,
'cellular-reprogramming.csl' => 1,
'chicago-author-date.csl' => 1,
'chicago-author-date-fr.csl' => 1,
'chicago-author-date-de.csl' => 1,
'chicago-author-date-basque.csl' => 1,
'chicago-annotated-bibliography.csl' => 1,
'chest.csl' => 1,
'chemical-senses.csl' => 1,
'chemical-and-pharmaceutical-bulletin.csl' => 1,
'changer-d-epoque.csl' => 1,
'ceska-zemedelska-univerzita-v-praze-fakulta-agrobiologie-potravinovych-a-prirodnich-zdroju.csl' => 1,
'cerebral-cortex.csl' => 1,
'centre-de-recherche-sur-les-civilisations-de-l-asie-orientale.csl' => 1,
'centaurus.csl' => 1,
'cellular-and-molecular-bioengineering.csl' => 1,
'chicago-fullnote-bibliography-fr.csl' => 1,
'cell.csl' => 1,
'cell-transplantation.csl' => 1,
'cell-research.csl' => 1,
'cell-numeric.csl' => 1,
'catholic-biblical-association.csl' => 1,
'cardiocore.csl' => 1,
'carcinogenesis.csl' => 1,
'carbohydrate-research.csl' => 1,
'canadian-public-policy.csl' => 1,
'canadian-journal-of-fisheries-and-aquatic-sciences.csl' => 1,
'canadian-journal-of-economics.csl' => 1,
'canadian-journal-of-dietetic-practice-and-research.csl' => 1,
'campus-adventiste-du-saleve-faculte-adventiste-de-theologie.csl' => 1,
'chicago-figures.csl' => 1,
'chicago-fullnote-bibliography-no-ibid.csl' => 1,
'byzantina-symmeikta.csl' => 1,
'clays-and-clay-minerals.csl' => 1,
'collection-du-centre-jean-berard.csl' => 1,
'collection-de-l-ecole-francaise-de-rome-note.csl' => 1,
'collection-de-l-ecole-francaise-de-rome-full-note.csl' => 1,
'cold-spring-harbor-laboratory-press.csl' => 1,
'cns-and-neurological-disorders-drug-targets.csl' => 1,
'clio-medica.csl' => 1,
'clinical-pharmacology-and-therapeutics.csl' => 1,
'clinical-otolaryngology.csl' => 1,
'clinical-orthopaedics-and-related-research.csl' => 1,
'clinical-nuclear-medicine.csl' => 1,
'clinical-infectious-diseases.csl' => 1,
'clinical-gastroenterology-and-hepatology.csl' => 1,
'clinica-e-investigacion-en-arteriosclerosis.csl' => 1,
'clay-minerals.csl' => 1,
'chicago-fullnote-bibliography.csl' => 1,
'clara-architecture-recherche.csl' => 1,
'cladistics.csl' => 1,
'cirugia-espanola.csl' => 1,
'cirugia-cardiovascular.csl' => 1,
'circulation.csl' => 1,
'chroniques-des-activites-archeologiques-de-l-ecole-francaise-de-rome.csl' => 1,
'chinese-journal-of-aeronautics.csl' => 1,
'chinese-gb7714-2005-numeric.csl' => 1,
'chinese-gb7714-2005-author-date.csl' => 1,
'chinese-gb7714-1987-numeric.csl' => 1,
'chimia.csl' => 1,
'chicago-note-bibliography.csl' => 1,
'chicago-note-biblio-no-ibid.csl' => 1,
'chicago-library-list.csl' => 1,
'cahiers-du-centre-gustave-glotz.csl' => 1,
'bulletin-of-marine-science.csl' => 1,
'collections-electroniques-de-l-inha-full-note.csl' => 1,
'beltz-padagogik.csl' => 1,
'biological-psychiatry.csl' => 1,
'biological-journal-of-the-linnean-society.csl' => 1,
'biological-and-pharmaceutical-bulletin.csl' => 1,
'biologia.csl' => 1,
'bioinformatics.csl' => 1,
'bioessays.csl' => 1,
'bioelectromagnetics.csl' => 1,
'biochimica-et-biophysica-acta.csl' => 1,
'biochemistry.csl' => 1,
'biochemical-society-transactions.csl' => 1,
'biochemical-journal.csl' => 1,
'bioarchaeology-of-the-near-east.csl' => 1,
'bibtex.csl' => 1,
'babes-bolyai-university-faculty-of-orthodox-theology.csl' => 1,
'biology-of-reproduction.csl' => 1,
'aviation-space-and-environmental-medicine.csl' => 1,
'avian-pathology.csl' => 1,
'avian-diseases.csl' => 1,
'avian-conservation-and-ecology.csl' => 1,
'austrian-legal.csl' => 1,
'australian-veterinary-journal.csl' => 1,
'australian-journal-of-grape-and-wine-research.csl' => 1,
'australian-journal-of-earth-sciences.csl' => 1,
'australian-historical-studies.csl' => 1,
'australian-guide-to-legal-citation.csl' => 1,
'australian-critical-care.csl' => 1,
'australasian-emergency-nursing-journal.csl' => 1,
'austral-ecology.csl' => 1,
'biological-reviews.csl' => 1,
'biomed-central.csl' => 1,
'bulletin-of-faculty-of-pharmacy-cairo-university.csl' => 1,
'brain.csl' => 1,
'bulletin-de-la-societe-prehistorique-francaise.csl' => 1,
'building-structure.csl' => 1,
'british-journal-of-surgery.csl' => 1,
'british-journal-of-political-science.csl' => 1,
'british-journal-of-pharmacology.csl' => 1,
'british-journal-of-industrial-relations.csl' => 1,
'british-journal-of-haematology.csl' => 1,
'british-journal-of-dermatology.csl' => 1,
'british-journal-of-cancer.csl' => 1,
'british-journal-of-anaesthesia.csl' => 1,
'british-ecological-society.csl' => 1,
'briefings-in-bioinformatics.csl' => 1,
'brazilian-journal-of-infectious-diseases.csl' => 1,
'boreal-environment-research.csl' => 1,
'biomed-research-international.csl' => 1,
'body-and-society.csl' => 1,
'bmj.csl' => 1,
'bluebook2.csl' => 1,
'bluebook-law-review.csl' => 1,
'bluebook-inline.csl' => 1,
'blood.csl' => 1,
'biotropica.csl' => 1,
'biotechnology-and-bioengineering.csl' => 1,
'biotechniques.csl' => 1,
'bioresources.csl' => 1,
'biopolymers.csl' => 1,
'biophysical-journal.csl' => 1,
'bioorganic-and-medicinal-chemistry-letters.csl' => 1,
'biometrics.csl' => 1,
'collections-electroniques-de-l-inha-author-date.csl' => 1,
'colombian-journal-of-anesthesiology.csl' => 1,
'evolution.csl' => 1,
'enfermeria-clinica.csl' => 1,
'environmental-toxicology-and-chemistry.csl' => 1,
'environmental-microbiology.csl' => 1,
'environmental-health-perspectives.csl' => 1,
'environmental-conservation.csl' => 1,
'environmental-chemistry.csl' => 1,
'environmental-and-engineering-geoscience.csl' => 1,
'environment-and-urbanization.csl' => 1,
'environment-and-planning.csl' => 1,
'entomological-society-of-america.csl' => 1,
'entomologia-experimentalis-et-applicata.csl' => 1,
'ens-de-lyon-centre-d-ingenierie-documentaire.csl' => 1,
'engineering-in-life-sciences.csl' => 1,
'enfermeria-intensiva.csl' => 1,
'endoscopia.csl' => 1,
'epidemiologie-et-sante-animale.csl' => 1,
'endocrinologia-y-nutricion.csl' => 1,
'endocrine-press.csl' => 1,
'emu-austral-ornithology.csl' => 1,
'emerald-harvard.csl' => 1,
'embo-reports.csl' => 1,
'elsevier-without-titles.csl' => 1,
'elsevier-with-titles.csl' => 1,
'elsevier-with-titles-alphabetical.csl' => 1,
'elsevier-vancouver.csl' => 1,
'elsevier-harvard2.csl' => 1,
'elsevier-harvard.csl' => 1,
'elsevier-harvard-without-titles.csl' => 1,
'el-profesional-de-la-informacion.csl' => 1,
'environnement-risques-et-sante.csl' => 1,
'equine-veterinary-education.csl' => 1,
'ecosistemas.csl' => 1,
'european-journal-of-international-law.csl' => 1,
'evolution-and-development.csl' => 1,
'european-union-interinstitutional-style-guide.csl' => 1,
'european-society-of-cardiology.csl' => 1,
'european-retail-research.csl' => 1,
'european-respiratory-journal.csl' => 1,
'european-journal-of-vascular-and-endovascular-surgery.csl' => 1,
'european-journal-of-surgical-oncology.csl' => 1,
'european-journal-of-soil-science.csl' => 1,
'european-journal-of-political-research.csl' => 1,
'european-journal-of-pain.csl' => 1,
'european-journal-of-paediatric-neurology.csl' => 1,
'european-journal-of-ophthalmology.csl' => 1,
'european-journal-of-neuroscience.csl' => 1,
'european-journal-of-information-systems.csl' => 1,
'equine-veterinary-journal.csl' => 1,
'european-journal-of-immunology.csl' => 1,
'european-journal-of-human-genetics.csl' => 1,
'european-journal-of-emergency-medicine.csl' => 1,
'european-journal-of-clinical-microbiology-and-infectious-diseases.csl' => 1,
'european-cells-and-materials.csl' => 1,
'europace.csl' => 1,
'ets-ecole-de-technologie-superieure.csl' => 1,
'ethnologie-francaise.csl' => 1,
'ethnobiology-and-conservation.csl' => 1,
'ethics-book-reviews.csl' => 1,
'escuela-nacional-de-antropologia-e-historia-short-note.csl' => 1,
'escuela-nacional-de-antropologia-e-historia-full-note.csl' => 1,
'escuela-nacional-de-antropologia-e-historia-author-date.csl' => 1,
'ergoscience.csl' => 1,
'ecosystems.csl' => 1,
'ecoscience.csl' => 1,
'comision-economica-para-america-latina-y-el-caribe.csl' => 1,
'cultivos-tropicales.csl' => 1,
'der-moderne-staat.csl' => 1,
'demographic-research.csl' => 1,
'decision-sciences.csl' => 1,
'de-buck.csl' => 1,
'database.csl' => 1,
'cytometry.csl' => 1,
'currents-in-biblical-research.csl' => 1,
'current-topics-in-medicinal-chemistry.csl' => 1,
'current-protocols.csl' => 1,
'current-proteomics.csl' => 1,
'current-opinion.csl' => 1,
'culture-medicine-and-psychiatry.csl' => 1,
'cultural-studies-of-science-education.csl' => 1,
'cuadernos-de-filologia-clasica.csl' => 1,
'deutsche-medizinische-wochenschrift.csl' => 1,
'critical-care-medicine.csl' => 1,
'creativity-and-innovation-management.csl' => 1,
'cranfield-university-numeric.csl' => 1,
'council-of-science-editors.csl' => 1,
'council-of-science-editors-author-date.csl' => 1,
'council-of-science-editors-alphabetical.csl' => 1,
'corrosion.csl' => 1,
'coral-reefs.csl' => 1,
'copernicus-publications.csl' => 1,
'conservation-physiology.csl' => 1,
'conservation-letters.csl' => 1,
'conservation-biology.csl' => 1,
'computer-und-recht.csl' => 1,
'communication-et-langages.csl' => 1,
'deutsche-gesellschaft-fur-psychologie.csl' => 1,
'deutsche-sprache.csl' => 1,
'economie-et-statistique.csl' => 1,
'drug-testing-and-analysis.csl' => 1,
'economic-commission-for-latin-america-and-the-caribbean.csl' => 1,
'ecology.csl' => 1,
'ecology-letters.csl' => 1,
'ecology-and-society.csl' => 1,
'ecological-entomology.csl' => 1,
'ecole-pratique-des-hautes-etudes-sciences-historiques-et-philologiques.csl' => 1,
'ecclesial-practices.csl' => 1,
'earthquake-engineering-and-structural-dynamics.csl' => 1,
'earth-surface-processes-and-landforms.csl' => 1,
'early-medieval-europe.csl' => 1,
'early-christianity.csl' => 1,
'ear-and-hearing.csl' => 1,
'drugs-of-today.csl' => 1,
'drug-development-research.csl' => 1,
'deutsches-archaologisches-institut.csl' => 1,
'documents-d-archeologie-francaise.csl' => 1,
'dna-research.csl' => 1,
'disability-and-rehabilitation.csl' => 1,
'diplo.csl' => 1,
'din-1505-2.csl' => 1,
'din-1505-2-numeric.csl' => 1,
'din-1505-2-numeric-alphabetical.csl' => 1,
'din-1505-2-alphanumeric.csl' => 1,
'die-bachelorarbeit-samac-et-al-note.csl' => 1,
'die-bachelorarbeit-samac-et-al-in-text.csl' => 1,
'diatom-research.csl' => 1,
'dialisis-y-trasplante.csl' => 1,
'diagnostico-prenatal.csl' => 1,
'development-policy-review.csl' => 1,
'baffordweblibbundle.php' => 1,
'boundinteger.php' => 1,
'baffordcsscolorvalidatorbundle.php' => 1,
'smartcorebundle.php' => 1,
'widgetmodule.php' => 1,
'webformmodule.php' => 1,
'unicatmodule.php' => 1,
'textermodule.php' => 1,
'simplenewsmodule.php' => 1,
'gallerymodule.php' => 1,
'breadcrumbsmodule.php' => 1,
'smartmediabundleusecases.php' => 1,
'smartmediabundle.php' => 1,
'htmlbundle.php' => 1,
'felibbundle.php' => 1,
'smartdbdumperbundle.php' => 1,
'cmsgeneratorbundle.php' => 1,
'smartseobundle.php' => 1,
'cmsappkernel.php' => 1,
'cacheclearerservice.php' => 1,
'acceleratorcacheclearer.php' => 1,
'acceleratorcachebundle.php' => 1,
'uncia.php' => 1,
'bare.php' => 1,
'safehtml.php' => 1,
'slikio.php' => 1,
'sleepnessubertranslationbundle.php' => 1,
'sleepnessubertranslationadminbundle.php' => 1,
'sleepnessuberfrontendvalidationbundle.php' => 1,
'hoauthadminaction.php' => 1,
'smartricheditorbundle.php' => 1,
'smartcoresessionbundle.php' => 1,
'dummyuseridentity.php' => 1,
'domainmessage.php' => 1,
'soclozeventqueuebundle.php' => 1,
'socloznsqbundle.php' => 1,
'goutte.phar' => 1,
'frontend.php' => 1,
'snceutilitybundle.php' => 1,
'snceezpublishlegacyutilitybundle.php' => 1,
'errorcontroller.php' => 1,
'objectselfserializer.php' => 1,
'eventsourcedrepository.php' => 1,
'aggregateroot.php' => 1,
'projectenableddispatcher.php' => 1,
'simpleeventbus.php' => 1,
'domaineventstream.php' => 1,
'smartsettingsbundle.php' => 1,
'simplecommandtranslator.php' => 1,
'simplecommandhandlerresolver.php' => 1,
'commandhandlermiddleware.php' => 1,
'basecommand.php' => 1,
'smilesimplepageviewbundle.php' => 1,
'testsettings-dist.php' => 1,
'example-full.php' => 1,
'smartrockuserbundle.php' => 1,
'smartgeckothriftbundle.php' => 1,
'governorframeworkbundle.php' => 1,
'externalresource.php' => 1,
'smartsitemapbundle.php' => 1,
'smartsimpleprofilerbundle.php' => 1,
'hoauthaction.php' => 1,
'slaxer' => 1,
'soclozmonitoringbundle.php' => 1,
'linkshere_body.php' => 1,
'alink.i18n.php' => 1,
'alink.i18n.magic.php' => 1,
'aform_body.php' => 1,
'aform.php' => 1,
'aform.i18n.php' => 1,
'aform.i18n.magic.php' => 1,
'userpageinfo_body.php' => 1,
'userpageinfo.php' => 1,
'userpageinfo.i18n.php' => 1,
'userpageinfo.i18n.magic.php' => 1,
'mailman.php' => 1,
'mailman.i18n.php' => 1,
'linkshere.php' => 1,
'alink_body.php' => 1,
'gravatar_body.php' => 1,
'gravatar.i18n.php' => 1,
'gravatar.i18n.magic.php' => 1,
'getuserinfo_body.php' => 1,
'getuserinfo.php' => 1,
'getuserinfo.i18n.php' => 1,
'getuserinfo.i18n.magic.php' => 1,
'getpageinfo.php' => 1,
'getpageinfo.body.php' => 1,
'extracttext_body.php' => 1,
'extracttext.php' => 1,
'extracttext.i18n.php' => 1,
'extracttext.i18n.magic.php' => 1,
'alink.php' => 1,
'linkrel.i18n.magic.php' => 1,
'street.php' => 1,
'sithousnetsuitebundle.php' => 1,
'building.php' => 1,
'apartment.php' => 1,
'sizanniatranslationbundle.php' => 1,
'sizanniajquerytoolsbundle.php' => 1,
'sizanniaeditorbundle.php' => 1,
'sizanniadataanalyticsbundle.php' => 1,
'imodule.php' => 1,
'deuton.sample.ini' => 1,
'param.php' => 1,
'opt.php' => 1,
'deuton.php' => 1,
'abort.php' => 1,
'sithousantispambundle.php' => 1,
'linkrel.i18n.php' => 1,
'exemples.php' => 1,
'sglim' => 1,
'config.sh' => 1,
'flyr.zip' => 1,
'suffixbehavior.php' => 1,
'mailqueue.neon.example' => 1,
'typo3cms' => 1,
'simonsimcityliipimaginewatermarkfilterbundle.php' => 1,
'simonsimcitygetid3bundle.php' => 1,
'simonsimcitycouchbasebundle.php' => 1,
'ansi.php' => 1,
'linkrel_body.php' => 1,
'linkrel.php' => 1,
'soclozfeatureflagbundle.php' => 1,
'gh-pages.sh' => 1,
'docviewer.php' => 1,
'classinfo_html.php' => 1,
'commanduserbundle.php' => 1,
'spomkylabsrolehierarchybundle.php' => 1,
'spomkylabsoauth2serverbundle.php' => 1,
'extensionwithplugins.php' => 1,
'configurationwithplugins.php' => 1,
'bundlewithplugins.php' => 1,
'bundleplugininterface.php' => 1,
'spomkylabsjosebundle.php' => 1,
'spomkylabsipfilterbundle.php' => 1,
'spikeointltelbundle.php' => 1,
'speicher210cloudinarybundle.php' => 1,
'spfixturedumperbundle.php' => 1,
'sparkreflection.php' => 1,
'bprsassetbundle.php' => 1,
'basics.php' => 1,
'fixers' => 1,
'soulboundawscloudsearchbundle.php' => 1,
'php-export-data.class.php' => 1,
'dtd-parser.iml' => 1,
'soothsilverdtdparser.php' => 1,
'extyii.php' => 1,
'classdiagram.png' => 1,
'classdiagram.dia' => 1,
'yamlstorage.php' => 1,
'parametersstorage.php' => 1,
'configstorage.php' => 1,
'spraedvcardbundle.php' => 1,
'bprsassetevent.php' => 1,
'slot.php' => 1,
'kcfinderinput.php' => 1,
'openssl.conf' => 1,
'opensslca.php' => 1,
'laravel-docker' => 1,
'overlayasset.php' => 1,
'debugpanelasset.php' => 1,
'crontask.php' => 1,
'cronservice.php' => 1,
'cronprocess.php' => 1,
'documents.json' => 1,
'documents-sample.json' => 1,
'stephanemanginangularjwtauthenticationbundle.php' => 1,
'kcfinderselectasset.php' => 1,
'yii2boletos.php' => 1,
'bprscommandlinebundle.php' => 1,
'smalltal.php' => 1,
'smalltal.tests.php' => 1,
'smalltal.compiler.php' => 1,
'neartal.php' => 1,
'neartal.tests.php' => 1,
'neartal.compiler.php' => 1,
'license.agpl-3.0' => 1,
'testwidget.php' => 1,
'piha.sh' => 1,
'staglag13womtestbundle.php' => 1,
'cli_run.php' => 1,
'bprsuserbundle.php' => 1,
'bprsstylebundle.php' => 1,
'arraystorage.php' => 1,
'uriservice.php' => 1,
'webpackpublishplugin.js' => 1,
'corrector.php' => 1,
'single-esdeveniment.php' => 1,
'plantilla-text-menuleft.php' => 1,
'plantilla-steps.php' => 1,
'plantilla-distribuidora-02.php' => 1,
'plantilla-distribuidora-02-auto.php' => 1,
'plantilla-distribuidora-01.php' => 1,
'plantilla-distribuidora-01-auto.php' => 1,
'planeta.php' => 1,
'home-sc.php' => 1,
'dist-recursos_traductors.php' => 1,
'dist-eines_consulta.php' => 1,
'diccionari-multilingue.php' => 1,
'contacte.php' => 1,
'single-projecte.php' => 1,
'archive-projecte.php' => 1,
'archive-programa.php' => 1,
'archive-esdeveniment.php' => 1,
'aparell.php' => 1,
'sc-shortcodes.php' => 1,
'sc-normalize-upload-dir.php' => 1,
'sc-importer.php' => 1,
'scfootnotes.php' => 1,
'scfootnotes.js' => 1,
'mce-table-buttons-class.php' => 1,
'logboardbundle.php' => 1,
'soclemissingtypebundle.php' => 1,
'socleintldatetimeformatbundle.php' => 1,
'single-programa.php' => 1,
'sinonims.php' => 1,
'solve' => 1,
'formulaire.php' => 1,
'httpstatus.php' => 1,
'headerstorage.php' => 1,
'fsservice.php' => 1,
'eventstate.php' => 1,
'eventpriority.php' => 1,
'dependencyunit.php' => 1,
'dependencycontainer.php' => 1,
'qc.php' => 1,
'dataprocessortest.php' => 1,
'dataprocessor.php' => 1,
'soloistbaseadminbundle.php' => 1,
'tester.php' => 1,
'fastconfig.php' => 1,
'subpagina-programa.php' => 1,
'exceptioninternal.php' => 1,
'processtrait.php' => 1,
'trieur.php' => 1,
'sourcefilter.php' => 1,
'abstractformat.php' => 1,
'mysqldump.class.php' => 1,
'soipookentouserbundle.php' => 1,
'soipookentoadminbundle.php' => 1,
'theme-mover.php' => 1,
'traductor.php' => 1,
'taxonomy-esdeveniment_cat.php' => 1,
'taxonomy-categoria_projecte.php' => 1,
'subpagina-projecte.php' => 1,
'docviewer_body.php' => 1,
'docviewer.i18n.php' => 1,
'license-numeraljs' => 1,
'screeperactionbundle.php' => 1,
'textcutter.php' => 1,
'swmmailhookevent.php' => 1,
'swmmailhookbundle.php' => 1,
'reph.php' => 1,
'reph.phn' => 1,
'template_debug.php' => 1,
'pharen.php' => 1,
'lexical.php' => 1,
'lang.phn' => 1,
'screeperserverbundle.php' => 1,
'screeperplayerbundle.php' => 1,
'screeperjsonapibundle.php' => 1,
'screamzsecuredownloadbundle.php' => 1,
'php-console.js' => 1,
'htmlsample.html' => 1,
'googlechart.php' => 1,
'export2excelbehavior.php' => 1,
'downloadaction.php' => 1,
'shkpagebundle.php' => 1,
'details' => 1,
'chart.png' => 1,
'release.command' => 1,
'svdschedulerbundle.php' => 1,
'svdmediabundle.php' => 1,
'sceniccitylabsoauthbundle.php' => 1,
'changelog-5.8' => 1,
'jquery-1.9.1.min.js' => 1,
'selenesoftwarespressplugindeployaws.php' => 1,
'user-data.tpl.sh' => 1,
'semanticwatchlist.hooks.php' => 1,
'wp-dashboard-log-monitor.php' => 1,
'wp-custom-bulk-actions.php' => 1,
'lake' => 1,
'budgegeriadatetimebundle.php' => 1,
'datacollectorbundle.php' => 1,
'sendmachineapiclient.php' => 1,
'sempredfacebookbundle.php' => 1,
'whatsnearby.php' => 1,
'semanticwatchlist.settings.php' => 1,
'semanticwatchlist.php' => 1,
'semanticwatchlist.i18n.php' => 1,
'semanticwatchlist.i18n.alias.php' => 1,
'semanticsignup.php' => 1,
'example.phpunit.xml.dist' => 1,
'semanticmetatags.php' => 1,
'semanticmediawiki.settings.php' => 1,
'semanticmediawiki.php' => 1,
'semanticmediawiki.hooks.php' => 1,
'semanticmaps.php' => 1,
'semanticmaps.hooks.php' => 1,
'sm_settings.php' => 1,
'semanticinterlanguagelinks.php' => 1,
'semanticglossary.php' => 1,
'semanticformsselect.php' => 1,
'semanticextraspecialproperties.php' => 1,
'semanticexternalquerylookup.php' => 1,
'semanticcite.php' => 1,
'changelog-5.10' => 1,
'options-icon.png' => 1,
'wp-frontend-profile.php' => 1,
'statementiteratorfactory.php' => 1,
'bspaccountingbundle.php' => 1,
'breakouthelper.php' => 1,
'sstwitterbundle.php' => 1,
'parallaxbundle.php' => 1,
'url_rewriting' => 1,
'sparqlutils.php' => 1,
'saft.wordpress.php' => 1,
'chainablestore.php' => 1,
'basictriplepatternstore.php' => 1,
'abstracttriplepatternstore.php' => 1,
'abstractsparqlstore.php' => 1,
'statementiteratorfactoryimpl.php' => 1,
'statementiterator.php' => 1,
'activemongocursor.php' => 1,
'statementimpl.php' => 1,
'statementfactoryimpl.php' => 1,
'statementfactory.php' => 1,
'nodeutils.php' => 1,
'nodefactoryimpl.php' => 1,
'nodefactory.php' => 1,
'namednodeimpl.php' => 1,
'namednode.php' => 1,
'literalpatternimpl.php' => 1,
'literalimpl.php' => 1,
'literal.php' => 1,
'blanknodeimpl.php' => 1,
'blanknode.php' => 1,
'logroute.php' => 1,
'indexcontroller.php' => 1,
'logo-white.png' => 1,
'samsondatagridbundle.php' => 1,
'internal' => 1,
'satoripopimagesbundle.php' => 1,
'sarsportuserbundle.php' => 1,
'sarsportapplicationbundle.php' => 1,
'stnwechatbundle.php' => 1,
'stnstatemachinebundle.php' => 1,
'samsonyoutrackbundle.php' => 1,
'samsonunexpectedresponsebundle.php' => 1,
'samsonsimplerknppaginatorbundle.php' => 1,
'samsonreleasebundle.php' => 1,
'samsonfilterbundle.php' => 1,
'samsondataviewbundle.php' => 1,
'samsonautocompletebundle.php' => 1,
'elephantio.php' => 1,
'samsonangularroutingbundle.php' => 1,
'rackspace.php' => 1,
'jquery.qtip.min.map' => 1,
'jquery.qtip.min.js' => 1,
'jquery.qtip.min.css' => 1,
'jquery.qtip.js' => 1,
'jquery.qtip.css' => 1,
'imagesloaded.pkg.min.js' => 1,
'qtipasset.php' => 1,
'qtip.php' => 1,
'outdatedbrowserasset.php' => 1,
'outdatedbrowser.php' => 1,
'keycdn.php' => 1,
'wp-fetch-social-posts.php' => 1,
'wp-hq-responsive-youtube-embed.php' => 1,
'docviewer.i18n.magic.php' => 1,
'basewpapi.php' => 1,
'arnmmediabundle.php' => 1,
'arnmcorebundle.php' => 1,
'arnmcontentbundle.php' => 1,
'arnmcontactbundle.php' => 1,
'configbundleinfo.php' => 1,
'arnmconfigbundle.php' => 1,
'arnmcatalogbundle.php' => 1,
'arnmartistbundle.php' => 1,
'arrayfinder.php' => 1,
'wpapiexception.php' => 1,
'orgwpapi.php' => 1,
'comwpapi.php' => 1,
'apirequest.php' => 1,
'arnmmenubundle.php' => 1,
'ilinkoscope.php' => 1,
'iapihandler.php' => 1,
'orglinkoscope.php' => 1,
'getlinksresult.php' => 1,
'getlinksrequest.php' => 1,
'getcommentsresult.php' => 1,
'getcommentsrequest.php' => 1,
'comlinkoscope.php' => 1,
'libs.php' => 1,
'twisto.php' => 1,
'shareddbresponse.php' => 1,
'orderitem.php' => 1,
'neworder.php' => 1,
'mediacontentbundle.php' => 1,
'arnmpagesbundle.php' => 1,
'checkresponse.php' => 1,
'silvestramediabundle.php' => 1,
'silvestratextnodebundle.php' => 1,
'silvestratextbundle.php' => 1,
'silvestrasitemapbundle.php' => 1,
'silvestraseobundle.php' => 1,
'seopageinterface.php' => 1,
'seopage.php' => 1,
'silvestrasandboxbundle.php' => 1,
'silvestrapaginatorbundle.php' => 1,
'urlhelper.php' => 1,
'templatinghelperinterface.php' => 1,
'silvestranotificationbundle.php' => 1,
'alertmanager.php' => 1,
'silvestralocalebundle.php' => 1,
'arnmwidgetbundle.php' => 1,
'silvestrafrontendbundle.php' => 1,
'silvestraformbundle.php' => 1,
'keyvaluearray.php' => 1,
'silvestracachebundle.php' => 1,
'silvestrabannerbundle.php' => 1,
'bannerzonesynchronizer.php' => 1,
'silvestraadminuserbundle.php' => 1,
'silvestraadminbundle.php' => 1,
'silverkixcmsbundle.php' => 1,
'simpleorm.php' => 1,
'containerawarecommand.php' => 1,
'sibsetaopfeaturebundle.php' => 1,
'jwthttpbearerauth.php' => 1,
'customer.php' => 1,
'bareorder.php' => 1,
'admin-readme.html' => 1,
'employee.php' => 1,
'sflsettingsbundle.php' => 1,
'sflpagebundle.php' => 1,
'sflgoogleapibundle.php' => 1,
'sendpulseinterface.php' => 1,
'sendpulse.php' => 1,
'dtobundle.php' => 1,
'smsaero.php' => 1,
'econfig.php' => 1,
'sergsxmuibundle.php' => 1,
'schedulewidget.php' => 1,
'rgobjecttrait.php' => 1,
'employeegroup.php' => 1,
'pushmenuwidget.php' => 1,
'hidenamespace.i18n.magic.php' => 1,
'bootstrowidget.php' => 1,
'inbapiauthenticationbundle.php' => 1,
'editlinkasset.php' => 1,
'editlink.php' => 1,
'siphash_apache.so' => 1,
'siphash.so' => 1,
'serializebehavior.php' => 1,
'searchlucene.php' => 1,
'menubuilderassets.php' => 1,
'simple-header-footer-html.php' => 1,
'wp-multisite-plugin-statistics.php' => 1,
'link-relative.js' => 1,
'https-domain-alias.php' => 1,
'breadcrumb.css' => 1,
'hidenamespace.i18n.php' => 1,
'barecustomer.php' => 1,
'shaygantelegrambotapibundle.php' => 1,
'bareaddress.php' => 1,
'shoplobundle.php' => 1,
'.shootproof-sample' => 1,
'shonmresquebundle.php' => 1,
'resqueevents.php' => 1,
'chesscomhoneybadgerbundle.php' => 1,
'usoftidealbundle.php' => 1,
'abstracttranslationbundle.php' => 1,
'class-jp-tax-query.php' => 1,
'jp-rest-cache.php' => 1,
'class-jp-menu-api.php' => 1,
'telegrambotapi.php' => 1,
'shayganaffiliateevents.php' => 1,
'hidenamespace.php' => 1,
'shayganaffiliatebundle.php' => 1,
'increment.php' => 1,
'generalizing' => 1,
'feature.php' => 1,
'shakepeers.php' => 1,
'myscripts.js' => 1,
'mising-trads' => 1,
'custom.css' => 1,
'shakepeers.skin.php' => 1,
'sitelinkssearchbox.php' => 1,
'pagecreator.php' => 1,
'pagecontributors.php' => 1,
'pagecontributors.i18n.magic.php' => 1,
'stillat_common.png' => 1,
'license-numbro' => 1,
'anypatternimpl.php' => 1,
'stop.sh' => 1,
'thibautg16squelettebundle.php' => 1,
'theratbranchingbundle.php' => 1,
'appfile' => 1,
'aws.config.yml' => 1,
'thephalconsamazonwebservicesbundle.php' => 1,
'basesocketlistener.php' => 1,
'settingtrait.php' => 1,
'mongoclient.php' => 1,
'utilities.sublime-project' => 1,
'tumblr-parser.sublime-project' => 1,
'rating.sublime-project' => 1,
'phpcsrs.sublime-project' => 1,
'start-mua.sh' => 1,
'sitebuild' => 1,
'start-daemon.sh' => 1,
'phpchat.sublime-project' => 1,
'listports.sh' => 1,
'macho.sublime-project' => 1,
'dbg.sh' => 1,
'config.check.sh' => 1,
'imapd.sublime-project' => 1,
'html2markdown.sublime-project' => 1,
'hashcash.sublime-project' => 1,
'assembly.sublime-project' => 1,
'masonry' => 1,
'fscrestbundle.php' => 1,
'new text document' => 1,
'dist.configuration.php' => 1,
'fscp3pbundle.php' => 1,
'wpsimplemapper.class.php' => 1,
'kendobuild.php' => 1,
'tigreboitefunkylabbundle.php' => 1,
'.gitiignore' => 1,
'ticketparkpingenbundle.php' => 1,
'ticketparkpdfbundle.php' => 1,
'ticketparklocalebundle.php' => 1,
'ticketparkimagebundle.php' => 1,
'ticketparkfilebundle.php' => 1,
'ticketparkexpiringurlbundle.php' => 1,
'ticketparkexcelbundle.php' => 1,
'ticketparkdynamicrolebundle.php' => 1,
'ticketparkbarcodebundle.php' => 1,
'wpsimpledao.class.php' => 1,
'start_phantomjs.sh' => 1,
'plib.class.php' => 1,
'phpgamification.class.php' => 1,
'dao.class.php' => 1,
'phalconfilter.php' => 1,
'ar_migrate' => 1,
'test_configs.php' => 1,
'ar_benchmark' => 1,
'tctwigglobalbundle.php' => 1,
'tctwigdefaultbundle.php' => 1,
'tcpjaxbundle.php' => 1,
'pool.php' => 1,
'controllable.php' => 1,
'start_selenium.sh' => 1,
'responsedecorator.php' => 1,
'fschateoasbundle.php' => 1,
'git_env.reg' => 1,
'teckhousemdetectbundle.php' => 1,
'tecnocreacionesvzlafixturesbundle.php' => 1,
'tecnocreacionesvzlaentitybundle.php' => 1,
'tecnocreacionesvzlaapibundle.php' => 1,
'toolsevents.php' => 1,
'tecnocreacionestoolsbundle.php' => 1,
'tecnocreacionesresourcebundle.php' => 1,
'tecnocreacionesinstallbundle.php' => 1,
'tecnocreacionescrmtemplatebundle.php' => 1,
'btobsocialnetworkentitybundle.php' => 1,
'btobsocialnetworkcorebundle.php' => 1,
'tecnocreacionesajaxfosuserbundle.php' => 1,
'tecnowordbundle.php' => 1,
'teckhouseanalyticsbundle.php' => 1,
'tecnocreacionesvzlatoolsbundle.php' => 1,
'techdatacontextdibundle.php' => 1,
'techdataas2securebundle.php' => 1,
'stormdeltalatexencoderannotationbundle.php' => 1,
'razorgatorfulfillmentapiv1.pdf' => 1,
'newtype.php' => 1,
'generate_model.php' => 1,
'usersbase.php' => 1,
'taysormbase.php' => 1,
'easyconnect.php' => 1,
'sqlbrainstorming.sql' => 1,
'librarianapinoodling.php' => 1,
'taoti_bootstrap.libraries.yml' => 1,
'taoti_bootstrap.info.yml' => 1,
'tecnocreacionesvzlagovernmentbundle.php' => 1,
'laravelpayzencontroller.php' => 1,
'fscemailfilterbundle.php' => 1,
'th3moukdoctrinetableprefixbundle.php' => 1,
'dotcommercefastentitybundle.php' => 1,
'northwind.sql' => 1,
'architect' => 1,
'tbbcrestutilbundle.php' => 1,
'composer-template.json' => 1,
'tbbcmoneyevents.php' => 1,
'tbbcmoneybundle.php' => 1,
'moneyexception.php' => 1,
'tbbccachebundle.php' => 1,
'classnotfoundexception.php' => 1,
'th3moukyahooweatherbundle.php' => 1,
'th3moukplanningbundle.php' => 1,
'th3moukcmssiteplanbundle.php' => 1,
'laravelpayzenserviceprovider.php' => 1,
'th3moukcmssimplecontentmanagerbundle.php' => 1,
'th3moukcmspagebundle.php' => 1,
'th3moukcmscorebundle.php' => 1,
'textrazor.php' => 1,
'mhosts.php' => 1,
'php7exceptions.php' => 1,
'telerivet.php' => 1,
'telemessage_web.phar' => 1,
'sellsy-plugin.php' => 1,
'asteriskmanager.php' => 1,
'agi.php' => 1,
'tehrancodeyahooapibundle.php' => 1,
'payzenformtoolbox.php' => 1,
'symfonianindonesiagammubundle.php' => 1,
'simplethingszetawebmailbundle.php' => 1,
'testbannerbundle.php' => 1,
'ucssecuritybobundle.php' => 1,
'datagridcolumninterface.php' => 1,
'datagridcolumnconfigurationinterface.php' => 1,
'datagridcolumnconfiguration.php' => 1,
'datagridcolumn.php' => 1,
'abstractdatagridtype.php' => 1,
'currencycodeguesserinterface.php' => 1,
'ucsutilsbundle.php' => 1,
'userprofileevents.php' => 1,
'userlogevents.php' => 1,
'ucsusermodelbundle.php' => 1,
'ucsuserbobundle.php' => 1,
'ucssecuritymodelbundle.php' => 1,
'ucssearchbundle.php' => 1,
'datagridconfigurationinterface.php' => 1,
'ucsrichuibundle.php' => 1,
'ucsmailerbundle.php' => 1,
'ucshtmlgeneratorbundle.php' => 1,
'markupevents.php' => 1,
'ucsdatagridbundle.php' => 1,
'ucsbackofficebundle.php' => 1,
'ucsadminstrapbundle.php' => 1,
'efficientpaginator.php' => 1,
'ucsnewsbundle.php' => 1,
'newsevents.php' => 1,
'newsmediamanagerinterface.php' => 1,
'newsmediamanager.php' => 1,
'datagridconfiguration.php' => 1,
'datagridfactory.php' => 1,
'newsmedia.php' => 1,
'.arrayformtype.php.swp' => 1,
'autoload_test_function.php' => 1,
'autoload_test_classmap.php' => 1,
'ufo_license_ru' => 1,
'markupmanagerinterface.php' => 1,
'markupmanager.php' => 1,
'markupinterface.php' => 1,
'generatorfactoryinterface.php' => 1,
'generatorfactory.php' => 1,
'constraintfactoryinterface.php' => 1,
'constraintfactory.php' => 1,
'arrayformtype.php' => 1,
'arrayformdataparserinterface.php' => 1,
'datapropertytransformerinterface.php' => 1,
'datagridfactoryinterface.php' => 1,
'datapropertyinterface.php' => 1,
'datapropertyformatterregistryinterface.php' => 1,
'datapropertyformatterregistry.php' => 1,
'datapropertyformatterinterface.php' => 1,
'datapropertyconfigurationinterface.php' => 1,
'datapropertyconfiguration.php' => 1,
'dataproperty.php' => 1,
'datagridtypeinterface.php' => 1,
'datagridrowtransformerinterface.php' => 1,
'datagridrowformatterinterface.php' => 1,
'datagridrowformatter.php' => 1,
'datagridpreviewerinterface.php' => 1,
'datagridinterface.php' => 1,
'newsmediainterface.php' => 1,
'newsmanagerinterface.php' => 1,
'tgaaudiencebundle.php' => 1,
'tom32iuserbundle.php' => 1,
'translation.sql' => 1,
'views-info.png' => 1,
'server-info.png' => 1,
'request-info.png' => 1,
'database-info.png' => 1,
'atlassianstashintegrationplugin.php' => 1,
'traackr-api.sublime-project' => 1,
'upload.xml' => 1,
'etherpad-lite-client.php' => 1,
'api-spec.json' => 1,
'example-loader.php' => 1,
'interop.php' => 1,
'tom32iurlscannerbundle.php' => 1,
'phpunit-no-logging.xml' => 1,
'tom32isimplesecuritybundle.php' => 1,
'tom32ifilebundle.php' => 1,
'tom32icsvbundle.php' => 1,
'max' => 1,
'dbconnector.php' => 1,
'math' => 1,
'tinyview.php' => 1,
'reasons.php' => 1,
'tinyvalidator.php' => 1,
'showloading.php' => 1,
'panelmenu.php' => 1,
'advanced-rss-widget.php' => 1,
'tilowebpaginationbundle.php' => 1,
'treewebvalidationbundle.php' => 1,
'test_configuration.example.yml' => 1,
'newsmanager.php' => 1,
'guide_utilisation_magento2.docx' => 1,
'newsinterface.php' => 1,
'newsawareinterface.php' => 1,
'tmpvj91xg' => 1,
'mailercollection.php' => 1,
'defaultmailer.php' => 1,
'configurableactioninterface.php' => 1,
'actionsubjectinterface.php' => 1,
'actioninterface.php' => 1,
'actionevents.php' => 1,
'actionevent.php' => 1,
'actioncollection.php' => 1,
'user_guide_magento2.docx' => 1,
'txtonyarrowdbconnectorevents.php' => 1,
'mondrian.php' => 1,
'txtonyarrowdbconnectorbundle.php' => 1,
'sweet-qa' => 1,
'session_messages.php' => 1,
'tuxes3doctrineutilbundle.php' => 1,
'tohtmlmini.jpg' => 1,
'uglifycss-lib.js' => 1,
'uglifycss' => 1,
'serpri.php' => 1,
'serpri' => 1,
'tdsinflectorbundle.php' => 1,
'troissixmysqlpostfixadminbundle.php' => 1,
'trismegistewambundle.php' => 1,
'howtouse' => 1,
'taoti_bootstrap.breakpoints.yml' => 1,
'planned' => 1,
'stingerbootstrapmaxlengthjsbundle.php' => 1,
'precisions.php' => 1,
'catalog-1.0.mwb' => 1,
'walvasimplecmsbundle.php' => 1,
'ste.php' => 1,
'pathcompiler.php' => 1,
'hostcompiler.php' => 1,
'compilerinterface.php' => 1,
'resourceserver.php' => 1,
'refreshtokeninterface.php' => 1,
'mac.php' => 1,
'implicitgrantinterface.php' => 1,
'dynamicuriinterface.php' => 1,
'authcodeinterface.php' => 1,
'exchangerateexception.php' => 1,
'swpmultitenancybundle.php' => 1,
'nativedriver.php' => 1,
'modriver.php' => 1,
'directories.php' => 1,
'sqlitedriver.php' => 1,
'pgsqltableschema.php' => 1,
'pgsqldriver.php' => 1,
'mysqldriver.php' => 1,
'pdostatementinterface.php' => 1,
'pdointerface.php' => 1,
'yamlloader.php' => 1,
'xmlloader.php' => 1,
'nativeloader.php' => 1,
'swpbridgebundle.php' => 1,
'swpupdaterbundle.php' => 1,
'iniloader.php' => 1,
'ordershippingtransitions.php' => 1,
'resourceactions.php' => 1,
'serviceregistryinterface.php' => 1,
'prioritizedserviceregistryinterface.php' => 1,
'prioritizedserviceregistry.php' => 1,
'nonexistingserviceexception.php' => 1,
'existingserviceexception.php' => 1,
'paymenttransitions.php' => 1,
'ordertransitions.php' => 1,
'syliusmailerevents.php' => 1,
'syliusstockableevents.php' => 1,
'inventoryunittransitions.php' => 1,
'syliuscheckoutevents.php' => 1,
'orderpaymenttransitions.php' => 1,
'html2pdf.js' => 1,
'ordercheckouttransitions.php' => 1,
'ordercheckoutstates.php' => 1,
'syliuscartevents.php' => 1,
'sylakesylakimbundle.php' => 1,
'licence.sample' => 1,
'coffee.php' => 1,
'swith' => 1,
'errorlayout.php' => 1,
'switherror.php' => 1,
'modulebootstrapper.php' => 1,
'scales.tsv' => 1,
'chords' => 1,
'survosmogreetbundle.php' => 1,
'jsonloader.php' => 1,
'captcha.ttf' => 1,
'shipmenttransitions.php' => 1,
'stingerckeditortableresizebundle.php' => 1,
'stingervisjsbundle.php' => 1,
'readme-orig' => 1,
'license-apache-2.0' => 1,
'stingerstrophejsbundle.php' => 1,
'stingersoftplatformbundle.php' => 1,
'stingermomentjsbundle.php' => 1,
'stingersoftmediaparsingbundle.php' => 1,
'stingerjquerybackstretchbundle.php' => 1,
'stingerckeditorwidgetbundle.php' => 1,
'stingerckeditoruploadwidgetbundle.php' => 1,
'stingerckeditoruploadimagebundle.php' => 1,
'stingerckeditortabletoolsbundle.php' => 1,
'stingerckeditorsavebundle.php' => 1,
'load-mu-plugins.php' => 1,
'stingerckeditorquicktablebundle.php' => 1,
'stingerckeditorpreviewbundle.php' => 1,
'stingerckeditorpanelbuttonbundle.php' => 1,
'stingerckeditorpanelbundle.php' => 1,
'stingerckeditoroffice2013skinbundle.php' => 1,
'stingerckeditornotificationbundle.php' => 1,
'stingerckeditornotificationaggregatorbundle.php' => 1,
'stingerckeditorlineutilsbundle.php' => 1,
'stingerckeditorimage2bundle.php' => 1,
'stingerckeditorfontbundle.php' => 1,
'stingerckeditorfloatingpanelbundle.php' => 1,
'stingerckeditorfiletoolsbundle.php' => 1,
'stingerckeditorcolorbuttonbundle.php' => 1,
'zohosubscriptionbundle.php' => 1,
'understory.php' => 1,
'memcachestore.php' => 1,
'phpunit-full.xml.dist' => 1,
'incrementorinterface.php' => 1,
'remembermeinterface.php' => 1,
'limitinterface.php' => 1,
'internalexception.php' => 1,
'hotpsecret.php' => 1,
'hotp.php' => 1,
'jspacker.php' => 1,
'jshrinkfilter.php' => 1,
'dummypacker.php' => 1,
'csspacker.php' => 1,
'abstractpacker.php' => 1,
'modell.php' => 1,
'attachment.class.php' => 1,
'epayapicontroller.php' => 1,
'mimemailparser.class.php' => 1,
'htaccess.redirect' => 1,
'strontiumpjaxbundle.php' => 1,
'specificationfactory.php' => 1,
'specificationbundle.php' => 1,
'woocommerce-first-atlantic-commerce.php' => 1,
'woocommerce-affiliate-tracking.php' => 1,
'trackerfactory.php' => 1,
'stregogooglebundle.php' => 1,
'events-manager-osm.php' => 1,
'events-manager-osm.js' => 1,
'iepay.php' => 1,
'epayapiserviceprovider.php' => 1,
'syliussequenceevents.php' => 1,
'shipmentunittransitions.php' => 1,
'treeexception.php' => 1,
'syndmultitenantbundle.php' => 1,
'pointers.js' => 1,
'pointers-tour.php' => 1,
'pointersmanagerinterface.php' => 1,
'pointersmanager.php' => 1,
'class-tgm-plugin-activation.php' => 1,
'tdmschedulerbundle.php' => 1,
'tdmswiftmailereventbundle.php' => 1,
'tdmdoctrineeventprioritybundle.php' => 1,
'tdmdoctrineencryptbundle.php' => 1,
'wp-mainwp-child-hidemenu.php' => 1,
'syren7owncloudapibundle.php' => 1,
'tenantevents.php' => 1,
'syndfreshbooksbundle.php' => 1,
'httpcapture.php' => 1,
'uasparser_example.phps' => 1,
'parameters.json-dist' => 1,
'db-config-sample.php' => 1,
'symfonianindonesiarestcrudevents.php' => 1,
'symfonianindonesiarestcrudbundle.php' => 1,
'symfonianindonesiarehatconstants.php' => 1,
'symfonianindonesiarehatbundle.php' => 1,
'symfonianindonesiaadminconstants.php' => 1,
'symfonianindonesiaadminbundle.php' => 1,
'adminbundle.png' => 1,
'votingbundle.php' => 1,
'taxonomybundle.php' => 1,
'sessionbundle.php' => 1,
'pointers.php' => 1,
'httpcapturebundle.php' => 1,
'linkbuttonbundle.php' => 1,
'surf' => 1,
'factoryexception.php' => 1,
'dom.php' => 1,
'diexception.php' => 1,
'configurabletrait.php' => 1,
'talandynamicformbundle.php' => 1,
'talakadoctrineversioningbundle.php' => 1,
'talakadoctrinetranslatablebundle.php' => 1,
'talakaapiplatformmongodbbundle.php' => 1,
'talakaannotationskitbundle.php' => 1,
'webpack.js' => 1,
'tacticscommandbusbundle.php' => 1,
'_.htaccess' => 1,
'raw' => 1,
'coreasteriskbundle.php' => 1,
'browse' => 1,
'n2r' => 1,
'tmsolutionextjsbundle.php' => 1,
'tmsolutionsmsbundle.php' => 1,
'coresecuritybundle.php' => 1,
'coremenubundle.php' => 1,
'tmsolutionloggingbundle.php' => 1,
'logmanager.php' => 1,
'tmsolutiongeneratorbundle.php' => 1,
'phpanalyzer.php' => 1,
'tmsolutiongamificationbundle.php' => 1,
'tmsolutionformtypebundle.php' => 1,
'tmsolutioncronbundle.php' => 1,
'machinenamefieldbundle.php' => 1,
'imagefieldbundle.php' => 1,
'cookiestorage.php' => 1,
'syliuscurrencybundle.php' => 1,
'syliuspayumbundle.php' => 1,
'syliuspaymentbundle.php' => 1,
'syliusorderbundle.php' => 1,
'syliusomnipaybundle.php' => 1,
'syliusmoneybundle.php' => 1,
'syliusmetadatabundle.php' => 1,
'syliusmailerbundle.php' => 1,
'syliuslocalebundle.php' => 1,
'syliusinstallerbundle.php' => 1,
'syliusgridbundle.php' => 1,
'syliusflowbundle.php' => 1,
'syliusfixturesbundle.php' => 1,
'syliuscorebundle.php' => 1,
'syliuspricingbundle.php' => 1,
'syliuscontactbundle.php' => 1,
'syliuschannelbundle.php' => 1,
'syliuscategorizerbundle.php' => 1,
'syliuscartbundle.php' => 1,
'syliusbloggerbundle.php' => 1,
'syliusattributebundle.php' => 1,
'syliusassortmentbundle.php' => 1,
'syliusassociationbundle.php' => 1,
'syliusarchetypebundle.php' => 1,
'syliusapibundle.php' => 1,
'syliusadminbundle.php' => 1,
'syliusaddressingbundle.php' => 1,
'doctrinecachestorage.php' => 1,
'syliuspluginsbundle.php' => 1,
'syliuspromotionbundle.php' => 1,
'filefieldbundle.php' => 1,
'syliuswebbundle.php' => 1,
'filedatabundle.php' => 1,
'dynamicmenubundle.php' => 1,
'cronexecuter.php' => 1,
'contentschedulerbundle.php' => 1,
'confirmbundle.php' => 1,
'alertermanager.php' => 1,
'alerterbundle.php' => 1,
'imagemagick_dependency.sh' => 1,
'symfonycommonsimagebundle.php' => 1,
'symbbextensionbundle.php' => 1,
'kernelplugin.php' => 1,
'composerplugin.php' => 1,
'syliusvariationbundle.php' => 1,
'syliusrbacbundle.php' => 1,
'syliusvariableproductbundle.php' => 1,
'syliususerbundle.php' => 1,
'syliusuibundle.php' => 1,
'syliusthemingbundle.php' => 1,
'syliustaxonomybundle.php' => 1,
'syliustaxationbundle.php' => 1,
'syliusshippingbundle.php' => 1,
'syliussettingsbundle.php' => 1,
'syliussequencebundle.php' => 1,
'syliussearchbundle.php' => 1,
'syliussalesbundle.php' => 1,
'syliusreviewbundle.php' => 1,
'syliusreportbundle.php' => 1,
'arraystatementiteratorimpl.php' => 1,
'abstractstatement.php' => 1,
'ujmexobundle.php' => 1,
'blockcurrencies.tpl' => 1,
'blocklayered-attribute-indexer.php' => 1,
'blocklayered-ajax.php' => 1,
'blocklayered-15.css' => 1,
'blocklanguages.tpl' => 1,
'blocklanguages.php' => 1,
'blocklanguages.css' => 1,
'blockfacebook.tpl' => 1,
'blockfacebook.php' => 1,
'blockfacebook.js' => 1,
'blockcustomerprivacy.tpl' => 1,
'blockcustomerprivacy.php' => 1,
'blockcustomerprivacy-simple.tpl' => 1,
'blockcurrencies.php' => 1,
'blocklayered-no-products.tpl' => 1,
'blockcurrencies.css' => 1,
'blockcontactinfos.tpl' => 1,
'blockcontactinfos.php' => 1,
'blockcontact.tpl' => 1,
'blockcontact.php' => 1,
'blockcontact.css' => 1,
'blockcmsinfo.tpl' => 1,
'blockcmsinfo.php' => 1,
'blockcms.tpl' => 1,
'blockcms.php' => 1,
'blockcmsmodel.php' => 1,
'blockcategories_footer.tpl' => 1,
'blocklayered-footer.js' => 1,
'blocklayered-price-indexer.php' => 1,
'blockcategories.php' => 1,
'blocknewproducts.php' => 1,
'reassuranceclass.php' => 1,
'blockreassurance.php' => 1,
'blockpermanentlinks.tpl' => 1,
'blockpermanentlinks.php' => 1,
'blockpermanentlinks.css' => 1,
'blockpermanentlinks-header.tpl' => 1,
'blockpermanentlinks-footer.tpl' => 1,
'blockpaymentlogo.tpl' => 1,
'blockpaymentlogo.php' => 1,
'blocknewsletter.php' => 1,
'blocknewsletter.js' => 1,
'blocknewsletter.css' => 1,
'blockmyaccountfooter.tpl' => 1,
'blocklayered-url-indexer.php' => 1,
'blockmyaccountfooter.php' => 1,
'blockmyaccount.css' => 1,
'blockmyaccount.tpl' => 1,
'blockmyaccount.php' => 1,
'blockmanufacturer.tpl' => 1,
'blockmanufacturer.php' => 1,
'prefs.gif' => 1,
'blocklink.tpl' => 1,
'blocklink.php' => 1,
'blocklayered.tpl' => 1,
'blocklayered.php' => 1,
'blocklayered.js' => 1,
'blocklayered.css' => 1,
'blockcategories.tpl' => 1,
'crossselling.tpl' => 1,
'blockreinsurance.tpl' => 1,
'poolport-sample.php' => 1,
'positibeuniqueviewsbundle.php' => 1,
'positibeseobundle.php' => 1,
'portalflareuserbundle.php' => 1,
'pfpdf.php' => 1,
'portalflarereportbundle.php' => 1,
'propertymetadata.php' => 1,
'portalflaremetadatabundle.php' => 1,
'metadataprocessor.php' => 1,
'metadataannotation.php' => 1,
'annotationdriver.php' => 1,
'portalflarefilterbundle.php' => 1,
'magicgettersetter.php' => 1,
'.simplecov' => 1,
'destroy.png' => 1,
'ruleset.phpcs.xml' => 1,
'sslcreator' => 1,
'polyauth' => 1,
'pssmockerybundle.php' => 1,
'pssdoctrineextensionsbundle.php' => 1,
'pssblogbundle.php' => 1,
'pfftagitbundle.php' => 1,
'urlmatcher.php' => 1,
'kernellistener.php' => 1,
'acceptheaderserviceprovider.php' => 1,
'class-pwp-system-status.php' => 1,
'plemipayboxbundle.php' => 1,
'plemiboomgobundle.php' => 1,
'.scrutinizer.yml ' => 1,
'index (copy 1).html' => 1,
'blockcart.tpl' => 1,
'bankwire.php' => 1,
'blockcart.php' => 1,
'blockcart.css' => 1,
'blockcart-set-collapse.php' => 1,
'blockcart-json.tpl' => 1,
'blockcart-ajax.php' => 1,
'ajax-cart.js' => 1,
'blockbestsellers.php' => 1,
'blockbanner.tpl' => 1,
'blockbanner.php' => 1,
'blockbanner.css' => 1,
'blockadvertising.tpl' => 1,
'blockadvertising.php' => 1,
'bankwire.jpg' => 1,
'index (copy 2).html' => 1,
'backwardcompatibility.php' => 1,
'backward_compatibility' => 1,
'ru.php' => 1,
'it.php' => 1,
'autoupgrade.php' => 1,
'ajax-upgradetab.php' => 1,
'adminselfupgrade.php' => 1,
'adminselfupgrade.gif' => 1,
'adminselftab.php' => 1,
'adminpreferences.php' => 1,
'advancedeucompliance.php' => 1,
'pswebservicelibrary.php' => 1,
'index (copy 3).html' => 1,
'blockreinsurance.php' => 1,
'reinsuranceclass.php' => 1,
'setup.yml.sample' => 1,
'homefeatured.php' => 1,
'productcomments.css' => 1,
'productcomments-extra.tpl' => 1,
'productcomments-ajax.php' => 1,
'productcriterion.php' => 1,
'productcommentcriterion.php' => 1,
'productcomment.php' => 1,
'paymentexample.php' => 1,
'payment.jpg' => 1,
'pagesnotfound.php' => 1,
'comment.gif' => 1,
'newsletter.php' => 1,
'homeslider.php' => 1,
'gsitemap.php' => 1,
'productcomments.tpl' => 1,
'gsitemap-cron.php' => 1,
'gridhtml.php' => 1,
'graphnvd3.php' => 1,
'oauth2callback.php' => 1,
'gapi.php' => 1,
'sql_install.php' => 1,
'prestashop.pub' => 1,
'gamification.php' => 1,
'followup.php' => 1,
'favoriteproducts.php' => 1,
'favoriteproducts.js' => 1,
'favoriteproducts.css' => 1,
'productcomments.php' => 1,
'productcomments_reviews.tpl' => 1,
'favoriteproducts-account.php' => 1,
'ps_customtext.tpl' => 1,
'referralprogrammodule.php' => 1,
'pscleaner.php' => 1,
'ps_socialfollow.tpl' => 1,
'ps_socialfollow.php' => 1,
'ps_sharebuttons.php' => 1,
'ps_mainmenu.tpl' => 1,
'ps_mainmenu.php' => 1,
'ps_linklist.php' => 1,
'ps_imageslider.php' => 1,
'homeslider.gif' => 1,
'ps_featuredproducts.php' => 1,
'ps_emailsubscription.php' => 1,
'ps_customtext.php' => 1,
'productcommentscriterion.php' => 1,
'ps_customersignin.tpl' => 1,
'ps_customersignin.php' => 1,
'ps_contactinfo.tpl' => 1,
'ps_contactinfo.php' => 1,
'ps_contactinfo-rich.tpl' => 1,
'ps_categorytree.php' => 1,
'ps_banner.tpl' => 1,
'ps_banner.php' => 1,
'producttooltip.php' => 1,
'productscategory.php' => 1,
'productpaymentlogos.php' => 1,
'tab.tpl' => 1,
'products-comparison.tpl' => 1,
'favoriteproducts-ajax.php' => 1,
'favoriteproduct.php' => 1,
'blockrss.php' => 1,
'blockstore.tpl' => 1,
'blockviewed.css' => 1,
'blockuserinfo.tpl' => 1,
'blockuserinfo.php' => 1,
'blockuserinfo.css' => 1,
'blocktopmenu.tpl' => 1,
'blocktopmenu.php' => 1,
'blocktags.tpl' => 1,
'blocktags.php' => 1,
'blocktags.css' => 1,
'blocksupplier.tpl' => 1,
'blocksupplier.php' => 1,
'store.jpg' => 1,
'blockstore.php' => 1,
'blockviewed.tpl' => 1,
'blockspecials.php' => 1,
'blocksocial.tpl' => 1,
'blocksocial.php' => 1,
'blocksocial.jpg' => 1,
'blocksharefb.tpl' => 1,
'blocksharefb.php' => 1,
'blocksearch.tpl' => 1,
'blocksearch.php' => 1,
'blocksearch.js' => 1,
'blocksearch.css' => 1,
'blocksearch-top.tpl' => 1,
'blocksearch-instantsearch.tpl' => 1,
'blockrss.tpl' => 1,
'blockviewed.php' => 1,
'blockwishlist-ajax.tpl' => 1,
'editorial.tpl' => 1,
'cheque.jpg' => 1,
'editorial.php' => 1,
'editorialclass.php' => 1,
'orderdetail.tpl' => 1,
'dateofdelivery.php' => 1,
'beforecarrier.tpl' => 1,
'dashtrends.php' => 1,
'dashproducts.php' => 1,
'dashgoals.php' => 1,
'gapi-logo.gif' => 1,
'dashactivity.php' => 1,
'crossselling.php' => 1,
'contactform.php' => 1,
'cashondelivery.php' => 1,
'blockwishlist-extra.tpl' => 1,
'cashondelivery.jpg' => 1,
'cashondelivery.gif' => 1,
'carriercompare.php' => 1,
'carriercompare.js' => 1,
'sendwishlist.php' => 1,
'my-account.tpl' => 1,
'managewishlist.php' => 1,
'buywishlistproduct.php' => 1,
'blockwishlist_top.tpl' => 1,
'blockwishlist_button.tpl' => 1,
'blockwishlist.tpl' => 1,
'blockwishlist.php' => 1,
'blockwishlist.css' => 1,
'swagger.json' => 1,
'playadzquicksetupbundle.php' => 1,
'referralprogram.php' => 1,
'padam87knockoutjsbundle.php' => 1,
'crypter.php' => 1,
'pandafirecorebundle.php' => 1,
'clonerinterface.php' => 1,
'pagomio.php' => 1,
'pageonaccountingbundle.php' => 1,
'paellatwitterbootstrapbundle.php' => 1,
'padam87searchbundle.php' => 1,
'rasterizer.php' => 1,
'padam87rasterizebundle.php' => 1,
'tempdir.php' => 1,
'configurationawaretrait.php' => 1,
'padam87modulebundle.php' => 1,
'padam87doctrinecacheinvalidatorbundle.php' => 1,
'encryptableiteminterface.php' => 1,
'padam87cronbundle.php' => 1,
'padam87billingobundle.php' => 1,
'padam87addressbundle.php' => 1,
'lightncandy' => 1,
'pugxshortiddoctrinebundle.php' => 1,
'bigquery' => 1,
'pugxi18nbundle.php' => 1,
'pugxgeoformbundle.php' => 1,
'pugxgeneratorbundle.php' => 1,
'pugxextravalidatorbundle.php' => 1,
'pugxautocompleterbundle.php' => 1,
'cascade.sublime-project' => 1,
'crypterinterface.php' => 1,
'nullcrypter.php' => 1,
'logincidadaotosbundle.php' => 1,
'slacklogger.php' => 1,
'banwiregatewaymethod.php' => 1,
'banwiregatewaybundle.php' => 1,
'banwiremethod.php' => 1,
'banwirebundle.php' => 1,
'bankwiremethod.php' => 1,
'bankwirebundle.php' => 1,
'authorizenetmethod.php' => 1,
'authorizenetbundle.php' => 1,
'openpayu_domain.php' => 1,
'html_helper.php' => 1,
'urlparserasset.php' => 1,
'bladebehavior.php' => 1,
'slackclient.php' => 1,
'timegenerator.php' => 1,
'xcopy.php' => 1,
'img_resize.php' => 1,
'priceformatter.php' => 1,
'clib.php' => 1,
'uploadercontroller.php' => 1,
'imguploader.php' => 1,
'parizzcacheextrabundle.php' => 1,
'parizzcachebundle.php' => 1,
'lsvpddkapibundle.php' => 1,
'lsvglsdkapibundle.php' => 1,
'paytrailgatewayfactory.php' => 1,
'pandawantechnologyrolevizbundle.php' => 1,
'timegeneratorinterface.php' => 1,
'praynocasauthbundle.php' => 1,
'procergslogincidadaomonitorbundle.php' => 1,
'dineromailapimethod.php' => 1,
'o2userbundle.php' => 1,
'plugin.js' => 1,
'persist.js' => 1,
'node.js' => 1,
'i18n.js' => 1,
'format.js' => 1,
'debug.js' => 1,
'arsenic.php' => 1,
'ppm.php' => 1,
'epitwitter.php' => 1,
'episequence.php' => 1,
'epioauth.php' => 1,
'epicurl.php' => 1,
'o2uibundle.php' => 1,
'string.js' => 1,
'o2modelbundle.php' => 1,
'thematicspeech.php' => 1,
'enseparhtml2pdfbundle.php' => 1,
'withingsbundle.php' => 1,
'oryzoneoauthbundle.php' => 1,
'oryzonemediastoragebundle.php' => 1,
'oryzoneimagevalidatorbundle.php' => 1,
'oryzoneimageresizerbundle.php' => 1,
'oryzoneboilerplatebundle.php' => 1,
'orkestrowebbundle.php' => 1,
'orkestrocountrybundle.php' => 1,
'orkestrocorebundle.php' => 1,
'orimgoogleapibundle.php' => 1,
'state.js' => 1,
'toolbar.js' => 1,
'procergslogincidadaoigpbundle.php' => 1,
'datetimerangesplitter.php' => 1,
'acmebadgesbundle.php' => 1,
'logincidadaobadgesbundle.php' => 1,
'pqstudiorestutilitybundle.php' => 1,
'pqstudioratelimitbundle.php' => 1,
'vk_exception.php' => 1,
'firstfriday.php' => 1,
'database.sqlite' => 1,
'addadmin.php' => 1,
'phppdo.php' => 1,
'pdostatementabstract.php' => 1,
'pdoexception.php' => 1,
'pdoabstract.php' => 1,
'datetimerange.php' => 1,
'types.js' => 1,
'cachebundle.php' => 1,
'phpfastcgispeedfonybundle.php' => 1,
'runfromweb.php' => 1,
'phpcheckstyle.sh' => 1,
'phpcheckstyle.cmd' => 1,
'.anorak.yml' => 1,
'database_pgsql.sql' => 1,
'wasp' => 1,
'profiles.php' => 1,
'stash.png' => 1,
'perbilitybcryptbundle.php' => 1,
'pbxg33kvocadbbundle.php' => 1,
'treetable.jquery.json' => 1,
'dineromailapibundle.php' => 1,
'dineromailbundle.php' => 1,
'platzengysasseticremoveloggingbundle.php' => 1,
'asesfeedbackcommand.php' => 1,
'form-protector.js' => 1,
'slyurlshortenerbundle.php' => 1,
'slypushoverbundle.php' => 1,
'slyfrancoisbundle.php' => 1,
'tinymce_toolbar.png' => 1,
'pco-kint.php' => 1,
'pco-image-widget-field.php' => 1,
'codesniffer.xml' => 1,
'wreaths' => 1,
'hawkstyles.css' => 1,
'.env_example' => 1,
'asesfeedbackhandler.php' => 1,
'asesfeedback.php' => 1,
'phing' => 1,
'imageresizer.php' => 1,
'visitorinfo.php' => 1,
'visitorfilter.php' => 1,
'updatecommand.php' => 1,
'peerjmpdfbundle.php' => 1,
'peerjusersecuritybundle.php' => 1,
'run-tests-with-coverage.sh' => 1,
'init.environment.php' => 1,
'public-routes.php' => 1,
'init.example.php' => 1,
'markdowntest.php' => 1,
'checker_bootstrap.php' => 1,
'phpaint.php' => 1,
'default_config.php' => 1,
'index.textile' => 1,
'currencytest.php' => 1,
'testguy.php' => 1,
'multidatespickerasset.php' => 1,
'multidatespicker.php' => 1,
'datespickerasset.php' => 1,
'datespicker.php' => 1,
'datesasset.php' => 1,
'collapsemenu.php' => 1,
'adminmenu.php' => 1,
'activeviewbutton.php' => 1,
'activetoolbarbutton.php' => 1,
'activeformbutton.php' => 1,
'composer.l' => 1,
'pipin' => 1,
'scenario.php' => 1,
'index.lex' => 1,
'codeguy.php' => 1,
'phpantom.php' => 1,
'phpantom' => 1,
'composer-extension.phar' => 1,
'htmlrenderer.php' => 1,
'test.file' => 1,
'phosprdoubleentrybundle.php' => 1,
'phosprcorebundle.php' => 1,
'workflow.png' => 1,
'rabbitmqsupervisorbundle.php' => 1,
'phobetorbillomatbundle.php' => 1,
'yml-example.php' => 1,
'i18n.class.php' => 1,
'circle-tests.yml' => 1,
'stripejsgatewayfactory.php' => 1,
'dineromailmethod.php' => 1,
'visanetmethod.php' => 1,
'redsysmethod.php' => 1,
'redsysbundle.php' => 1,
'paypalwebcheckoutmethod.php' => 1,
'paypalwebcheckoutemptymethod.php' => 1,
'paypalwebcheckoutbundle.php' => 1,
'paypalexpresscheckoutmethod.php' => 1,
'paypalexpresscheckoutbundle.php' => 1,
'paymillmethod.php' => 1,
'paymillbundle.php' => 1,
'paymentmethodinterface.php' => 1,
'paymentcoreevents.php' => 1,
'paymentcorebundle.php' => 1,
'payutransactiontypes.php' => 1,
'safetypaymethod.php' => 1,
'payurequesttypes.php' => 1,
'payumethod.php' => 1,
'payudetailstypes.php' => 1,
'payuadditionalvaluetypes.php' => 1,
'pagosonlinegatewaymethod.php' => 1,
'pagosonlinegatewaybundle.php' => 1,
'pagosonlinecommbundle.php' => 1,
'pagosonlinemethod.php' => 1,
'pagosonlinebundle.php' => 1,
'googlewalletmethod.php' => 1,
'googlewalletbundle.php' => 1,
'freepaymentmethod.php' => 1,
'freepaymentbundle.php' => 1,
'safetypaybundle.php' => 1,
'stripebundle.php' => 1,
'stripedirectgatewayfactory.php' => 1,
'payumbuilder.php' => 1,
'stripecheckoutgatewayfactory.php' => 1,
'sofortgatewayfactory.php' => 1,
'skeletongatewayfactory.php' => 1,
'payumbundle.php' => 1,
'paypalrestgatewayfactory.php' => 1,
'paypalprocheckoutgatewayfactory.php' => 1,
'paypalmasspaygatewayfactory.php' => 1,
'paypalexpresscheckoutgatewayfactory.php' => 1,
'payexgatewayfactory.php' => 1,
'offlinegatewayfactory.php' => 1,
'klarnainvoicegatewayfactory.php' => 1,
'klarnacheckoutgatewayfactory.php' => 1,
'payum.php' => 1,
'stripemethod.php' => 1,
'gatewayfactoryinterface.php' => 1,
'gatewayawaretrait.php' => 1,
'gatewayawareinterface.php' => 1,
'coregatewayfactory.php' => 1,
'apiawaretrait.php' => 1,
'apiawareinterface.php' => 1,
'be2billoffsitegatewayfactory.php' => 1,
'be2billdirectgatewayfactory.php' => 1,
'authorizenetaimgatewayfactory.php' => 1,
'undefinedkeyinstrictarrayexception.php' => 1,
'strictarray.php' => 1,
'webpaymethod.php' => 1,
'webpaybundle.php' => 1,
'referralprogram.gif' => 1,
'securitypatch.php' => 1,
'abstractnamednode.php' => 1,
'cookie-banner.php' => 1,
'rauwekostreleasebundle.php' => 1,
'rauwekostmonologawsbundle.php' => 1,
'rattlerhoneypotbundle.php' => 1,
'update-blocker.php' => 1,
'toolbar-theme-switcher.php' => 1,
'class-locate-vendor.php' => 1,
'holder.php' => 1,
'fragment-cache.php' => 1,
'error-log-dashboard-widget.php' => 1,
'class-r-hook-handler.php' => 1,
'advanced-hooks-api.php' => 1,
'rare-font-fout.php' => 1,
'generate_metrics.sh' => 1,
'release.yml.dist' => 1,
'raptekregonbundle.php' => 1,
'sf2genconsolelistener.php' => 1,
'sf2genconsolebundle.php' => 1,
'raphymarkdownbundle.php' => 1,
'raphyepitechuserbundle.php' => 1,
'samurai' => 1,
'.samurai.json' => 1,
'puppy' => 1,
'thrift.php' => 1,
'tania_serrano.sql' => 1,
'application.raid' => 1,
'autoload.gradle' => 1,
'deploy.yml.dist' => 1,
'version.yml.dist' => 1,
'apiserver-test.php' => 1,
'azubuapi.php' => 1,
'example.phtml' => 1,
'renton56paginatorbundle.php' => 1,
'rjemailbundle.php' => 1,
'google-translate.gemspec' => 1,
'.rvmrc' => 1,
'remguserbundle.php' => 1,
'remgpagebundle.php' => 1,
'remgmessagebundle.php' => 1,
'remggeneratorbundle.php' => 1,
'remgfrontendbundle.php' => 1,
'remgbackendbundle.php' => 1,
'ogravatar.php' => 1,
'sharescounter.php' => 1,
'rauwekostschedulebundle.php' => 1,
'scrypt130302pitcairnglg2tc8192w256l8.bin' => 1,
'regelwerkignorebotswiftmailerhandlerbundle.php' => 1,
'pscss' => 1,
'rdirsimplearraybundle.php' => 1,
'redexpertserrbitbundle.php' => 1,
'platesslimextension.php' => 1,
'platesmailtoextension.php' => 1,
'rravenmenuannotationsbundle.php' => 1,
'igbinary.php' => 1,
'eassetmanager.php' => 1,
'yiimailer.php' => 1,
'style_guide' => 1,
'liw.php' => 1,
'pdfcrowd.php' => 1,
'ec2ssh-worker' => 1,
'travis-coverage.php' => 1,
'context.go' => 1,
'staticroute.go' => 1,
'router_test.go' => 1,
'router.go' => 1,
'route_test.go' => 1,
'route.go' => 1,
'response_test.go' => 1,
'response.go' => 1,
'request_test.go' => 1,
'request.go' => 1,
'regexroute.go' => 1,
'middleware.go' => 1,
'context_test.go' => 1,
'comptage' => 1,
'defaultrequest_test.go' => 1,
'cadastre_type' => 1,
'bano-974.csv' => 1,
'bano-973.csv' => 1,
'bano-972.csv' => 1,
'bano-971.csv' => 1,
'bano-95.csv' => 1,
'bano-94.csv' => 1,
'bano-93.csv' => 1,
'bano-92.csv' => 1,
'bano-91.csv' => 1,
'bano-90.csv' => 1,
'bano-89.csv' => 1,
'bano-88.csv' => 1,
'defaultrequest.go' => 1,
'defaultresponse.go' => 1,
'ec2ssh' => 1,
'rncryptor-spec-v2' => 1,
'radiocerosbitidbundle.php' => 1,
'rwsoftexcelbundle.php' => 1,
'excelresponse.php' => 1,
'helper.css' => 1,
'yamlconfigbundle.php' => 1,
'vichimaginebundle.php' => 1,
'uploadbundle.php' => 1,
'ipinfobundle.php' => 1,
'itfadminbundle.php' => 1,
'homestead.yaml' => 1,
'draft-rncryptor-spec-v4.0' => 1,
'rncryptor-spec-v3' => 1,
'torrentapi.php' => 1,
'defaultresponse_test.go' => 1,
'api_documentation.pdf' => 1,
'googleapilibrary.php' => 1,
'slitslidermodule.php' => 1,
'manualwidget.php' => 1,
'manualimageaction.php' => 1,
'googlecalendarwidget.php' => 1,
'googlemapapi.php' => 1,
'propeltranslationbundle.php' => 1,
'pelau_suite_test.go' => 1,
'pelau.go' => 1,
'mime.go' => 1,
'defaultrouter_test.go' => 1,
'defaultrouter.go' => 1,
'quickpay.php' => 1,
'requestlabestatbundle.php' => 1,
'bano-86.csv' => 1,
'redactor.php' => 1,
'filearray.php' => 1,
'symfonybundleinstallerplugin.php' => 1,
'symfonybundleinstaller.php' => 1,
'servicesloader.php' => 1,
'scannerfactory.php' => 1,
'projectscanner.php' => 1,
'magicinjectionbundle.php' => 1,
'yamldeserializationvisitor.php' => 1,
'datetimehandler.php' => 1,
'abstractyamldeserializationhandler.php' => 1,
'jmsdeyamlbundle.php' => 1,
'elasticaentitymappingbundle.php' => 1,
'config.global.php' => 1,
'sipmultipleuploadbundle.php' => 1,
'priv.key' => 1,
'roles' => 1,
'syntaxhighlighter mit license' => 1,
'diem permissions' => 1,
'prove' => 1,
'ruhrtalnetmenubundle.php' => 1,
'gravatar-proxy.php' => 1,
'modifier.noscheme.php' => 1,
'rtmpdump' => 1,
'rtxlabsliquibasebundle.php' => 1,
'phppoker' => 1,
'gestion_framework.sql' => 1,
'rootaccezbasicbundle.php' => 1,
'siplocationpickerbundle.php' => 1,
'sipadmintreebundle.php' => 1,
'.ac-php-conf.json' => 1,
'symbioorangegatetimelinebundle.php' => 1,
'abstractliteral.php' => 1,
'abstractblanknode.php' => 1,
'querycache.php' => 1,
'serializerfactoryimpl.php' => 1,
'serializerfactory.php' => 1,
'serializationutils.php' => 1,
'parserfactory.php' => 1,
'nquadsserializerimpl.php' => 1,
'pxcorepaylinebundle.php' => 1,
'pxcorelibreofficeconverterbundle.php' => 1,
'symbioorangegateuserbundle.php' => 1,
'symbioorangegatetranslationbundle.php' => 1,
'symbioorangegatesearchbundle.php' => 1,
'sipdynamicconnectionbundle.php' => 1,
'symbioorangegatepagebundle.php' => 1,
'symbioorangegatenewsbundle.php' => 1,
'symbioorangegatemediabundle.php' => 1,
'symbioorangegatedoctrineormadminbundle.php' => 1,
'symbioorangegateclassificationbundle.php' => 1,
'symbioorangegateanalyticsbundle.php' => 1,
'symbioorangegateadminbundle.php' => 1,
'symbiofulltextsearchbundle.php' => 1,
'stiwlpagebundle.php' => 1,
'siptagbundle.php' => 1,
'siptranslationbundle.php' => 1,
'siptextbundle.php' => 1,
'sipnewsbundle.php' => 1,
'rootaccezodeskapibundle.php' => 1,
'watch.list' => 1,
'requestlabvimeobundle.php' => 1,
'cacheablebehaviorbundle.php' => 1,
'bamboo-example.png' => 1,
'fix-cs.sh' => 1,
'demo-config.yml' => 1,
'example-manual.php' => 1,
'configure.sample.json' => 1,
'tagcachetime.php' => 1,
'tagcacheobj.php' => 1,
'img-nocache.jpg' => 1,
'img-cached.jpg' => 1,
'tagcachecacheclearer.php' => 1,
'tagcachebundle.php' => 1,
'cacheablebehaviorfactory.php' => 1,
'itemfactory.php' => 1,
'phantomserver.js' => 1,
'itemcollectionfactory.php' => 1,
'itemcollection.php' => 1,
'itemallower.php' => 1,
'criteriabuilder.php' => 1,
'monexy.php' => 1,
'alphasms.php' => 1,
'exchanger.php' => 1,
'saasapiresourcemap' => 1,
'buttondropdownsorter.php' => 1,
'restapigeneratorbundle.php' => 1,
'respectvalidationbundle.php' => 1,
'rnkelfinderbundle.php' => 1,
'requestlabxitianalyticsbundle.php' => 1,
'filler.yml.dist' => 1,
'rjmcommentbundle.php' => 1,
'chosenbootstrapasset.php' => 1,
'ss3.jpg' => 1,
'roheaopenxintegrationbundle.php' => 1,
's2protocol' => 1,
'corezerobundle.php' => 1,
'settings.example.yml' => 1,
'parentchildtree.php' => 1,
'i18ntoolbar.php' => 1,
'treetable.php' => 1,
'term.php' => 1,
'taxonomytrait.php' => 1,
'rbrssbundle.php' => 1,
'rvdvdisqusbundle.php' => 1,
'example-output' => 1,
'ss2.jpg' => 1,
'rjmgenemusandboxbundle.php' => 1,
'ss1.jpg' => 1,
'docgen.json' => 1,
'reflectionmethod.php' => 1,
'reflectioninterface.php' => 1,
'docblock.php' => 1,
'use_native_gettext_function.php' => 1,
'use_class_gettext_function.php' => 1,
'gettextvars.php' => 1,
'gettextreader.php' => 1,
'multifactorauthforeveryone.png' => 1,
'twofactorauth.sln' => 1,
'twofactorauth.phpproj' => 1,
'rjmmaxmindbundle.php' => 1,
'bano-87.csv' => 1,
'bano-85.csv' => 1,
'sekeywords.php' => 1,
'smwfileprotect.php' => 1,
'smwuserprotect.classes.php' => 1,
'smwparent.php' => 1,
'smwparent.iterate.php' => 1,
'smwparent.i18n.php' => 1,
'smwparent.i18n.magic.php' => 1,
'smwparent.classes.php' => 1,
'smwlistprops.php' => 1,
'smwlistprops.i18n.php' => 1,
'smwlistprops.i18n.magic.php' => 1,
'smwlistprops.classes.php' => 1,
'smwnsprotect_body.php' => 1,
'smwfileprotect_body.php' => 1,
'formlink.php' => 1,
'smwuserprotect.php' => 1,
'emailobfuscator.js' => 1,
'laravel4.phpunit.xml' => 1,
'cmsadminbundle.php' => 1,
'entitystore' => 1,
'default-config.json' => 1,
'liscence' => 1,
'pkroundcolor.php' => 1,
'pkcolor.php' => 1,
'ps-forms.php' => 1,
'class-ps-forms.php' => 1,
'class-ps-forms-table.php' => 1,
'class-ps-forms-admin.php' => 1,
'smwuserprotect.i18n.php' => 1,
'semanticformsmultiedit.php' => 1,
'padoctrineenumbundle.php' => 1,
'sha1hashgenerator.php' => 1,
'.coverals.yml' => 1,
'pulpcache.php' => 1,
'pulpmediaserializedresponsebundle.php' => 1,
'pulpmedianghttpbundle.php' => 1,
'pulpmediap3pcookiebundle.php' => 1,
'radiobuttonmatrix.php' => 1,
'webtestcaseinterface.php' => 1,
'extensiontestcase.php' => 1,
'databasewebtestcase.php' => 1,
'databasetestcase.php' => 1,
'containerawaretestcase.php' => 1,
'consolecommandtestcase.php' => 1,
'md5hashgenerator.php' => 1,
'test.tpl' => 1,
'customalphabetcodegenerator.php' => 1,
'codegeneratorinterface.php' => 1,
'publeroapinotificationbundle.php' => 1,
'publerotokenauthenticationevents.php' => 1,
'publerotokenauthenticationbundle.php' => 1,
'publerotemplatemailerbundle.php' => 1,
'publeroapplemobilebundle.php' => 1,
'publerofilebundle.php' => 1,
'psycle-mail.php' => 1,
'psycle-mail.class.php' => 1,
'psycle-pii-scrub.php' => 1,
'class-pii-scrub.php' => 1,
'proxiwebpersonabundle.php' => 1,
'uri.lib.php' => 1,
'programmingarehardresourcebundle.php' => 1,
'loggly.php' => 1,
'statsbestvouchers.php' => 1,
'statspersonalinfos.php' => 1,
'statsorigin.php' => 1,
'statsnewsletter.php' => 1,
'statslive.php' => 1,
'statsforecast.php' => 1,
'next.png' => 1,
'funnel.png' => 1,
'statsequipment.php' => 1,
'statsdata.php' => 1,
'statscheckup.php' => 1,
'statscatalog.php' => 1,
'statscarrier.php' => 1,
'statsbestsuppliers.php' => 1,
'statsregistrations.php' => 1,
'statsbestproducts.php' => 1,
'statsbestmanufacturers.php' => 1,
'statsbestcustomers.php' => 1,
'statsbestcategories.php' => 1,
'socialsharing.php' => 1,
'sendtoafriend_ajax.php' => 1,
'sendtoafriend.tpl' => 1,
'sendtoafriend.png' => 1,
'sendtoafriend.php' => 1,
'sendtoafriend.js' => 1,
'sendtoafriend.css' => 1,
'sendtoafriend-extra.tpl' => 1,
'product_page.tpl' => 1,
'statsproduct.php' => 1,
'statssales.php' => 1,
'phar_stub.php' => 1,
'prims47translatebundle.php' => 1,
'tested.html' => 1,
'hypersafe.php' => 1,
'laravel.php' => 1,
'htmlki.php' => 1,
'smile.png' => 1,
'feeder.php' => 1,
'example-object.php' => 1,
'example-chain.php' => 1,
'example-array.php' => 1,
'chained.php' => 1,
'datefmt.php' => 1,
'certificationycertybundle.php' => 1,
'prims47paypalexpresscheckoutnvpbundle.php' => 1,
'statssearch.php' => 1,
'primenavigationbundle.php' => 1,
'prezenttranslationbundle.php' => 1,
'prezentgridbundle.php' => 1,
'prezentdompdfbundle.php' => 1,
'prezentdoctrinetranslatablebundle.php' => 1,
'watermark.php' => 1,
'watermark.gif' => 1,
'vatnumber.php' => 1,
'vatnumbertaxmanager.php' => 1,
'trackingfront.php' => 1,
'themeconfigurator.php' => 1,
'statsvisits.php' => 1,
'statsstock.php' => 1,
'boot_laravel.php' => 1,
'herokugeneratorcontroller.php' => 1,
'bano-84.csv' => 1,
'bano-40.csv' => 1,
'bano-52.csv' => 1,
'bano-51.csv' => 1,
'bano-50.csv' => 1,
'bano-49.csv' => 1,
'bano-48.csv' => 1,
'bano-47.csv' => 1,
'bano-46.csv' => 1,
'bano-45.csv' => 1,
'bano-44.csv' => 1,
'bano-43.csv' => 1,
'bano-42.csv' => 1,
'bano-41.csv' => 1,
'bano-39.csv' => 1,
'bano-54.csv' => 1,
'bano-38.csv' => 1,
'bano-37.csv' => 1,
'bano-36.csv' => 1,
'bano-35.csv' => 1,
'bano-34.csv' => 1,
'bano-33.csv' => 1,
'bano-32.csv' => 1,
'bano-31.csv' => 1,
'bano-30.csv' => 1,
'bano-2b.csv' => 1,
'bano-2a.csv' => 1,
'bano-29.csv' => 1,
'bano-28.csv' => 1,
'bano-53.csv' => 1,
'bano-55.csv' => 1,
'bano-26.csv' => 1,
'bano-71.csv' => 1,
'bano-83.csv' => 1,
'bano-82.csv' => 1,
'bano-81.csv' => 1,
'bano-80.csv' => 1,
'bano-79.csv' => 1,
'bano-78.csv' => 1,
'bano-77.csv' => 1,
'bano-76.csv' => 1,
'bano-75.csv' => 1,
'bano-74.csv' => 1,
'bano-73.csv' => 1,
'bano-72.csv' => 1,
'bano-70.csv' => 1,
'bano-56.csv' => 1,
'bano-69.csv' => 1,
'bano-68.csv' => 1,
'bano-67.csv' => 1,
'bano-66.csv' => 1,
'bano-65.csv' => 1,
'bano-64.csv' => 1,
'bano-63.csv' => 1,
'bano-62.csv' => 1,
'bano-61.csv' => 1,
'bano-60.csv' => 1,
'bano-59.csv' => 1,
'bano-58.csv' => 1,
'bano-57.csv' => 1,
'bano-27.csv' => 1,
'bano-25.csv' => 1,
'check_psr.sh' => 1,
'dataservice.php' => 1,
'sourcertrait.php' => 1,
'sourcerinterface.php' => 1,
'sourceabletrait.php' => 1,
'sourceableinterface.php' => 1,
'qualitypressstaticcontentbundle.php' => 1,
'qualitypresssocialmediabundle.php' => 1,
'qualitycurrencyconverterbundle.php' => 1,
'qualitypressbreadcrumbsbundle.php' => 1,
'requestadapter.php' => 1,
'operationcontextadapter.php' => 1,
'odataurlrule.php' => 1,
'queryprovider.php' => 1,
'basequeryprovider.php' => 1,
'listingfilter.php' => 1,
'baseentity.php' => 1,
'basedataservice.php' => 1,
'qcumbeerbreadcrumbsbundle.php' => 1,
'shops.dist.json' => 1,
'ee7.php' => 1,
'ee.php' => 1,
'qbttranslationbundle.php' => 1,
'qbankapi.php' => 1,
'credentials.php' => 1,
'cachepolicy.php' => 1,
'radiohitsbundle.php' => 1,
'deejaypoolbundle.php' => 1,
'deejayfilesorganizerbundle.php' => 1,
'websitebundle.php' => 1,
'uploadmodel.php' => 1,
'bano-24.csv' => 1,
'bano-10.csv' => 1,
'bano-23.csv' => 1,
'bano-22.csv' => 1,
'bano-21.csv' => 1,
'bano-19.csv' => 1,
'bano-18.csv' => 1,
'bano-17.csv' => 1,
'bano-16.csv' => 1,
'bano-15.csv' => 1,
'bano-14.csv' => 1,
'bano-13.csv' => 1,
'bano-12.csv' => 1,
'bano-11.csv' => 1,
'bano-09.csv' => 1,
'qbrepobundle.php' => 1,
'bano-08.csv' => 1,
'bano-07.csv' => 1,
'bano-06.csv' => 1,
'bano-05.csv' => 1,
'bano-04.csv' => 1,
'bano-03.csv' => 1,
'bano-02.csv' => 1,
'bano-01.csv' => 1,
'1_statistiques_rapprochement_voirie' => 1,
'searchresultproviderfactory.php' => 1,
'searchresultprovider.php' => 1,
'searchresultfilter.php' => 1,
'searchprovider.php' => 1,
'autoload_test_register.php' => 1,
'csconfig.php_cs' => 1,
'oreadespaymentpayplugbundle.php' => 1,
'analystsconfigurator.example.php' => 1,
'docomo.php' => 1,
'deployer.yml' => 1,
'couchreplicator.php' => 1,
'couchdocument.php' => 1,
'couchclient.php' => 1,
'couchadmin.php' => 1,
'couch.php' => 1,
'classmap-generator.sh' => 1,
'ioccontainer.php' => 1,
'anna.php' => 1,
'anna.bat' => 1,
'anna' => 1,
'payu.php' => 1,
'loggly-new-input.png' => 1,
'mysql-connector-license' => 1,
'mysql-connector-java-5.1.18-bin.jar' => 1,
'aniscommercebundle.php' => 1,
'uploadcropimagebundle.php' => 1,
'animedb' => 1,
'pandoradoctrinegeneratorbundle.php' => 1,
'include_file_template.php' => 1,
'cake.php' => 1,
'envswitcher.php' => 1,
'model' => 1,
'standards.xml' => 1,
'easygit.php' => 1,
'create-tables.sql' => 1,
'loggly-shell.png' => 1,
'create-language-detector' => 1,
'upgrade-2.0.2' => 1,
'wp-libre-form.php' => 1,
'woocommerce-clean-orphaned-variations.php' => 1,
'pusher.sublime-project' => 1,
'antqaajaxautocompletebundle.php' => 1,
'gate.php' => 1,
'amocrm.php' => 1,
'vkapi.php' => 1,
'antkowiakvalidationbundle.php' => 1,
'readme_pl' => 1,
'mongodbmigrationsbundle.php' => 1,
'upgrade-2.0.4' => 1,
'upgrade-2.0.3' => 1,
'upgrade-2.0.1' => 1,
'ansuserbundle.php' => 1,
'rules.mk' => 1,
'afs_version.php' => 1,
'afs_lib.php' => 1,
'afs_lib.doxygen' => 1,
'dlr' => 1,
'arvblogservices.php' => 1,
'arvblogroles.php' => 1,
'arvblogparameters.php' => 1,
'arvblogbundle.php' => 1,
'afdonttranslatebundle.php' => 1,
'patchwork.php' => 1,
'generate-phar.php' => 1,
'antaresaccessiblebundle.php' => 1,
'detect-language' => 1,
'extension-install.sh' => 1,
'wp-pdf-templates.php' => 1,
'bubblesoap.class.php' => 1,
'andresmontanezfragmentcachebundle.php' => 1,
'wysihtml5.php' => 1,
'coreimage.php' => 1,
'yammerstrategy.php' => 1,
'schematic.phar' => 1,
'.schematic.yaml' => 1,
'wp-represent-map.php' => 1,
'cover.jpeg' => 1,
'bootstrap-phpunit.php' => 1,
'utilizando_o_composer_no_windows' => 1,
'exemplo-estados' => 1,
'exemplo-datas' => 1,
'ususcryptpasswordencoderbundle.php' => 1,
'andresmontanezuseragentstringbundle.php' => 1,
'billabletrait.php' => 1,
'gravatarpresentertrait.php' => 1,
'abkquerybundle.php' => 1,
'phpjunitmerge' => 1,
'andreasglasernotifybundle.php' => 1,
'andreasglaserdceventbundle.php' => 1,
'andreasglaserdoctrinefilebundle.php' => 1,
'commit-msg' => 1,
'try_schema_tool.php' => 1,
'migration-to-2.1' => 1,
'migration-to-2.0' => 1,
'htaccess-example' => 1,
'potatodb.sq3' => 1,
'andresmontanezrecommendationsbundle.php' => 1,
'googleurlshortener.php' => 1,
'acknowledgement' => 1,
'nooppagerbundle.php' => 1,
'mhttohtml.php' => 1,
'gerrie' => 1,
'license 2' => 1,
'.env.production.php' => 1,
'simplify.php' => 1,
'run_webpage.php' => 1,
'run_servicepage.php' => 1,
'run_script.php' => 1,
'run_init.php' => 1,
'nooptwitterbootstrapbundle.php' => 1,
'noopstopforumspambundle.php' => 1,
'noopparserbundle.php' => 1,
'noopformfieldsbundle.php' => 1,
'datatrait.php' => 1,
'attached-post-field-cmb2.php' => 1,
'contactformwidget.php' => 1,
'provisioner' => 1,
'financial' => 1,
'security_ruleset.xml' => 1,
'creditcardnumber.php' => 1,
'creditcardexpiry.php' => 1,
'creditcardcvcode.php' => 1,
'creditcardasset.php' => 1,
'featherlightgalleryasset.php' => 1,
'featherlightgallery.php' => 1,
'featherlightasset.php' => 1,
'featherlight.php' => 1,
'index-pdf.php' => 1,
'wp-post-acl.php' => 1,
'host=localhost:33060;dbname=potato' => 1,
'aqarmaputilitybundle.php' => 1,
'arcanacontentbundle.php' => 1,
'optionelement.php' => 1,
'errorview.php' => 1,
'jada' => 1,
'unittests' => 1,
'fromgit.php' => 1,
'ipreserver.php' => 1,
'cmsdiff.php' => 1,
'lightframework.sql' => 1,
'ahomestead' => 1,
'composer-nette_2.2.json' => 1,
'thumbnailconfig.php' => 1,
'multiregionbundle.php' => 1,
'slotmachineslotbundle.php' => 1,
'apruve.php' => 1,
'culabsjquerybundle.php' => 1,
'culabstestingbundle.php' => 1,
'culabsilluminatebundle.php' => 1,
'culabscontactbundle.php' => 1,
'bugcatch.services.yml' => 1,
'bugcatch.info.yml' => 1,
'culabsbugcatchbundle.php' => 1,
'culabsadminbundle.php' => 1,
'apresellerclubbundle.php' => 1,
'testupload.png' => 1,
'test_add_data.zip' => 1,
'archerclickatellbundle.php' => 1,
'schema.solr5.xml' => 1,
'virtual-host.xml' => 1,
'armetizfacebookbundle.php' => 1,
'aygondoctrinemigrationsbundle.php' => 1,
'aygondatabaseconfigbundle.php' => 1,
'aygondatalistbundle.php' => 1,
'albtwigshellbundle.php' => 1,
'albtwigreflectionbundle.php' => 1,
'mthamlengine.php' => 1,
'mthamlbundle.php' => 1,
'alboauth2serverbundle.php' => 1,
'repo-stats' => 1,
'armetizmediabundle.php' => 1,
'armetizformextensionbundle.php' => 1,
'facebooksessionpersistence.php' => 1,
'armazon' => 1,
'atadminbundle.php' => 1,
'simple_acf_options.php' => 1,
'j3telquerybundle.php' => 1,
'j3telpagerbundle.php' => 1,
'argentumtranslationbundle.php' => 1,
'readme.md.example' => 1,
'yaf.php' => 1,
'generate_namespaces.php' => 1,
'v8js.php' => 1,
'simplecws.php' => 1,
'oauthparams-dist.php' => 1,
'morana.sublime-workspace' => 1,
'atuserbundle.php' => 1,
'atcmsbundle.php' => 1,
'sdsidebar.php' => 1,
'common.win.properties' => 1,
'apisocialbundle.php' => 1,
'dryrun.php' => 1,
'aws-eb-newrelic-deploynotify.sh' => 1,
'xmllint.sh' => 1,
'systemstorage_import.sh' => 1,
'phplint.sh' => 1,
'opsworks_updateapp.sh' => 1,
'opsworks_deployment.sh' => 1,
'apply_patches.sh' => 1,
'blueprints.example.yml' => 1,
'locallang_db.php' => 1,
'class.tx_staticpub_fe.php' => 1,
'class.tx_staticpub_export.php' => 1,
'class.tx_staticpub.php' => 1,
'apply.php' => 1,
'oraclelogin.php' => 1,
'scheduler_cron.sh' => 1,
'lci.php' => 1,
'api2.php' => 1,
'logingatebundle.php' => 1,
'antsocialrestbundle.php' => 1,
'antphotorestbundle.php' => 1,
'metadatabundle.php' => 1,
'helpbundle.php' => 1,
'antfotobundle.php' => 1,
'.project~' => 1,
'chateasecurebundle.php' => 1,
'chateaclientbundle.php' => 1,
'antbadgebundle.php' => 1,
'oci8dbconnection.php' => 1,
'generate-doc.bat' => 1,
'common.mac.properties' => 1,
'apoutchikamediabundle.php' => 1,
'common.linux.properties' => 1,
'upgrade-1.1.1' => 1,
'upgrade-1.1.0' => 1,
'upgrade-1.0.6' => 1,
'upgrade-1.0.5' => 1,
'upgrade-1.0.4' => 1,
'upgrade-1.0.3' => 1,
'upgrade-1.0.2' => 1,
'dateintlfacade.php' => 1,
'dateintlbuilder.php' => 1,
'readme-pl' => 1,
'traceviewbundle.php' => 1,
'apoutchikaloremipsumbundle.php' => 1,
'expiringhash.php' => 1,
'pull-hub-updates.bat' => 1,
'aplazame.php' => 1,
'watchngo.config' => 1,
'watchngo' => 1,
'mp' => 1,
'migrator.php' => 1,
'fixturenator.php' => 1,
'cfg' => 1,
'configmagic.php' => 1,
'climax' => 1,
'testclasses.php' => 1,
'climaxcontrollertest.php' => 1,
'climax.php' => 1,
'potato.db' => 1,
'view-application-form.php' => 1,
'aygonformhandlerbundle.php' => 1,
'debrilrssatombundle.php' => 1,
'simplistic-nav-menus.php' => 1,
'alexkomaralexfilesearchbundle.php' => 1,
'asynctweetsbundle.php' => 1,
'script.sql' => 1,
'shell.sh' => 1,
'readmerussian' => 1,
'gittest2.core' => 1,
'gittest' => 1,
'aldoapibundle.php' => 1,
'example.dcr.yml' => 1,
'dcr' => 1,
'.jscsrc.drupal' => 1,
'phpunit-feeds.xml' => 1,
'polyutil.php' => 1,
'debrilfeediobundle.php' => 1,
'persons.png' => 1,
'curriculum.png' => 1,
'alexwebbundle.php' => 1,
'phped' => 1,
'grammar' => 1,
'alexpaginationbundle.php' => 1,
'alexmultisitebundle.php' => 1,
'alexdoctrineextrabundle.php' => 1,
'alexasseticextrabundle.php' => 1,
'twofactor_gauthenticator_form.js' => 1,
'twofactor_gauthenticator.php' => 1,
'mathutil.php' => 1,
'sphericalutil.php' => 1,
'qrcode.min.js' => 1,
'settingsasset.php' => 1,
'erro.html' => 1,
'reflectsandcleanspropertiesaftertesttrait.php' => 1,
'iscontrollertesttrait.php' => 1,
'closesconnectionsaftertesttrait.php' => 1,
'apihelperstrait.php' => 1,
'newsstickerasset.php' => 1,
'newssticker.php' => 1,
'phunction.php' => 1,
'testdummy' => 1,
'align-lib-doc.pdf' => 1,
'filternet' => 1,
'uploadfilesbehavior.php' => 1,
'algolia_algoliasearch.xml' => 1,
'isup' => 1,
'contacts.json' => 1,
'algoliasearch.php' => 1,
'skeletonclass.php' => 1,
'mypackageserviceprovider.php' => 1,
'ab_useparentmediafiles.sublime-project' => 1,
'cougar.php' => 1,
'microremoteservicebundle.php' => 1,
'microclientbundle.php' => 1,
'microbaseservicebundle.php' => 1,
'ratyasset.php' => 1,
'raty.php' => 1,
'nf_pp.php' => 1,
'tiny_ssi.php' => 1,
'twofactor_gauthenticator.js' => 1,
'2fa_qr_code.js' => 1,
'phpunit-auth-example.json' => 1,
'localization.html.php' => 1,
'templateenginecache.php' => 1,
'templates.ru.json' => 1,
'templates.json' => 1,
'templates.html.php' => 1,
'simple.ru.json' => 1,
'simple.json' => 1,
'pages.ru.json' => 1,
'pages.php' => 1,
'pages.html.php' => 1,
'localization.ru.json' => 1,
'localization.php' => 1,
'localization.json' => 1,
'index.ru.json' => 1,
'templateenginenull.php' => 1,
'index.json' => 1,
'global.ru.json' => 1,
'global.json' => 1,
'elements.ru.json' => 1,
'elements.json' => 1,
'elements.html.php' => 1,
'debug.ru.json' => 1,
'debug.json' => 1,
'debug.html.php' => 1,
'controls.ru.json' => 1,
'controls.php' => 1,
'controls.json' => 1,
'controls.html.php' => 1,
'templateenginefactory.module' => 1,
'templateengineprocesswire.module' => 1,
'scrypt.php' => 1,
'adminltecrudgenerator.sublime-project' => 1,
'devicedetect.php' => 1,
'vcdeploy' => 1,
'config.inc.php.dist2' => 1,
'l91suluwebsiteuserbundle.php' => 1,
'l91suluformbundle.php' => 1,
'l91sulubackendbundle.php' => 1,
'techfinancialsclient.php' => 1,
'commoner.xml' => 1,
'alestecrudgeneratorbundle.php' => 1,
'alestegeneratorbundle.php' => 1,
'adminltegeneratorbundle.php' => 1,
'adminltecrudgenerator.sublime-workspace' => 1,
'dependentdropdown.php' => 1,
'license.twig' => 1,
'modalloaderasset.php' => 1,
'modalloader.php' => 1,
'languageboxasset.php' => 1,
'languagebox.php' => 1,
'famfamfamflagsasset.php' => 1,
'cookiesasset.php' => 1,
'.flooignore' => 1,
'jquerytranslatorasset.php' => 1,
'circulartabsasset.php' => 1,
'circulartabs.php' => 1,
'titlebehavior.php' => 1,
'i18ntrait.php' => 1,
'controllerhelper.php' => 1,
'mg' => 1,
'timeslot.php' => 1,
'view-application-data.php' => 1,
'amiairbrakebundle.php' => 1,
'reverseproxy.php' => 1,
'phperror-gui.php' => 1,
'thumbnails.php' => 1,
'entropy' => 1,
'twitterfeed.php' => 1,
'detailview4col.php' => 1,
'aerospikesessionhandler.php' => 1,
'tempmail_example.php' => 1,
'tempmail.class.php' => 1,
'zarinpal.php' => 1,
'awzetacachebundle.php' => 1,
'awezpfetchbundle.php' => 1,
'sequencejsasset.php' => 1,
'pingerbundle.php' => 1,
'nivosliderasset.php' => 1,
'elevatezoomasset.php' => 1,
'elevatezoom.php' => 1,
'moneyasset.php' => 1,
'adrcassandrabundle.php' => 1,
'jpgraph_logo.jpg' => 1,
'amysql.php' => 1,
'ambtadoctrineencryptbundle.php' => 1,
'uploadsaktiwidgetasset.php' => 1,
'uploadsaktitrait.php' => 1,
'uploadsaktiasset.php' => 1,
'uploadsakti.php' => 1,
'amaxlabformbundle.php' => 1,
'messentebundle.php' => 1,
'checkvendors.sh' => 1,
'timezones' => 1,
'edit-application-form.php' => 1,
'view-all-applications.php' => 1,
'terms_condition.php' => 1,
'switchery.min.js' => 1,
'switchery.min.css' => 1,
'renewal_notification.php' => 1,
'register-application-form.php' => 1,
'new-application-list.php' => 1,
'my_companies.php' => 1,
'my-invoices-list.php' => 1,
'manage_templates_role.php' => 1,
'ias-documents.php' => 1,
'edited-application-list.php' => 1,
'company_users.php' => 1,
'jqueuebundle.php' => 1,
'change-password.php' => 1,
'certificate_listing.php' => 1,
'approved-application-list.php' => 1,
'application_form.php' => 1,
'application-form.css' => 1,
'app-diff.php' => 1,
'all_companies.php' => 1,
'add_users.php' => 1,
'jqueryajaxenxbundle.php' => 1,
'_example.php' => 1,
'_auto_example.php' => 1,
'lescript.php' => 1,
'sonatamediawebcamproviderbundle.php' => 1,
'backenddesignbundle.php' => 1,
'amsearchplugin.php' => 1,
'assetmon' => 1,
'data_manager.php' => 1,
'businessdropcapbundle.php' => 1,
'businesscarouselbundle.php' => 1,
'alphalemonbootstrapbundle.php' => 1,
'love alphalemoncms (powered by link)' => 1,
'gpl2' => 1,
'alphalemoncmsbundle.php' => 1,
'alvalumuploaderbundle.php' => 1,
'uinames.class.php' => 1,
'instagram-helper.php' => 1,
'posts_store.php' => 1,
'notice_manager.php' => 1,
'instagram_factory.php' => 1,
'carbon_helper.php' => 1,
'businesssliderbundle.php' => 1,
'env_example' => 1,
'entity_decorator_finder.class.inc' => 1,
'entity_decorator.module' => 1,
'entity_decorator.info' => 1,
'measure.php' => 1,
'weirdbundle.php' => 1,
'lexrants.libraries.yml' => 1,
'lexrants.info.yml' => 1,
'lexrants.breakpoints.yml' => 1,
'registry.functions.php' => 1,
'empir' => 1,
'assetmon.php' => 1,
'assetmon.json' => 1,
'businessmenubundle.php' => 1,
'businesswebsitethemebundle.php' => 1,
'amnavplugin.php' => 1,
'symfony.php' => 1,
'amformsplugin.php' => 1,
'oathtoken.php' => 1,
'alyxgrayoathtokenbundle.php' => 1,
'logviewbundle.php' => 1,
'.twgit_features_subject' => 1,
'readme.mdwn' => 1,
'alterphpdeveloperbundle.php' => 1,
'alterphpbitformbundle.php' => 1,
'alter' => 1,
'alsarmonologextensionsbundle.php' => 1,
'convertibleinterface.php' => 1,
'autoboxtype.php' => 1,
'alpixeluserbundle.php' => 1,
'alphalemonelfinderbundle.php' => 1,
'seobundle.php' => 1,
'alpixelmenubundle.php' => 1,
'alpixelmediabundle.php' => 1,
'alpixelelasticaquerysorterbundle.php' => 1,
'alpixelcustomerbridgebundle.php' => 1,
'alpixelcmsbundle.php' => 1,
'alpixelassetversionbundle.php' => 1,
'fix-generated-themes' => 1,
'alphalemonthemeenginebundle.php' => 1,
'socialsdkbundle.php' => 1,
'alphalemonpagetreebundle.php' => 1,
'markdowngeshibundle.php' => 1,
'alphalemonfrontendbundle.php' => 1,
'aygonfilterbundle.php' => 1,
'config_readme' => 1,
'nemiro.webforms.php.phpproj.user' => 1,
'htpasswd.php' => 1,
'docmethod.php' => 1,
'docclass.php' => 1,
'lambda.php' => 1,
'numerics.php' => 1,
'tagslist.php' => 1,
'htmlminifier.php' => 1,
'named.php' => 1,
'lazyfield.php' => 1,
'lazycontainer.php' => 1,
'arraywrapper.php' => 1,
'arraymagic.php' => 1,
'passwordfile.php' => 1,
'realfile.php' => 1,
'posgenerated.php' => 1,
'fs.php' => 1,
'windows.php' => 1,
'posix.php' => 1,
'ifile.php' => 1,
'ifs.php' => 1,
'superglobals.php' => 1,
'evil.php' => 1,
'typingerror.php' => 1,
'requiresoverride.php' => 1,
'propertyreadonly.php' => 1,
'pointless.php' => 1,
'opts.php' => 1,
'docvar.php' => 1,
'posmap.php' => 1,
'notinstalled.php' => 1,
'quick_start' => 1,
'minify.module' => 1,
'minify.install' => 1,
'minify.info' => 1,
'minify.admin.inc' => 1,
'azure_blob.streamwrappers.inc' => 1,
'azure_blob.module' => 1,
'azure_blob.install' => 1,
'azure_blob.info' => 1,
'azure_blob.drush.inc' => 1,
'simpleapp.php' => 1,
'azinegeoblockingbundle.php' => 1,
'usage_examples' => 1,
'azineemailbundle.php' => 1,
'possource.php' => 1,
'azinesocialbarbundle.php' => 1,
'azinemailgunwebhooksbundle.php' => 1,
'azinehybridauthbundle.php' => 1,
'raskoh.php' => 1,
'code-capture.png' => 1,
'loop-tests' => 1,
'azatyanarmenianlocalebundle.php' => 1,
'sv.po' => 1,
'php-xgettext' => 1,
'pgettext.php' => 1,
'recentplaces.lnk' => 1,
'ifactory.php' => 1,
'sourcemap.php' => 1,
'notvalid.php' => 1,
'notinited.php' => 1,
'bmltwigswiftmailerbundle.php' => 1,
'issuu.php' => 1,
'calendaruplifts.php' => 1,
'suppliers.php' => 1,
'roomservice.php' => 1,
'products.php' => 1,
'orders.php' => 1,
'customers.php' => 1,
'drinkmenu.php' => 1,
'modules' => 1,
'extend' => 1,
'beverage' => 1,
'logrest' => 1,
'shutterfly.php' => 1,
'curlclass.php' => 1,
'omnipay.php' => 1,
'mysql2sqlite.sh' => 1,
'mysql2sqlite.php' => 1,
'database-str-replace.php' => 1,
'database-prefix.php' => 1,
'database-browser.php' => 1,
'cities_states.php' => 1,
'index.sample.php' => 1,
'avooserializertranslationbundle.php' => 1,
'avooinstallerbundle.php' => 1,
'avoogeneratorbundle.php' => 1,
'avooelobundle.php' => 1,
'elopoint.php' => 1,
'avooachievementbundle.php' => 1,
'custompayment.php' => 1,
'moventprofilerbundle.php' => 1,
'notfound.php' => 1,
'actionnotallowed.php' => 1,
'logic.php' => 1,
'itemnotfound.php' => 1,
'invalidvalue.php' => 1,
'invalidformat.php' => 1,
'invalidconfig.php' => 1,
'forbidden.php' => 1,
'fieldnotexist.php' => 1,
'disabled.php' => 1,
'dependencyerror.php' => 1,
'containerreadonly.php' => 1,
'alreadyinited.php' => 1,
'adapternotdefined.php' => 1,
'setter.php' => 1,
'awildeepdisquebundle.php' => 1,
'joblist.php' => 1,
'exp.php' => 1,
'subs.php' => 1,
'lazy.php' => 1,
'irootnode.php' => 1,
'inode.php' => 1,
'exceptiontrace.php' => 1,
'phpunit.xml.desc' => 1,
'axsytransactionalbundle.php' => 1,
'axsydoctrineshardingbundle.php' => 1,
'herbertextrabootstrap.php' => 1,
'.codeception.yml' => 1,
'.codeception.coverage.yml' => 1,
'build-example.xml' => 1,
'scaffold' => 1,
'payload.json' => 1,
'dotenvplugin.php' => 1,
'classbasednametrait.php' => 1,
'bangpoundinvokerbundle.php' => 1,
'bangpoundguzzleproxybundle.php' => 1,
'commonsgenderbundle.php' => 1,
'bangpoundfinitebundle.php' => 1,
'druplex.php' => 1,
'drupalserviceprovider.php' => 1,
'pseudokernel.php' => 1,
'drupalsessionhandler.php' => 1,
'bangpounddrupalbundle.php' => 1,
'bangpounddocumentcloudbundle.php' => 1,
'debugbarserviceprovider.php' => 1,
'constantsplugin.php' => 1,
'standardconfigtrait.php' => 1,
'bangpoundcastlebundle.php' => 1,
'callablecompilerpass.php' => 1,
'bangpoundatomdatabundle.php' => 1,
'asseticserviceprovider.php' => 1,
'codekitcoffeescriptfilter.php' => 1,
'sculpinoembedbundle.php' => 1,
'legacyphphttpkernelprovider.php' => 1,
'ezid.php' => 1,
'php-bandwidth' => 1,
'rm-subs' => 1,
'catapultdb.sql' => 1,
'exec.php' => 1,
'minimalconfigtrait.php' => 1,
'variablefilesystemtrait.php' => 1,
'rkpostformat.php' => 1,
'dynamodb_local_schema.js' => 1,
'githubmodel.php' => 1,
'eventbootstrap.php' => 1,
'urltest.php' => 1,
'unittest.php' => 1,
'methodparser.php' => 1,
'codeceptionaction.php' => 1,
'clicktest.php' => 1,
'configbootstrap.php' => 1,
'html2csv.php' => 1,
'cgkintbundle.php' => 1,
'barbondevpaymentpaypointhostedbundle.php' => 1,
'fast' => 1,
'dynamodb_local_init.db' => 1,
'yamlenvironmenttrait.php' => 1,
'bangpoundtwitterstreamingbundle.php' => 1,
'symfony_test.module' => 1,
'symfony_test.info' => 1,
'symfony.module' => 1,
'symfony.info' => 1,
'session.inc' => 1,
'jsonxmlelement.php' => 1,
'bangpoundpubsubbundle.php' => 1,
'phirehoseevents.php' => 1,
'bangpoundphirehosebundle.php' => 1,
'mediawiki-parser.php' => 1,
'ladybugserviceprovider.php' => 1,
'ladybugextension.php' => 1,
'phploy.ini' => 1,
'symfony-autocomplete' => 1,
'bb-twitterfeed.php' => 1,
'layoutbuilder.php' => 1,
'twigrender.php' => 1,
'urlgeneratorinterface.php' => 1,
'requestcontextinterface.php' => 1,
'flashinterface.php' => 1,
'dependencyinjectioncontainerinterface.php' => 1,
'callbackinterface.php' => 1,
'callbackfactoryinterface.php' => 1,
'bindingfactoryinterface.php' => 1,
'authenticatorinterface.php' => 1,
'numeric.php' => 1,
'backbee.bat' => 1,
'toolbar.php' => 1,
'crop.php' => 1,
'backendwebgeneratorbundle.php' => 1,
'bbapplication.php' => 1,
'bacbox_license' => 1,
'bacbox_author' => 1,
'taglistextension.php' => 1,
'taglisteventsubscriber.php' => 1,
'fastnavextension.php' => 1,
'fastnaveventsubscriber.php' => 1,
'blogrollextension.php' => 1,
'blogrolleventsubscriber.php' => 1,
'bablogentriesbundle.php' => 1,
'babaganoushgridsterbundle.php' => 1,
'babaganoushfoundationbundle.php' => 1,
'babaganoushdatatablesbundle.php' => 1,
'backenderepiceditorbundle.php' => 1,
'errorfinder.php' => 1,
'brsignedrequestbundle.php' => 1,
'rollbarerrorhandler.php' => 1,
'notostest' => 1,
'uapiasset.php' => 1,
'baiy.php' => 1,
'baitpollbundle.php' => 1,
'sqlite_simple_store.php' => 1,
'php-hooks.php' => 1,
'sign_sample.php' => 1,
'sampleconf.php' => 1,
'bosclientsample.php' => 1,
'withpayload.php' => 1,
'measurementprotocol.php' => 1,
'rollbarlogroute.php' => 1,
'rollbarcomponent.php' => 1,
'badge-poser.svg' => 1,
'mailgunyii2.php' => 1,
'mailgunyii.php' => 1,
'mailgununsubscribe.php' => 1,
'mailgunroute.php' => 1,
'mailgunmessage.php' => 1,
'mailgunlistmember.php' => 1,
'mailgunlist.php' => 1,
'mailguncomplaint.php' => 1,
'mailgunbounce.php' => 1,
'mailgunapi.php' => 1,
'baetmaendqlbundle.php' => 1,
'today-dark.svg' => 1,
'i_m-badge.svg' => 1,
'achievement.php' => 1,
'hookdeploy.php' => 1,
'arodissxlsbundle.php' => 1,
'multipleimagesfield.php' => 1,
'lambdacontroller.php' => 1,
'httpfile.php' => 1,
'cookiemanager.php' => 1,
'hookabletrait.php' => 1,
'hookmanagerinterface.php' => 1,
'hookmanager.php' => 1,
'hookcontainer.php' => 1,
'chain.php' => 1,
'widgetmanagerinterface.php' => 1,
'widgetfactoryinterface.php' => 1,
'groupinterface.php' => 1,
'dynamicgroup.php' => 1,
'imageswidget.php' => 1,
'migrationmanagerinterface.php' => 1,
'imagewidget.php' => 1,
'imageproperty.php' => 1,
'entityforminterface.php' => 1,
'entityform.php' => 1,
'entityfieldsolverinterface.php' => 1,
'entityfieldsolver.php' => 1,
'relationsbehavior.php' => 1,
'persistencebehavior.php' => 1,
'manycollection.php' => 1,
'entityexceptioninterface.php' => 1,
'swiftmessage.php' => 1,
'swiftemail.php' => 1,
'dbmigration.php' => 1,
'collectionorm.php' => 1,
'psrexception.php' => 1,
'testbuilder.php' => 1,
'wkebayapi.php' => 1,
'wkdhlapibundle.php' => 1,
'wkbasebundle.php' => 1,
'wkamazonmwsapi.php' => 1,
'wkafterbuyapibundle.php' => 1,
'validatorfactoryinterface.php' => 1,
'validatorfactory.php' => 1,
'rulesregistryinterface.php' => 1,
'rulesregistry.php' => 1,
'inputbag.php' => 1,
'testsgenerator.php' => 1,
'testbuilderinterface.php' => 1,
'results.php' => 1,
'collectionormfactory.php' => 1,
'curlconverter.php' => 1,
'viewabletrait.php' => 1,
'templateenginefactoryinterface.php' => 1,
'sqlpropertytransformerinterface.php' => 1,
'polymorphiccollectionorm.php' => 1,
'ormmigrations.php' => 1,
'orminterface.php' => 1,
'ormfactoryinterface.php' => 1,
'ormfactory.php' => 1,
'ormbehavior.php' => 1,
'entityrelation.php' => 1,
'collectionorminterface.php' => 1,
'collectionormfactoryinterface.php' => 1,
'fakeemail.php' => 1,
'sqlite_functions.php' => 1,
'wkgooglespreadsheetbundle.php' => 1,
'phpunit.example.xml' => 1,
'paramscodecbundle.php' => 1,
'artseldopeninviterbundle.php' => 1,
'asfwebsitebundle.php' => 1,
'asfuserbundle.php' => 1,
'asfschedulerbundle.php' => 1,
'asfproductbundle.php' => 1,
'asfdocumentbundle.php' => 1,
'asfcontactbundle.php' => 1,
'asfblogbundle.php' => 1,
'asfbackendbundle.php' => 1,
'artprimajsendbundle.php' => 1,
'artprimaformsextrabundle.php' => 1,
'konektsyliussyncbundle.php' => 1,
'dateconverterbundle.php' => 1,
'studio' => 1,
'moocsybundle.php' => 1,
'flashersbundle.php' => 1,
'artesanusevents.php' => 1,
'artesanusbundle.php' => 1,
'aclbundle.php' => 1,
'states.php' => 1,
'sasshandler.php' => 1,
'extendedscssc.php' => 1,
'elivejournal.php' => 1,
'badsignatureexception.php' => 1,
'php-ext-checker' => 1,
'linode.png' => 1,
'documentorbundle.php' => 1,
'eassy.php' => 1,
'schematable.php' => 1,
'publishbehavior.php' => 1,
'schemainterface.php' => 1,
'dbinterface.php' => 1,
'bundleloader.php' => 1,
'bundleinstallerplugin.php' => 1,
'bundleinstaller.php' => 1,
'paginatorfactoryinterface.php' => 1,
'paginatorfactory.php' => 1,
'datetimeinterface.php' => 1,
'baginterface.php' => 1,
'nullcache.php' => 1,
'timestampsbehavior.php' => 1,
'slugifybehavior.php' => 1,
'metasbehavior.php' => 1,
'settings.json-dist' => 1,
'notauthenticatedexception.php' => 1,
'monofont.ttf' => 1,
'bitpaypayments.php' => 1,
'modelcsv' => 1,
'as3modlrbundle.php' => 1,
'arzzzencmsbundle.php' => 1,
'cana' => 1,
'macaddrvalidator.php' => 1,
'htmlutils.php' => 1,
'dateutils.php' => 1,
'arturdoruchpaginatorbundle.php' => 1,
'requesthandler.php' => 1,
'arturdoruchflashmessagebundle.php' => 1,
'wkemarsysapi.php' => 1,
'wkguzzlecommandclient.php' => 1,
'test-phantom.sh' => 1,
'wordpress-custom-fields-permalink-plugin.php' => 1,
'devicedetectorbundle.php' => 1,
'wrapperimperaviredactorpluginasset.php' => 1,
'referenceimperaviredactorpluginasset.php' => 1,
'pdfimperaviredactorpluginasset.php' => 1,
'blueimperaviredactorpluginasset.php' => 1,
'psqgridview.php' => 1,
'testbench' => 1,
'make.utilities.inc' => 1,
'about' => 1,
'atoumatoumbundle.php' => 1,
'atl15googleanalyticsbundle.php' => 1,
'atolye15slackexceptionbundle.php' => 1,
'twigextension' => 1,
'siteplatformbundle.php' => 1,
'.devtools' => 1,
'demo-builder.php' => 1,
'demo-builder-lib.php' => 1,
'config.markdown.php' => 1,
'localize.class.php' => 1,
'entityhintefqexception.php' => 1,
'entityhintefq.php' => 1,
'at_base.module' => 1,
'at_base.missing.inc' => 1,
'at_base.make' => 1,
'at_base.install' => 1,
'at_base.info' => 1,
'at_base.hooks.inc' => 1,
'semaphoresmsbundle.php' => 1,
'siteutilitybundle.php' => 1,
'at_base.drush.inc' => 1,
'example_ccform.php' => 1,
'activefield - copy.php' => 1,
'rangecomparevalidatorasset.php' => 1,
'rangecomparevalidator.php' => 1,
'intltelinputvalidator.php' => 1,
'intltelinput.php' => 1,
'datetimerangecomparevalidatorasset.php' => 1,
'datetimerangecomparevalidator.php' => 1,
'runtest' => 1,
'receiver.php' => 1,
'codes.php' => 1,
'xinjiaspainvalidatorbundle.php' => 1,
'avegaochartjsbundle.php' => 1,
'avanzutransformerbundle.php' => 1,
'readme-forms' => 1,
'avanzudoctrineprefixbundle.php' => 1,
'avanzuprofilebundle.php' => 1,
'avanzujsonrequestbundle.php' => 1,
'avanzuadminthemebundle.php' => 1,
'endpoints.json.default' => 1,
'avangatejsonrpcclient.php' => 1,
'sapphp.xml' => 1,
'ddl-postgresql.sql' => 1,
'dist.sql' => 1,
'authy.php' => 1,
'readme-response' => 1,
'readme-request' => 1,
'readme-helpers' => 1,
'at_base.hack.inc' => 1,
'test_active_record_class.sql' => 1,
'wkicecatapi.php' => 1,
'natika' => 1,
'selectortest.php' => 1,
'optionstest.php' => 1,
'license - copy' => 1,
'domtest.php' => 1,
'contenttest.php' => 1,
'collectiontest.php' => 1,
'andreaspregabreadcrumbbundle.php' => 1,
'asposecloudbundle.php' => 1,
'wp-deblogify.php' => 1,
'wp-ip.php' => 1,
'style.phtml' => 1,
'assymfonydiextends.php' => 1,
'angularjqasset.php' => 1,
'index-01.php' => 1,
'sideuser.php' => 1,
'ioniconasset.php' => 1,
'icheckasset.php' => 1,
'adminlteskinasset.php' => 1,
'translituk.php' => 1,
'translitka.php' => 1,
'translitbe.php' => 1,
'translitascii.php' => 1,
'wkversionbundle.php' => 1,
'wkshopifyapi.php' => 1,
'wkschutzklickapi.php' => 1,
'wkklarnaapibundle.php' => 1,
'wkimageserviceclient.php' => 1,
'staticdomtest.php' => 1,
'assetcontroller.php' => 1,
'example-set.php' => 1,
'astinamoneybundle.php' => 1,
'example-hook.php' => 1,
'example-getupdatescli.php' => 1,
'doctrineloggerbundle.php' => 1,
'config.inc.sample.php' => 1,
'astinatranslationbundle.php' => 1,
'astinatradedoublerbundle.php' => 1,
'astinasolvencybundle.php' => 1,
'astinasociallinksbundle.php' => 1,
'astinaseobundle.php' => 1,
'astinaredirectmanagerbundle.php' => 1,
'astinaquillbundle.php' => 1,
'astinapaymentbundle.php' => 1,
'astinalabelsbundle.php' => 1,
'robotstxt.php' => 1,
'astinainjectionbundle.php' => 1,
'astinafotoliabundle.php' => 1,
'astinadomaineventsbundle.php' => 1,
'astinadeadlinkbundle.php' => 1,
'migratelibchart.php' => 1,
'phpunit_loader.php' => 1,
'laraeval-travis-build.sh' => 1,
'sysexits.php' => 1,
'sociallikes.php' => 1,
'socialassetjs.php' => 1,
'socialassetflat.php' => 1,
'socialassetclassic.php' => 1,
'socialassetbirman.php' => 1,
'nemiro.webforms.php.sln' => 1,
'nemiro.webforms.php.phpproj' => 1,
'usf-ca-chain.pem' => 1,
'wiakoweformbundle.php' => 1,
'woopra_tracker.php' => 1,
'wp-local-config-sample.php' => 1,
'wguniversaldatatablebundle.php' => 1,
'argumentscheck.php' => 1,
'cli_daemon' => 1,
'wildphp.php' => 1,
'main.modules' => 1,
'config.example.neon' => 1,
'easyrdf.php' => 1,
'pubsubhubbubsubscriber.php' => 1,
'pubsubhubbubsubscriber.i18n.php' => 1,
'wiakowemandrillbundle.php' => 1,
'wiakowebreadcrumbbundle.php' => 1,
'project.ruleset.xml.example' => 1,
'wiakowedoctrinetableprefixbundle.php' => 1,
'wihocaptchabundle.php' => 1,
'rafie.php' => 1,
'configuration.ini-dist' => 1,
'white.php' => 1,
'backpack' => 1,
'weysandoctrineimgbundle.php' => 1,
'werkspotstatsdbundle.php' => 1,
'werkspotsitemapbundle.php' => 1,
'werkintmemcachedbundle.php' => 1,
'wellcommercewishlistbundle.php' => 1,
'wellcommerceunitbundle.php' => 1,
'wordpoints.php' => 1,
'getclientip.php' => 1,
'wellcommercetaxbundle.php' => 1,
'asynccurler.php' => 1,
'composerrunner.php' => 1,
'xtainunitconverterbundle.php' => 1,
'readme_google' => 1,
'googledriveexample.php' => 1,
'x4dsbadmin2bundle.php' => 1,
'travis-event-loops.sh' => 1,
'repository-template-compare.yml' => 1,
'phunin-node.yml' => 1,
'phunin-node' => 1,
'htmlscraper.php' => 1,
'consumessitemap.php' => 1,
'curler_license' => 1,
'jquerypostcodeswidget.php' => 1,
'unescapeplugin.php' => 1,
'jquerypostcodesasset.php' => 1,
'ordermodelcolumn.php' => 1,
'ordermodelaction.php' => 1,
'orderbehavior.php' => 1,
'wsdltophp.yml.dist' => 1,
'cases' => 1,
'wgopeniduserbundle.php' => 1,
'ciscosystemsauditbundle.php' => 1,
'fred.php' => 1,
'decres.php' => 1,
'decres.bat' => 1,
'virtualbundle.php' => 1,
'appfocusedkernel.php' => 1,
'wellcommercethemebundle.php' => 1,
'wellcommerceshopbundle.php' => 1,
'kinit.php' => 1,
'wsgeneratorbundle.php' => 1,
'breadcrumbitemcollection.php' => 1,
'breadcrumbitem.php' => 1,
'wellcommerceavailabilitybundle.php' => 1,
'wellcommerceattributebundle.php' => 1,
'wellcommerceappbundle.php' => 1,
'wellcommerceapibundle.php' => 1,
'wellcommerceadminbundle.php' => 1,
'commonmodel.php' => 1,
'weidealdocbundle.php' => 1,
'aldocexception.php' => 1,
'aldoc.php' => 1,
'wsjsformvalidatorbundle.php' => 1,
'wsformbundle.php' => 1,
'breadcrumbiteminterface.php' => 1,
'wsexceptionsbundle.php' => 1,
'nonsensebundle.php' => 1,
'doctrinefixturesgeneratorbundle.php' => 1,
'font.html' => 1,
'webmakerssettingbundle.php' => 1,
'shoppingcartcomponent.php' => 1,
'cartvoucherinterface.php' => 1,
'cartofferinterface.php' => 1,
'rightsmodule.php' => 1,
'.hg_archival' => 1,
'twitteroauthuser.php' => 1,
'twitteroauthloader.php' => 1,
'templateenginetrait.php' => 1,
'breadcrumbitemcollectioninterface.php' => 1,
'wellcommercecartbundle.php' => 1,
'wellcommerceshippingbundle.php' => 1,
'wellcommercemediabundle.php' => 1,
'wellcommercesearchbundle.php' => 1,
'wellcommerceroutingbundle.php' => 1,
'wellcommercereviewbundle.php' => 1,
'wellcommercereportbundle.php' => 1,
'wellcommerceproductstatusbundle.php' => 1,
'wellcommerceproductbundle.php' => 1,
'wellcommerceproducerbundle.php' => 1,
'wellcommercepaymentbundle.php' => 1,
'wellcommercepagebundle.php' => 1,
'wellcommerceorderbundle.php' => 1,
'wellcommerceoauthbundle.php' => 1,
'wellcommercenewsbundle.php' => 1,
'wellcommercelocalebundle.php' => 1,
'wellcommercecategorybundle.php' => 1,
'wellcommercelayoutbundle.php' => 1,
'wellcommercelayerednavigationbundle.php' => 1,
'wellcommercedoctrinebundle.php' => 1,
'wellcommercedistributionbundle.php' => 1,
'wellcommercedictionarybundle.php' => 1,
'wellcommercedelivererbundle.php' => 1,
'wellcommercecurrencybundle.php' => 1,
'wellcommercecouponbundle.php' => 1,
'wellcommercecountrybundle.php' => 1,
'wellcommercecorebundle.php' => 1,
'wellcommercecontactbundle.php' => 1,
'wellcommercecompanybundle.php' => 1,
'wellcommerceclientbundle.php' => 1,
'xvenginesymfonybridgebundle.php' => 1,
'testauth.php' => 1,
'templateengineexception.php' => 1,
'yadminbundle.php' => 1,
'youwefilemanagerbundle.php' => 1,
'ysapiparameters.ini.dist' => 1,
'uploadablebundle.php' => 1,
'tokenauthenticationbundle.php' => 1,
'ysettingsbundle.php' => 1,
'youshidosecurityuserbundle.php' => 1,
'ymessagesbundle.php' => 1,
'youshidoencryptionbundle.php' => 1,
'youshidodoctrineextensionbundle.php' => 1,
'ycmsbundle.php' => 1,
'youshidoblogbundle.php' => 1,
'apiimagesbundle.php' => 1,
'yotpo.phar' => 1,
'wannaspeakbundle.php' => 1,
'yosimitsoworkingforumbundle.php' => 1,
'test-sniff-doc.sh' => 1,
'nexmoverify.php' => 1,
'i18n-module.php' => 1,
'class-api-libs.php' => 1,
'class-api-google.php' => 1,
'class-api-google-client.php' => 1,
'class-update-manager.php' => 1,
'class-theme-update-manager.php' => 1,
'class-theme-license-manager.php' => 1,
'class-product.php' => 1,
'class-plugin-update-manager.php' => 1,
'youwefilemanagerevents.php' => 1,
'responsefilter.php' => 1,
'class-license-manager.php' => 1,
'images.php' => 1,
'zensideckeditorbundle.php' => 1,
'plugin.yaml' => 1,
'pusherplugin.php' => 1,
'pushereventpusher.php' => 1,
'notormtracypanel.php' => 1,
'srusearch.php' => 1,
'zeichen32gitlabapibundle.php' => 1,
'zeeroutelistbundle.php' => 1,
'zeemobiledetectservicebundle.php' => 1,
'zeecapifonydeployinfobundle.php' => 1,
'punit_bootstrap.php.dist.php' => 1,
'woocommerce.php' => 1,
'header-searchform.php' => 1,
'yllyassetdependencybundle.php' => 1,
'readme-pt_pt' => 1,
'simple-phpexcel-reader.iml' => 1,
'composer-setup.php' => 1,
'wp_scan.yml.dist' => 1,
'travis.config.sh' => 1,
'yammerbundle.php' => 1,
'targetprocessbundle.php' => 1,
'vdm.raml' => 1,
'diagram_school_persons_simple.png' => 1,
'diagram_school_persons.png' => 1,
'diagram_school_curriculum_simple.png' => 1,
'diagram_school_curriculum.png' => 1,
'blurb' => 1,
'class-plugin-license-manager.php' => 1,
'class-api-request.php' => 1,
'cakephp3features' => 1,
'xidearestbundle.php' => 1,
'abimusfetchbundle.php' => 1,
'globaldebug.php' => 1,
'phpxiphehtml.sublime-snippet' => 1,
'_html.php' => 1,
'marker_shadow.png' => 1,
'gmapsmarker.php' => 1,
'xideauserbundle.php' => 1,
'xideaurlbundle.php' => 1,
'xideatwitterbootstrapbundle.php' => 1,
'xideatemplatebundle.php' => 1,
'xideastuffbundle.php' => 1,
'xideastatusbundle.php' => 1,
'xideaproductbundle.php' => 1,
'controllerrouter.php' => 1,
'productevents.php' => 1,
'xideaprioritybundle.php' => 1,
'xideanotificationbundle.php' => 1,
'xideajquerybundle.php' => 1,
'xideadataflowbundle.php' => 1,
'xideacommentbundle.php' => 1,
'commentevents.php' => 1,
'xideacategorybundle.php' => 1,
'xideabookbundle.php' => 1,
'bookevents.php' => 1,
'xideabasebundle.php' => 1,
'dataflowinterface.php' => 1,
'abstractdataflow.php' => 1,
'dps-pxpay.php' => 1,
'interfacerouter.php' => 1,
'.gitigore' => 1,
'importfilewidget.php' => 1,
'phpdoccrontab.php' => 1,
'leftright.php' => 1,
'ydleuserbundle.php' => 1,
'ydlesettingsbundle.php' => 1,
'ydleroombundle.php' => 1,
'ydlenodesbundle.php' => 1,
'ydlelogsbundle.php' => 1,
'ydlehubbundle.php' => 1,
'ydlecorebundle.php' => 1,
'ydleapibundle.php' => 1,
'fablabmanagerbundle.php' => 1,
'importlogwidget.php' => 1,
'importbehavior.php' => 1,
'interfaceviewloader.php' => 1,
'github-checker.php' => 1,
'tablerow.php' => 1,
'yourls-loader.php' => 1,
'yourls-infos.php' => 1,
'yourls-go.php' => 1,
'yourls-api.php' => 1,
'sample-robots' => 1,
'sample-remote-api-call' => 1,
'sample-public-front-page' => 1,
'sample-public-api' => 1,
'gom.php' => 1,
'viewloader.php' => 1,
'onesapp.php' => 1,
'templateengineloader.php' => 1,
'storagetrait.php' => 1,
'zensidesonataimagebundle.php' => 1,
'vesaxrestclientbundle.php' => 1,
'siduseavbootstrapbundle.php' => 1,
'sidusdatagridbundle.php' => 1,
'sidusadminbundle.php' => 1,
'vbeesettingbundle.php' => 1,
'realwork' => 1,
'barcodegeneratorassets.php' => 1,
'barcodegenerator.php' => 1,
'alkwebbundle.php' => 1,
'organizer.js' => 1,
'bisect' => 1,
'plugins.sql' => 1,
'vesaxseobundle.php' => 1,
'vesaxrelationbundle.php' => 1,
'siduseavfilterbundle.php' => 1,
'maintenance_handler.php' => 1,
'vesaxmaintenancebundle.php' => 1,
'vesaxhttpkernelloggerbundle.php' => 1,
'vesaxguzzlebundle.php' => 1,
'vesaxfavoritebundle.php' => 1,
'favoritemanager.php' => 1,
'vesaxajaxcrossdomainsessionbundle.php' => 1,
'vesaxadminextrabundle.php' => 1,
'prepare' => 1,
'static.json' => 1,
'velvelreportbundle.php' => 1,
'search_api_elasticsearch.views.inc' => 1,
'siduseavdatagridbundle.php' => 1,
'siduseavmodelbundle.php' => 1,
'search_api_elasticsearch.install' => 1,
'ebootstrapalert.php' => 1,
'ebootstraplistview.php' => 1,
'ebootstraplinkpager.php' => 1,
'ebootstraphero.php' => 1,
'ebootstrapgridview.php' => 1,
'ebootstrapflashmessages.php' => 1,
'ebootstrapdetailview.php' => 1,
'ebootstrapcollapse.php' => 1,
'ebootstrapcode.php' => 1,
'ebootstrapcarousel.php' => 1,
'ebootstrapbuttoncolumn.php' => 1,
'ebootstrapbutton.php' => 1,
'ebootstrapbreadcrumbs.php' => 1,
'ebootstrapactiveform.php' => 1,
'siduseavvariantbundle.php' => 1,
'ebootstrap.php' => 1,
'visithor.yml.dist' => 1,
'visithorbundle.php' => 1,
'vlibtemplate.php' => 1,
'vlibini.php' => 1,
'vlibdate.php' => 1,
'virmytuserrefererbundle.php' => 1,
'auth.todo' => 1,
'oauth' => 1,
'siduspublishingbundle.php' => 1,
'sidusfilterbundle.php' => 1,
'sidusfileuploadbundle.php' => 1,
'sidusencryptionbundle.php' => 1,
'search_api_elasticsearch.module' => 1,
'search_api_elasticsearch.info' => 1,
'ebootstrapmodal.php' => 1,
'unialteritagbundle.php' => 1,
'useradapted.js' => 1,
'ads.js' => 1,
'leafletsearchasset.php' => 1,
'leafletsearch.php' => 1,
'sk_lib_i.php' => 1,
'phphypher.php' => 1,
'wp-php-console.php' => 1,
'moneytest.php' => 1,
'sample-data.json' => 1,
'mesh.php' => 1,
'databasetable.php' => 1,
'uniquelibsemberdataserializerbundle.php' => 1,
'cmediatagbundle.php' => 1,
'lib-doc.html' => 1,
'fixturegenerator.php' => 1,
'undeletelikesbundle.php' => 1,
'undeletebtceapibundle.php' => 1,
'patches.png' => 1,
'viewtwigextension.php' => 1,
'twigtemplateengine.php' => 1,
'templatingtwigextension.php' => 1,
'tmonologaware.php' => 1,
'dendecommonbundle.php' => 1,
'release-clone.php' => 1,
'get-phing.sh' => 1,
'classgenerator.php' => 1,
'readme-release' => 1,
'example_builder.php' => 1,
'objrefexamplebundle.php' => 1,
'opcache.module' => 1,
'symfonycommand.php' => 1,
'opcache.install' => 1,
'opcache.info' => 1,
'opcache.drush.inc' => 1,
'opcache.admin.inc' => 1,
'commerce_taxcloud.rules.inc' => 1,
'commerce_taxcloud.module' => 1,
'commerce_taxcloud.install' => 1,
'commerce_taxcloud.info' => 1,
'commerce_taxcloud.api.php' => 1,
'commerce_taxcloud.admin.inc' => 1,
'veganmenubundle.php' => 1,
'dunitconfig.example' => 1,
'vardiususerbundle.php' => 1,
'objrefremotebundle.php' => 1,
'vardiussecuritybundle.php' => 1,
'vardiusmenubundle.php' => 1,
'vardiusinvoicebundle.php' => 1,
'vardiusadminbundle.php' => 1,
'valondeeglebundle.php' => 1,
'valantirforumbundle.php' => 1,
'ajaxenginebundle.php' => 1,
'vvssecuritybundle.php' => 1,
'exttest.php' => 1,
'taxcloud.wsdl' => 1,
'project-readme' => 1,
'vlabsamazonmwsbundle.php' => 1,
'mwsclient.php' => 1,
'ebootstraplistviewitem.php' => 1,
'ebootstrapmodaltrigger.php' => 1,
'storageexception.php' => 1,
'cachestorage.php' => 1,
'httptrait.php' => 1,
'eventprocessor.php' => 1,
'eventmanagerexception.php' => 1,
'entitypool.php' => 1,
'entitydataextractor.php' => 1,
'entitycollection.php' => 1,
'entityattributebuilder.php' => 1,
'entityabstract.php' => 1,
'crypttrait.php' => 1,
'cryptexception.php' => 1,
'configtrait.php' => 1,
'configobject.php' => 1,
'bootstrapexception.php' => 1,
'imagetrait.php' => 1,
'sampleconfig.yaml' => 1,
'annotationstrait.php' => 1,
'webilityentityresourcebundle.php' => 1,
'resourcebundletrait.php' => 1,
'invite.php' => 1,
'webultdpayupaymentbundle.php' => 1,
'rubedo.sh' => 1,
'rubedo.bat' => 1,
'mongo.ini' => 1,
'composer.front.json' => 1,
'composer.extensions.json.dist' => 1,
'example-field-setup.php' => 1,
'cmb2-attached-posts-field.php' => 1,
'imageloader.php' => 1,
'loggertrait.php' => 1,
'wds-wp-rest-api-connect.php' => 1,
'securitytrait.php' => 1,
'storageevent.php' => 1,
'validatortrait.php' => 1,
'stdobjecttrait.php' => 1,
'stdlibtrait.php' => 1,
'factoryloadertrait.php' => 1,
'servicescope.php' => 1,
'servicemanagertrait.php' => 1,
'servicemanagerexception.php' => 1,
'servicecreator.php' => 1,
'serviceconfig.php' => 1,
'factoryargument.php' => 1,
'configcompiler.php' => 1,
'routertrait.php' => 1,
'mailerexception.php' => 1,
'resttrait.php' => 1,
'resterrorexception.php' => 1,
'serverabstract.php' => 1,
'oauth2user.php' => 1,
'oauth2request.php' => 1,
'oauth2loader.php' => 1,
'oauth2exception.php' => 1,
'mongotrait.php' => 1,
'mongoresult.php' => 1,
'mongointerface.php' => 1,
'mongoexception.php' => 1,
'mongocollection.php' => 1,
'mailertrait.php' => 1,
'attached-posts-field.png' => 1,
'wds-customizer-css.php' => 1,
'ebootstrapnavigation.php' => 1,
'scu_sort_available.php' => 1,
'volleyballfixturesbundle.php' => 1,
'volleyballfacilitybundle.php' => 1,
'volleyballenrollmentbundle.php' => 1,
'volleyballcoursebundle.php' => 1,
'vxipfieldtypebundle.php' => 1,
'vitrephpconsolebundle.php' => 1,
'limitrule.php' => 1,
'xml_parse.php' => 1,
'viewed_product.php' => 1,
'sort_scu.php' => 1,
'sestrenskyihlclass.php' => 1,
'sestrenskyiclass.php' => 1,
'script_check_comment.js' => 1,
'volleyballpasselbundle.php' => 1,
'js_examples.js' => 1,
'git_commands' => 1,
'createsmartfilterseoxml.php' => 1,
'bitrix_server_test.php' => 1,
'hl.php' => 1,
'angulartimeagoasset.php' => 1,
'ebootstrapwidget.php' => 1,
'ebootstraptabwrapper.php' => 1,
'ebootstraptabnavigation.php' => 1,
'ebootstraptabcontentwrapper.php' => 1,
'ebootstraptabcontent.php' => 1,
'ebootstrapsidebar.php' => 1,
'ebootstrapprogressbar.php' => 1,
'volleyballorganizationbundle.php' => 1,
'volleyballreportbundle.php' => 1,
'cmb2-user-select.php' => 1,
'wecodepixelspremailerbundle.php' => 1,
'post-search-field.png' => 1,
'post-search-dialog.png' => 1,
'cmb2_post_search_field.php' => 1,
'to_php_54.php' => 1,
'webconsulebayapibundle.php' => 1,
'createdoc.sh' => 1,
'console.neon' => 1,
'parameter.sql' => 1,
'create.jar' => 1,
'downloadandcompilelua.sh' => 1,
'testpush.php' => 1,
'weavingthewebframeworkextrabundle.php' => 1,
'premailer.php' => 1,
'volleyballuserbundle.php' => 1,
'silla' => 1,
'warrantylifeapiexamplebundle.php' => 1,
'sample-sender.php' => 1,
'sample-receiver.php' => 1,
'wuild.php' => 1,
'stubs.sqlite' => 1,
'stubs-generator.php' => 1,
'sliderrevolution.php' => 1,
'magnify-core.php' => 1,
'basic-auth.php' => 1,
'wdueditor.php' => 1,
'tweetarticlesbundle.php' => 1,
'projectpunchclockcorebundle.php' => 1,
'zensidecorebundle.php' => 1,
'cli-commands.png' => 1,
'directivetype.php' => 1,
'jobs.php' => 1,
'httpmessagesnewrelicmiddlewareplugin.php' => 1,
'httpmessagesfractalmiddlewareplugin.php' => 1,
'httpmessagescommercemiddlewareplugin.php' => 1,
'httpmessagescachemiddlewareplugin.php' => 1,
'httpmessagesplugin.php' => 1,
'helloworld.php~' => 1,
'related3.png' => 1,
'related2.png' => 1,
'related1.png' => 1,
'iveecoreinit.php' => 1,
'view.html' => 1,
'aimeosshopbundle.php' => 1,
'vkbundle.php' => 1,
'httpmessagesvalidationmiddlewareplugin.php' => 1,
'vkapihelperbundle.php' => 1,
'okbundle.php' => 1,
'ailovefacebookbundle.php' => 1,
'ailoveckeditorbundle.php' => 1,
'abstractsocialbundle.php' => 1,
'phpcs-validate.sh' => 1,
'tinymcepluginasset.php' => 1,
'pianosoloweatherbundle.php' => 1,
'fontawesome-markers.min.js' => 1,
'fontawesome-markers.json' => 1,
'helloworldwidget.php' => 1,
'slideshowpluginbundle.php' => 1,
'httpmessagesrestmiddlewareplugin.php' => 1,
'aivusresizerbundle.php' => 1,
'ahspushnotificationspluginbundle.php' => 1,
'asana-oauth.php' => 1,
'pimenterpriseclassificationrulebundle.php' => 1,
'tests.cmd' => 1,
'.cocomoignore' => 1,
'zehir.php' => 1,
'tokenfieldasset.php' => 1,
'tokenfield.php' => 1,
'jqueryuiasset.php' => 1,
'ajstudionestedsetbundle.php' => 1,
'ajstudioinflectbundle.php' => 1,
'ajstudiocentralbankbundle.php' => 1,
'mongosearchbundle.php' => 1,
'datafaker.sql' => 1,
'ajglvalidatoresbundle.php' => 1,
'gulpbusterbundle.php' => 1,
'nievalidator.php' => 1,
'dnivalidator.php' => 1,
'cifvalidator.php' => 1,
'checksumvalidator.php' => 1,
'cccvalidator.php' => 1,
'ajgltwigextensionsbundle.php' => 1,
'ajgljqgridbundle.php' => 1,
'ajgljqueryuibundle.php' => 1,
'ajgljquerybundle.php' => 1,
'ajglh5bpbundle.php' => 1,
'ajglcpmbundle.php' => 1,
'transformation_trait_docs.html' => 1,
'paymentgatewaybundle.php' => 1,
'newscoopslideshowpluginbundle.php' => 1,
'ahspersonabundle.php' => 1,
'pimdirecttomongodbbundle.php' => 1,
'lti_tool_provider.php' => 1,
'testphpconfig.ini' => 1,
'aegisjwtauthenticationbundle.php' => 1,
'license-manager' => 1,
'stundenplan' => 1,
'portfolio.php' => 1,
'pamm.php' => 1,
'active.php' => 1,
'advancingustripesubscriptionbundle.php' => 1,
'lti-tables-oracle.sql' => 1,
'lti-tables-oracle-pdo.sql' => 1,
'lti-tables-mysql.sql' => 1,
'lti-tables-mssql.sql' => 1,
'lti_data_connector_pdo.php' => 1,
'madalynnplumbundle.php' => 1,
'lti_data_connector_oci.php' => 1,
'lti_data_connector_none.php' => 1,
'lti_data_connector_mysqli.php' => 1,
'lti_data_connector_mysql.php' => 1,
'retrieval.php' => 1,
'adticketmediabackendimagehostingbundle.php' => 1,
'adticketgeonamesbundle.php' => 1,
'adrotecwebapibundle.php' => 1,
'leyertranslationadditionbundle.php' => 1,
'abanalyzer' => 1,
'silexbundle.php' => 1,
'aboauth2facebookgrantbundle.php' => 1,
'aotranslationbundle.php' => 1,
'aequasimemcachedbundle.php' => 1,
'plum.php' => 1,
'ahsweatherpluginbundle.php' => 1,
'agentsibcrontabbundle.php' => 1,
'ahsbelferpluginbundle.php' => 1,
'platform-util' => 1,
'openpayu_php' => 1,
'first.php' => 1,
'sharkformloggerbundle.php' => 1,
'agitprofilebundle.php' => 1,
'agitpagebundle.php' => 1,
'agitcronbundle.php' => 1,
'agitapibundle.php' => 1,
'agitadminbundle.php' => 1,
'agentsibsphinxbundle.php' => 1,
'jsonrpcbundle.php' => 1,
'agazzirestclientauthenticatorbundle.php' => 1,
'codeigniterinstallerplugin.php' => 1,
'grunthashassetsbundle.php' => 1,
'wpasseticbootstrap.php' => 1,
'test_hardened.sh' => 1,
'phpunit.hardened.xml' => 1,
'afrihostbasecommandbundle.php' => 1,
'github-updater.php' => 1,
'routertest.php' => 1,
'gatewaymodule.php' => 1,
'ferrandinixhprofbundle.php' => 1,
'ferrandinipdosessionbundle.php' => 1,
'ferrandinidisablebundle.php' => 1,
'gpl-v.2.0' => 1,
'custominstaller.php' => 1,
'pimdevtoolboxbundle.php' => 1,
'pimenhancedconnectorbundle.php' => 1,
'subsiteadminextension.php' => 1,
'vector.php' => 1,
'afmasseticamazons3bundle.php' => 1,
'module.zpm' => 1,
'mailmaster.php' => 1,
'historizer.php' => 1,
'schema-oracle.sql' => 1,
'clickatellhttp.php' => 1,
'ahistorizer.php' => 1,
'alazjjsimplebootstrapbundle.php' => 1,
'horus.php' => 1,
'html-index.png' => 1,
'science.php' => 1,
'vectorinterface.php' => 1,
'length.php' => 1,
'sitestatuscheckerbundle.php' => 1,
'encrypterinterface.php' => 1,
'decrypterinterface.php' => 1,
'alamedadoctrineextensionsbundle.php' => 1,
'dateinterval.php' => 1,
'bomifier.php' => 1,
'alk13bomifierbundle.php' => 1,
'const.php' => 1,
'quicks' => 1,
'extended_parse_url' => 1,
'bank.php' => 1,
'git_pull_example.sh' => 1,
'loft_data_grids.info' => 1,
'kit_php.info' => 1,
'jpnforphpbundle.php' => 1,
'afmtranslatableroutepathbundle.php' => 1,
'user.mail.tpl' => 1,
'generate-soap' => 1,
'tdbclient.php' => 1,
'pgstmt.php' => 1,
'pgexception.php' => 1,
'nemiro.data.php.sln' => 1,
'nemiro.data.php.phpproj' => 1,
'idbclient.php' => 1,
'dbparametertype.php' => 1,
'dbparametercollection.php' => 1,
'dbparameter.php' => 1,
'connectionmode.php' => 1,
'excel-column-iterator.php' => 1,
'rurupay.config-dist.php' => 1,
'hi.php' => 1,
'.gitginore' => 1,
'authsubscriber.php' => 1,
'iso3166test.php' => 1,
'iso3166.php' => 1,
'exiftool.exe' => 1,
'emailhelper.php' => 1,
'onpath.php' => 1,
'alcalynpayplugbundle.php' => 1,
'jsvars.php' => 1,
'alcalynflushonkernelterminatebundle.php' => 1,
'casuser.php' => 1,
'casinterface.php' => 1,
'experientbundle.php' => 1,
'tltanerpvbundle.php' => 1,
'user.tpl' => 1,
'user.layer.json' => 1,
'changelog-1.6' => 1,
'showcontacts.js' => 1,
'noimg.jpg' => 1,
'noimage.psd' => 1,
'noimage.png' => 1,
'mark.psd' => 1,
'manual.mht' => 1,
'manual.docx' => 1,
'imager.php' => 1,
'imager.inc.php' => 1,
'empty.png' => 1,
'.mark.png' => 1,
'xlsx.php' => 1,
'mht.php' => 1,
'contacts.tpl' => 1,
'infrajs.php' => 1,
'contacts.layer.json' => 1,
'contacts.css' => 1,
'cont.php' => 1,
'cont.mail.tpl' => 1,
'builddocsontravis.sh' => 1,
'akeneomeasurebundle.php' => 1,
'pimmagentoconnectorbundle.php' => 1,
'pimicecatdemobundle.php' => 1,
'pimdeltaexportbundle.php' => 1,
'pimconnectormappingbundle.php' => 1,
'akeneobatchbundle.php' => 1,
'demoextensionbundle.php' => 1,
'pimexcelconnectorbundle.php' => 1,
'.test.js' => 1,
'infrajs.js' => 1,
'user.js' => 1,
'metrika.tpl' => 1,
'sentemail.php' => 1,
'sitemap.tpl' => 1,
'seo.tpl' => 1,
'seo.layer.js' => 1,
'seo.js' => 1,
'seo.inc.php' => 1,
'seo.ext.js' => 1,
'rss.tpl' => 1,
'pages.css' => 1,
'mht.json' => 1,
'rambler.tpl' => 1,
'rambler.layer.js' => 1,
'metrika.layer.js' => 1,
'initjs.php' => 1,
'mail.layer.js' => 1,
'liveinternet.tpl' => 1,
'liveinternet.layer.js' => 1,
'counters.tpl' => 1,
'counters.layer.php' => 1,
'counters.layer.js' => 1,
'counters.json' => 1,
'analytics.tpl' => 1,
'analytics.layer.js' => 1,
'version.tpl' => 1,
'make.js' => 1,
'loader-red.gif' => 1,
'loader-green.gif' => 1,
'subsitemodelextension.php' => 1,
'adpapiuserinfo.class.php' => 1,
'zephyreditablebundle.php' => 1,
'osrssbundle.php' => 1,
'ably-loader.php' => 1,
'ably-common' => 1,
'kyelabundle.php' => 1,
'imagemagic.php' => 1,
'mail.blade.php' => 1,
'installermodule.php' => 1,
'coderefactorbundle.php' => 1,
'expandedcollectionbundle.php' => 1,
'ostoolsbundle.php' => 1,
'osormadapter.php' => 1,
'ossitemapbundle.php' => 1,
'rssgenerator.php' => 1,
'tcclass3-2011.pem' => 1,
'abcjobbundle.php' => 1,
'ospaymentbundle.php' => 1,
'openskysitemapbundle.php' => 1,
'osexcelbundle.php' => 1,
'oshookbundle.php' => 1,
'oscompanyreportsbundle.php' => 1,
'companyreports.php' => 1,
'instapush.class.php' => 1,
'maskedinputdatepicker.php' => 1,
'extendedhighcharts.php' => 1,
'formitemsfacade.php' => 1,
'slimsavant.php' => 1,
'savant.php' => 1,
'resolve_url.php' => 1,
'abcprocesscontrolbundle.php' => 1,
'wpenv.php' => 1,
'predefinedwordlistresourcehandle.php' => 1,
'wordlistnormalizerinterface.php' => 1,
'wordlistnormalizerawareproxytrait.php' => 1,
'wordlistnormalizerawareinterface.php' => 1,
'wordlistnormalizer.php' => 1,
'wordlistinterface.php' => 1,
'wordlistcomparatorinterface.php' => 1,
'wordlistcomparatorawareinterface.php' => 1,
'wordlistanalyzerinterface.php' => 1,
'wordlistanalyzerawareinterface.php' => 1,
'wordlist.php' => 1,
'sieveinterface.php' => 1,
'sieveawareinterface.php' => 1,
'overallsimilaritywordlistcomparator.php' => 1,
'abcresourcelockbundle.php' => 1,
'genericmatchertrait.php' => 1,
'fullcoveragewordlistcomparator.php' => 1,
'aggregatedsieveinterface.php' => 1,
'aggregatedmatcherinterface.php' => 1,
'aggregatedmatcher.php' => 1,
'example_config.xml' => 1,
'example-warning.ico' => 1,
'example-unknown.ico' => 1,
'example-ok.ico' => 1,
'example-critical.ico' => 1,
'doku.pdf' => 1,
'abcsequencebundle.php' => 1,
'abcschedulerbundle.php' => 1,
'grunt.js' => 1,
'.wpenv.example.yml' => 1,
'guidproviderawareinterface.php' => 1,
'cachecleanerbundle.php' => 1,
'zorbusgallerybundle.php' => 1,
'zorbusfaqbundle.php' => 1,
'zorbusdocumentbundle.php' => 1,
'zorbuscontactbundle.php' => 1,
'zorbusbannerbundle.php' => 1,
'zorbusarticlebundle.php' => 1,
'ircconnection.php' => 1,
'irceventlistener.php' => 1,
'template.class.php' => 1,
'ovhbundle.php' => 1,
'ovhapi.php' => 1,
'gatekeeperbundle.php' => 1,
'php-json-server' => 1,
'zorbuslinkbundle.php' => 1,
'ziiwebfrontendbundle.php' => 1,
'ziggeo.php' => 1,
'zzseotk.php' => 1,
'hreflang-canonical-image.jpg' => 1,
'zzcleanurls.php' => 1,
'formextrabundle.php' => 1,
'galleryimagemodel.php' => 1,
'synchronize-github-drupal.bat' => 1,
'media_mediahaven.module' => 1,
'media_mediahaven.info' => 1,
'media_mediahaven.css' => 1,
'zertzphotobundle.php' => 1,
'prepros.cfg' => 1,
'zorbusglossarybundle.php' => 1,
'zorbusmenubundle.php' => 1,
'wp-cli-updates-command.php' => 1,
'baconuserbundle.php' => 1,
'pl2x-remote-purge.php' => 1,
'page.gamma.php' => 1,
'page.epsilon.php' => 1,
'page.delta.php' => 1,
'page.beta.php' => 1,
'page.alpha.php' => 1,
'pagelines-developer.php' => 1,
'nag-squelcher.php' => 1,
'thumb.png' => 1,
'container.config.php' => 1,
'a2lixtranslationformbundle.php' => 1,
'a2lixi18ndoctrinebundle.php' => 1,
'bacontranslationformbundle.php' => 1,
'zorbusnewsletterbundle.php' => 1,
'baconrdstationbundle.php' => 1,
'baconmenubundle.php' => 1,
'baconlanguagebundle.php' => 1,
'bacongeneratorbundle.php' => 1,
'baconcorebundle.php' => 1,
'blinker_test.php' => 1,
'array-converter.php' => 1,
'zzvalidationextrabundle.php' => 1,
'zzcorebundle.php' => 1,
'zzchezzzortellbundle.php' => 1,
'zrgisanewrelicbundle.php' => 1,
'zorbustrafficbundle.php' => 1,
'zorbuspollbundle.php' => 1,
'guidprovider.php' => 1,
'guidproviderawaretrait.php' => 1,
'adpapiutility.class.php' => 1,
'acseobaserestbundle.php' => 1,
'alswaggeruibundle.php' => 1,
'example-self-hosted.php' => 1,
'example-cloud.php' => 1,
'activdevnoclinebundle.php' => 1,
'xmlrpcs.inc.php' => 1,
'xmlrpc_wrappers.inc' => 1,
'xmlrpc.inc.php' => 1,
'acseosqlserverbundle.php' => 1,
'acseographicbundle.php' => 1,
'acseofastshowgeneratorbundle.php' => 1,
'acseodynamicformbundle.php' => 1,
'acseochangepasswordbundle.php' => 1,
'php-fmt.sh' => 1,
'quick-start' => 1,
'derivedkey.php' => 1,
'acquiasearchservice.php' => 1,
'acquiasearchclient.php' => 1,
'acquiasearchauthplugin.php' => 1,
'signatureabstract.php' => 1,
'servicemanageraware.php' => 1,
'randomstringnoncer.php' => 1,
'noncerinterface.php' => 1,
'noncerabstract.php' => 1,
'acquianetworkclient.php' => 1,
'jsoninterface.php' => 1,
'environmentinterface.php' => 1,
'memcacheserviceinterface.php' => 1,
'actualysdrupalcommerceconnectorbundle.php' => 1,
'dxf colortable.ods' => 1,
'memcachecredentials.php' => 1,
'aww.php' => 1,
'adpapiconnection.class.php' => 1,
'fcgiget.php' => 1,
'adnsummernotebundle.php' => 1,
'pitechkernelinterface.php' => 1,
'pitechkernel.php' => 1,
'pitechbundleinterface.php' => 1,
'pitechbundle.php' => 1,
'install_apps.sh' => 1,
'expressofoobundle.php' => 1,
'defterdar.php' => 1,
'aefeaturebundle.php' => 1,
'deruweslugifybundle.php' => 1,
'aww' => 1,
'linetype.php' => 1,
'example.lock.php' => 1,
'histogram.php' => 1,
'gauge.php' => 1,
'adanfmbeonpopapibundle.php' => 1,
'adamquailefieldsetbundle.php' => 1,
'flatbase.json' => 1,
'flatbase' => 1,
'cli-demo.gif' => 1,
'phpunit_functional.xml' => 1,
'env-example.php' => 1,
'regex.json' => 1,
'sculpin.lock' => 1,
'sculpin.json' => 1,
'memcacheservice.php' => 1,
'localenvironment.php' => 1,
'guidproviderinterface.php' => 1,
'llum' => 1,
'accestoinstallerbundle.php' => 1,
'setpayu.php' => 1,
'payupaymentfactory.php' => 1,
'payugatewayfactory.php' => 1,
'openpayuwrapper.php' => 1,
'workerbundleevents.php' => 1,
'workerbundle.php' => 1,
'remoteserverbundle.php' => 1,
'dispatcherbundle.php' => 1,
'acfwurflbundle.php' => 1,
'test_teardown.sh' => 1,
'test_setup.sh' => 1,
'old-readme' => 1,
'_composer.json' => 1,
'adminlte-laravel' => 1,
'test-with-adminlte.sh' => 1,
'sandbox_setup_withadminlte.sh' => 1,
'laravoole' => 1,
'imagist' => 1,
'testkernel.php' => 1,
'memorysessionstorage.php' => 1,
'kerneltestcase.php' => 1,
'customcallbackcompilerpass.php' => 1,
'accessdeniedlistener.php' => 1,
'reflectionmethodhelper.php' => 1,
'namegeneratortrait.php' => 1,
'nameawareinterface.php' => 1,
'_readme' => 1,
'_phpunit.xml.dist' => 1,
'cloudenvironmentinterface.php' => 1,
'modifier.php' => 1,
'cloudenvironmentaware.php' => 1,
'cloudenvironment.php' => 1,
'databaseserviceinterface.php' => 1,
'databasecredentials.php' => 1,
'cloudapiclient.php' => 1,
'cloudapiauthplugin.php' => 1,
'composer_travis.json' => 1,
'acmephpbundle.php' => 1,
'sample_captcha.php' => 1,
'lwihdbundle.php' => 1,
'entryinterface.php' => 1,
'ac_module_internals.png' => 1,
'zmcimagebundle.php' => 1,
'_travis.yml' => 1,
'aciliaviewcounterbundle.php' => 1,
'aciliavideoproviderbundle.php' => 1,
'aciliatranslationbundle.php' => 1,
'aciliasearchenginebundle.php' => 1,
'aciliaratingbundle.php' => 1,
'aciliaoauth2bundle.php' => 1,
'aciliametatagsbundle.php' => 1,
'aciliadbloggerbundle.php' => 1,
'aciliacorebundle.php' => 1,
'aciliabannerbundle.php' => 1,
'receivdata.php' => 1,
'ftpupload.php' => 1,
'webanalytics.local.php.dist' => 1,
'phoreman' => 1,
'orbitaletranslationbundle.php' => 1,
'i18n.php.example' => 1,
'phpresquebundle.php' => 1,
'cekurtemailerbundle.php' => 1,
'cekurtelivebuzzbundle.php' => 1,
'cekurteinsightlytaskbundle.php' => 1,
'cekurteinsightlybundle.php' => 1,
'cekurtegoogleapibundle.php' => 1,
'cekurtegeneratorbundle.php' => 1,
'cekurtefixturesbundle.php' => 1,
'cavejatoshlbundle.php' => 1,
'default-template.odt' => 1,
'default-template.ods' => 1,
'default-template-with-replaces.odt' => 1,
'spreadsheet.php' => 1,
'phpresque.php' => 1,
'cekurteuploaderbundle.php' => 1,
'kdbparametersbundle.php' => 1,
'res.7z' => 1,
'prepare.bash' => 1,
'integrationtest.xml' => 1,
'loadfail.php' => 1,
'errorhandling.php' => 1,
'canaltptyrbundle.php' => 1,
'canaltpsammonitoringbundle.php' => 1,
'canaltpsamecoreusermanagerbundle.php' => 1,
'canaltpsamecoresecuritybundle.php' => 1,
'commonbusinessinterface.php' => 1,
'canaltpsamecoreapplicationmanagerbundle.php' => 1,
'cekurtepagebundle.php' => 1,
'cekurteuserbundle.php' => 1,
'canaltpsamcorebundle.php' => 1,
'engines.ini.dist' => 1,
'opengraphprotocol.php' => 1,
'library.json' => 1,
'instance.sh' => 1,
'ec2-attached-volumes-snapshot.php' => 1,
'ec2-attached-volumes-prune.php' => 1,
'backup.sh.default' => 1,
'parsepowermail.php' => 1,
'chmatexcelbundle.php' => 1,
'go.bat' => 1,
'doxygen.ini.dist' => 1,
'doc.xml.dist' => 1,
'cmclasses.ini.dist' => 1,
'doc.xml' => 1,
'sepadirectdebitfile.php' => 1,
'mail.ini' => 1,
'setrights.sh' => 1,
'index.php5' => 1,
'checkfilepermissions.php' => 1,
'boot.php5' => 1,
'.htpasswd' => 1,
'doc-creator.php' => 1,
'doc-creator.xml' => 1,
'compat.php' => 1,
'autoload.php5' => 1,
'common.ini' => 1,
'cethyworkszopimchatbundle.php' => 1,
'cssparsed.css' => 1,
'slugify.php' => 1,
'canaltpsamcorebridgebundle.php' => 1,
'task_restart.php' => 1,
'campaignchaincampaignscheduledcampaignbundle.php' => 1,
'campaignchaindistributioncebundle.php' => 1,
'campaignchaincorebundle.php' => 1,
'campaignchainchannelwebsitebundle.php' => 1,
'campaignchainchanneltwitterbundle.php' => 1,
'campaignchainchannellinkedinbundle.php' => 1,
'campaignchainchannelgoogleanalyticsbundle.php' => 1,
'campaignchainchannelfacebookbundle.php' => 1,
'campaignchainchannelezplatformbundle.php' => 1,
'campaignchainchannelcitrixbundle.php' => 1,
'changelog-1.0.0-beta' => 1,
'changelog-1.0.0-alpha' => 1,
'campaignchaincampaigntemplatebundle.php' => 1,
'campaignchaincampaignrepeatingbundle.php' => 1,
'campaignchainhookassigneebundle.php' => 1,
'campaignchainactivitytwitterbundle.php' => 1,
'campaignchainactivitysocialmediabundle.php' => 1,
'campaignchainactivitymailchimpbundle.php' => 1,
'campaignchainactivitylinkedinbundle.php' => 1,
'campaignchainactivitygotowebinarbundle.php' => 1,
'campaignchainactivityfacebookbundle.php' => 1,
'campaignchainactivityezplatformbundle.php' => 1,
'client-map' => 1,
'aeria.php' => 1,
'aeria-activator.php' => 1,
'alexpsocialauthbundle.php' => 1,
'stravastrategy.php' => 1,
'license.rtf' => 1,
'campaignchaindochtmlbundle.php' => 1,
'campaignchainhookdaterepeatbundle.php' => 1,
'canaltpnmmportalbundle.php' => 1,
'campaignchainoperationmailchimpbundle.php' => 1,
'canaltpnmmportalbridgebundle.php' => 1,
'navitiaprofilerbundle.php' => 1,
'navitiaexceptionfactory.php' => 1,
'abstractfactory.php' => 1,
'canaltpmediamanagerbundle.php' => 1,
'campaignchainsecurityauthenticationserveroauthbundle.php' => 1,
'campaignchainsecurityauthenticationclientoauthbundle.php' => 1,
'campaignchainreportgoogleanalyticsbundle.php' => 1,
'campaignchainreportanalyticsmetricsperactivitybundle.php' => 1,
'campaignchainreportanalyticsctatrackingbundle.php' => 1,
'campaignchainoperationtwitterbundle.php' => 1,
'campaignchainoperationsocialmediabundle.php' => 1,
'campaignchainoperationlinkedinbundle.php' => 1,
'campaignchainhookduebundle.php' => 1,
'campaignchainoperationgotowebinarbundle.php' => 1,
'campaignchainoperationfacebookbundle.php' => 1,
'campaignchainoperationezplatformbundle.php' => 1,
'campaignchainmilestonescheduledmilestonebundle.php' => 1,
'campaignchainlocationwebsitebundle.php' => 1,
'campaignchainlocationtwitterbundle.php' => 1,
'campaignchainlocationlinkedinbundle.php' => 1,
'campaignchainlocationgoogleanalyticsbundle.php' => 1,
'campaignchainlocationfacebookbundle.php' => 1,
'campaignchainlocationezplatformbundle.php' => 1,
'campaignchainlocationcitrixbundle.php' => 1,
'campaignchainhooktimespanbundle.php' => 1,
'campaignchainhookdurationbundle.php' => 1,
'yandextranslatorbundle.php' => 1,
'worker_restart.php' => 1,
'cpalexsurchargebundlebundle.php' => 1,
'doctrine1.php' => 1,
'barrating.php' => 1,
'pharer.php' => 1,
'style_guide.php' => 1,
'coderspottingtoastmessagebundle.php' => 1,
'delorean' => 1,
'twig_gear.services.yml' => 1,
'twig_gear.module' => 1,
'twig_gear.info.yml' => 1,
'angulasil.theme' => 1,
'angulasil.libraries.yml' => 1,
'angulasil.info.yml' => 1,
'script.robo' => 1,
'ffmpegmovie.php' => 1,
'barratingpluginasset.php' => 1,
'ffmpegframe.php' => 1,
'ffmpegautoloader.php' => 1,
'ffmpeganimatedgif.php' => 1,
'repositoryaliasbundle.php' => 1,
'rulesenginefactory.php' => 1,
'rulesengine.php' => 1,
'codememerulesbundle.php' => 1,
'codememeironmqbundle.php' => 1,
'codeloversloggingbundle.php' => 1,
'codeloversjshintbundle.php' => 1,
'codeloversrestbundle.php' => 1,
'codeloversphpstormbundle.php' => 1,
'barratingasset.php' => 1,
'guielement.php' => 1,
'codeloversdoctrineencryptbundle.php' => 1,
'iobject.php' => 1,
'frontcontrollerinterface.php' => 1,
'errorhandlinginterface.php' => 1,
'dateinterface.php' => 1,
'code-generator.php' => 1,
'negotiation.php' => 1,
'http-verbs.php' => 1,
'first-example.php' => 1,
'objectsinglecollection.php' => 1,
'objectmulticollection.php' => 1,
'iobjectsinglecollection.php' => 1,
'iobjectmulticollection.php' => 1,
'iobjectcollection.php' => 1,
'idb.php' => 1,
'guiframe.php' => 1,
'abstractdb.php' => 1,
'viewscontroller.php' => 1,
'methodscontroller.php' => 1,
'localconfig.php' => 1,
'idynamiccollection.php' => 1,
'dynamiccollection.php' => 1,
'responsetype.php' => 1,
'requesttype.php' => 1,
'calltype.php' => 1,
'guistring.php' => 1,
'guiscrollablewindow.php' => 1,
'guiresizeevent.php' => 1,
'guiprogressbar.php' => 1,
'typename.php' => 1,
'codeloversangularbundle.php' => 1,
'chokapixjcropimagebundle.php' => 1,
'acf-modules-setup.json' => 1,
'organismtemplate.php' => 1,
'atomtemplate.php' => 1,
'cnp-molecule-builder.php' => 1,
'queried-object-parser.php' => 1,
'print-on-present.php' => 1,
'p2p-connections.php' => 1,
'nav-filters.php' => 1,
'inline-svg.php' => 1,
'human-timing.php' => 1,
'highest-ancestor.php' => 1,
'add-favicon.php' => 1,
'acf-modules.php' => 1,
'haversine.php' => 1,
'application_enter.php' => 1,
'cnp-atom-builder.php' => 1,
'ciscajabugminerestbundle.php' => 1,
'circleutilitybundle.php' => 1,
'circlerestclientbundle.php' => 1,
'cimusgeobundle.php' => 1,
'cimusgearmanbundle.php' => 1,
'timelinejsbundle.php' => 1,
'mercurialnode.php' => 1,
'mercurialmanager.php' => 1,
'interkassabundle.php' => 1,
'christianvermeulenpostalcodebundle.php' => 1,
'christianriesenpasswordhashbundle.php' => 1,
'ckrupahubicapibundle.php' => 1,
'includes.php' => 1,
'config_social_default.php' => 1,
'codeloversaclbundle.php' => 1,
'.cleantalk.class.php.swp' => 1,
'init.production.php' => 1,
'init.development.php' => 1,
'encryption.key' => 1,
'codagrestfabricationbundle.php' => 1,
'codagpredictioniobundle.php' => 1,
'codagalchemyapibundle.php' => 1,
'optionallocalebundle.php' => 1,
'db_example.sql' => 1,
'clickandmortarimportbundle.php' => 1,
'cleeng_api.php' => 1,
'cleantalkvalidator.php' => 1,
'cleantalkapi.php' => 1,
'clasticuserbundle.php' => 1,
'classpreloader.php' => 1,
'clastictextbundle.php' => 1,
'clastictaxonomybundle.php' => 1,
'clasticsecuritybundle.php' => 1,
'clasticnodebundle.php' => 1,
'clasticgeneratorbundle.php' => 1,
'clasticfrontbundle.php' => 1,
'nodeevents.php' => 1,
'clasticcorebundle.php' => 1,
'clasticblockbundle.php' => 1,
'clasticnewsbundle.php' => 1,
'clastichttpcachebundle.php' => 1,
'clasticgoogleanalyticsbundle.php' => 1,
'clasticblogbundle.php' => 1,
'testwidgetbundle.php' => 1,
'moukmoukibundle.php' => 1,
'randomstringinterface.php' => 1,
'yamm.php' => 1,
'yiiquickswapmodule.php' => 1,
'merrorhandler.php' => 1,
'bdkenquirybundle.php' => 1,
'bdkasyncdispatcherbundle.php' => 1,
'bobrdschedulerbundle.php' => 1,
'processmanager.phar' => 1,
'bobrdmessagebusbundle.php' => 1,
'architect-composer.sublime-project' => 1,
'yandexmoneygatewayfactory.php' => 1,
'graythemeasset.php' => 1,
'bluethemeasset.php' => 1,
'yammasset.php' => 1,
'blueteapushnotificationsbundle.php' => 1,
'iactivate.php' => 1,
'blueteajirarestapibundle.php' => 1,
'blueteaimportevents.php' => 1,
'blueteaimportbundle.php' => 1,
'blueteaexportevents.php' => 1,
'blueteaexportbundle.php' => 1,
'blueteacrowdauthenticationbundle.php' => 1,
'testdox-output' => 1,
'create-sqlite.sql' => 1,
'create-pgsql.sql' => 1,
'create-mysql.sql' => 1,
'test results' => 1,
'pubspec.yaml' => 1,
'admin.info' => 1,
'data_tools.info' => 1,
'bloghovenjekyllproviderbundle.php' => 1,
'botanickserializerbundle.php' => 1,
'woocommerce-role-based-coupons.php' => 1,
'bs-unset-free.php' => 1,
'divi_cpt_builder.php' => 1,
'.php.tags' => 1,
'bbitsqscommandqueuebundle.php' => 1,
'subtree.sh' => 1,
'bbitblogbundle.php' => 1,
'bbitauditlogbundle.php' => 1,
'bbitasyncdispatcherbundle.php' => 1,
'branchbitairgrambundle.php' => 1,
'cortex-plugin.php' => 1,
'.envrc' => 1,
'expect.php' => 1,
'data_tools.php' => 1,
'imagsimplecachebundle.php' => 1,
'imagnotifierbundle.php' => 1,
'bomoicalbundle.php' => 1,
'imagfilesbundle.php' => 1,
'imagetherpadbundle.php' => 1,
'imagcsvbundle.php' => 1,
'toolsconvert.php' => 1,
'toolsblanknode.php' => 1,
'parserturtle.php' => 1,
'parsersparqlresult.php' => 1,
'conversionmimetype.php' => 1,
'eyiipdf.php' => 1,
'downloader.php' => 1,
'bluebearbasebundle.php' => 1,
'bloghovenblosxomdirproviderbundle.php' => 1,
'todo.dev' => 1,
'module-payment.csv' => 1,
'module-sales-sequence.csv' => 1,
'module-sales-rule.csv' => 1,
'module-rule.csv' => 1,
'module-rss.csv' => 1,
'module-review.csv' => 1,
'module-require-js.csv' => 1,
'module-reports.csv' => 1,
'module-quote.csv' => 1,
'module-product-video.csv' => 1,
'module-product-alert.csv' => 1,
'module-persistent.csv' => 1,
'module-paypal.csv' => 1,
'module-page-cache.csv' => 1,
'module-search.csv' => 1,
'module-offline-shipping.csv' => 1,
'module-offline-payments.csv' => 1,
'module-newsletter.csv' => 1,
'module-multishipping.csv' => 1,
'module-msrp.csv' => 1,
'module-media-storage.csv' => 1,
'module-marketplace.csv' => 1,
'module-layered-navigation.csv' => 1,
'module-integration.csv' => 1,
'module-indexer.csv' => 1,
'module-import-export.csv' => 1,
'module-grouped-product.csv' => 1,
'module-grouped-import-export.csv' => 1,
'module-sales.csv' => 1,
'module-send-friend.csv' => 1,
'bloghovenblogbundle.php' => 1,
'module-webapi.csv' => 1,
'bloghovenabstractthemebundle.php' => 1,
'phpdoccheck' => 1,
'pluginconfig.php.example' => 1,
'loggerconfig.php.example' => 1,
'daemonise' => 1,
'.phpci.yml' => 1,
'octocmd' => 1,
'theme-frontend-luma.csv' => 1,
'theme-frontend-blank.csv' => 1,
'module-wishlist.csv' => 1,
'module-widget.csv' => 1,
'module-weee.csv' => 1,
'module-version.csv' => 1,
'module-shipping.csv' => 1,
'module-variable.csv' => 1,
'module-usps.csv' => 1,
'module-user.csv' => 1,
'module-url-rewrite.csv' => 1,
'module-ups.csv' => 1,
'module-ui.csv' => 1,
'module-translation.csv' => 1,
'module-theme.csv' => 1,
'module-tax.csv' => 1,
'module-tax-import-export.csv' => 1,
'module-swatches.csv' => 1,
'module-store.csv' => 1,
'module-sitemap.csv' => 1,
'woocommerce-referralcandy.php' => 1,
'bfosbrasilbundle.php' => 1,
'cpalexdashboardbundle.php' => 1,
'bureaupieperstoreebundle.php' => 1,
'media_bynder.install' => 1,
'media_bynder.info' => 1,
'media_bynder.css' => 1,
'bushidoioqrcodebundle.php' => 1,
'bushidoiopdfbundle.php' => 1,
'wsdl.php' => 1,
'autodiscover.php' => 1,
'part.php' => 1,
'glaze-old.php' => 1,
'keyvaluecontainer.php' => 1,
'burgovkeyvalueformbundle.php' => 1,
'burgovcmsbundle.php' => 1,
'thunder.profile' => 1,
'eventmapper.php' => 1,
'thunder.install' => 1,
'thunder.info.yml' => 1,
'premake.sh' => 1,
'drupal-org.make.yml' => 1,
'drupal-org-core.make.yml' => 1,
'drupal-org-core.make' => 1,
'develop.make.yml' => 1,
'develop.make' => 1,
'build-thunder.make.yml' => 1,
'build-thunder.make' => 1,
'ivw_integration.tokens.inc' => 1,
'ivw_integration.services.yml' => 1,
'ivw_integration.routing.yml' => 1,
'media_bynder.module' => 1,
'ccetcerrorreportbundle.php' => 1,
'ivw_integration.links.menu.yml' => 1,
'update_production.sh' => 1,
'simucpabundle.php' => 1,
'simusantechatbundle.php' => 1,
'convconvbundle.php' => 1,
'cpasimusanteexoverridebundle.php' => 1,
'cpasimusantesimusanteoverridebundle.php' => 1,
'cpasimusantesimupollbundle.php' => 1,
'cpasimusanteprocompetencybundle.php' => 1,
'cpasimusanteitemselectorbundle.php' => 1,
'cpasimusanteclarolinelayoutoverridebundle.php' => 1,
'cpasimusanteclacoadminbundle.php' => 1,
'cpasimusantechartnewbundle.php' => 1,
'cpasimusantechartjsbundle.php' => 1,
'management_utils.sh' => 1,
'ccetcdirectorybundle.php' => 1,
'install_config.sh' => 1,
'env_config.base' => 1,
'email_config.base' => 1,
'db_config.base' => 1,
'schemasyncwrapper.sh' => 1,
'config.autoload.dao.orm.global.php' => 1,
'config.autoload.auth.page.local.php' => 1,
'config.autoload.auth.login.local.php' => 1,
'ngen_ant.xml' => 1,
'certunlpngenbundle.php' => 1,
'libkml.php' => 1,
'ccetcimportbundle.php' => 1,
'ccetcdirectoryuserbundle.php' => 1,
'ivw_integration.module' => 1,
'ivw_integration.install' => 1,
'bfosfretebraspressbundle.php' => 1,
'aceadminjqgridasset.php' => 1,
'scehma' => 1,
'configuration.yml' => 1,
'broutouspageeditorbundle.php' => 1,
'pulseconnect.php' => 1,
'briteapicontact.php' => 1,
'briteapiclient.php' => 1,
'default.ini' => 1,
'restsdk.php' => 1,
'enabledinterface.php' => 1,
'example-layout.php' => 1,
'aceadminwysiwygasset.php' => 1,
'aceadminwizardasset.php' => 1,
'aceadminasset.php' => 1,
'smarthome.php' => 1,
'skin.json' => 1,
'script.sh' => 1,
'refreshed.skin.php' => 1,
'brein-api-library-php.iml' => 1,
'bfostwigextensionsbundle.php' => 1,
'bfossynccontentbundle.php' => 1,
'bfossettingsmanagementbundle.php' => 1,
'bfospagsegurobundle.php' => 1,
'bfospagamentodigitalbundle.php' => 1,
'bfospagamentobundle.php' => 1,
'bfosnotafiscalbundle.php' => 1,
'bfosgatewaylocawebbundle.php' => 1,
'bfosfretebundle.php' => 1,
'mysqli.php' => 1,
'cltr.php' => 1,
'ivw_integration.info.yml' => 1,
'bukashk0zzztimestamptypebundle.php' => 1,
'breakpoint_js_settings.routing.yml' => 1,
'breakpoint_js_settings.module' => 1,
'breakpoint_js_settings.links.menu.yml' => 1,
'breakpoint_js_settings.info.yml' => 1,
'ad_integration.tokens.inc' => 1,
'ad_integration.services.yml' => 1,
'ad_integration.routing.yml' => 1,
'ad_integration.module' => 1,
'ad_integration.links.menu.yml' => 1,
'ad_integration.libraries.yml' => 1,
'ad_integration.install' => 1,
'ad_integration.info.yml' => 1,
'sample-microbilt.php' => 1,
'vk_methods' => 1,
'microbiltwsdlclass.php' => 1,
'microbiltclassmap.php' => 1,
'microbiltautoload.php' => 1,
'bukashk0zzzliipimagineserializationbundle.php' => 1,
'bukashk0zzzhellosignbundle.php' => 1,
'bukashk0zzzfilterbundle.php' => 1,
'file2add' => 1,
'default.xlf' => 1,
'branch_beta' => 1,
'modulebotstatisticsversion.php' => 1,
'composer.json.back' => 1,
'yadr.php' => 1,
'vkdr.php' => 1,
'numbertotextinterface.php' => 1,
'siteinterface.php' => 1,
'module-google-analytics.csv' => 1,
'eccube_install.sh' => 1,
'egyg33kcsvbundle.php' => 1,
'eetestsgeneratorbundle.php' => 1,
'eetysbundle.php' => 1,
'eelightuserbundle.php' => 1,
'eeextramailerbundle.php' => 1,
'eeexceptionjsbundle.php' => 1,
'eeembedlybundle.php' => 1,
'eedataexporterbundle.php' => 1,
'edsitechsirtrevorbundle.php' => 1,
'saferedisclient.php' => 1,
'redisguzzlecache.php' => 1,
'edsitechgandibundle.php' => 1,
'campaigncommandernotificationmessagingexception.php' => 1,
'epicr2riobundle.php' => 1,
'campaigncommandernotificationmessaging.php' => 1,
'campaigncommandermemberexception.php' => 1,
'campaigncommandermember.php' => 1,
'evencesoftdeleteableextensionbundle.php' => 1,
'evencegridbundle.php' => 1,
'voicesofpoll.php' => 1,
'polldb.php' => 1,
'dwollaswagger.php' => 1,
'dbsr_gui_bootstrapper.php' => 1,
'dbsr_gui.php' => 1,
'dbsr_cli_bootstrapper.php' => 1,
'dbsr_cli.php' => 1,
'egyg33kdomainparserbundle.php' => 1,
'esnesnbundle.php' => 1,
'dudytzdoctrineuuidbundle.php' => 1,
'workerregistry.php' => 1,
'poi.php' => 1,
'voice.php' => 1,
'transfer.php' => 1,
'shortvideo.php' => 1,
'music.php' => 1,
'encryptionexception.php' => 1,
'devicehttpexception.php' => 1,
'init-error-handling.php' => 1,
'init-environment.php' => 1,
'.ppi-settings.json' => 1,
'.ppi-settings-metadata.json' => 1,
'.eipi.json' => 1,
'serviceawareworkerfactory.php' => 1,
'etsechosignbundle.php' => 1,
'exsystworkerbundle.php' => 1,
'workerpool.php' => 1,
'workerfactory.php' => 1,
'sharedworkerimplementationinterface.php' => 1,
'sharedworker.php' => 1,
'rawworkerimplementationinterface.php' => 1,
'eventedworkerimplementationinterface.php' => 1,
'exsystsecuritybundle.php' => 1,
'stateinterface.php' => 1,
'sink.php' => 1,
'selectableinterface.php' => 1,
'exsystapibundle.php' => 1,
'etspaymentdotpaybundle.php' => 1,
'dbsr.php' => 1,
'dzcronmanagerbundle.php' => 1,
'badrequestexception.php' => 1,
'difanecontentpartbundle.php' => 1,
'divipropelloggerbundle.php' => 1,
'orkestraapcbundle.php' => 1,
'diviajaxloginbundle.php' => 1,
'ddgetdocuments_snippet.php' => 1,
'modx.ddtools.class.php' => 1,
'displore.json' => 1,
'deploymentbundle.php' => 1,
'dildenfeedbackasset.php' => 1,
'dildenfeedback.php' => 1,
'mikepearceeasybacklogapibundle.php' => 1,
'helper.less' => 1,
'difanetwigdatabasebundle.php' => 1,
'robin.class.php' => 1,
'exiguousecommerceitem.php' => 1,
'yiidisquswidget.php' => 1,
'actionplugin.php' => 1,
'aclpath.php' => 1,
'consoledemo.php' => 1,
'console-php.php' => 1,
'ecommerce.xsd' => 1,
'entitygeneratorbundle.php' => 1,
'hofplexexportbundle.php' => 1,
'treenodesreorderaction.php' => 1,
'treenodemoveaction.php' => 1,
'jstreeassetbundle.php' => 1,
'contextmenuhelper.php' => 1,
'adjacencyfulltreedataaction.php' => 1,
'basketitem.php' => 1,
'djamygooglecalendarbundle.php' => 1,
'rootca' => 1,
'_before_test.php' => 1,
'drensoicalbundle.php' => 1,
'example.html.php' => 1,
'sqls.iml' => 1,
'typo3.xml' => 1,
'qa.xml' => 1,
'ladder.json.sample' => 1,
'license-orig' => 1,
'naith.php' => 1,
'naith' => 1,
'naithjunitreport.class.php' => 1,
'naithclirunner.class.php' => 1,
'naithclireport.class.php' => 1,
'templator.php' => 1,
'davidjegatasseticminifierbundle.php' => 1,
'templator.js' => 1,
'devreadme' => 1,
'logintemplate.tpl' => 1,
'commonjs.php' => 1,
'beforeaftercontrollershooksbundle.php' => 1,
'dwdqiniusdkbundle.php' => 1,
'dowdowleagueoflegendsapibundle.php' => 1,
'src.zip' => 1,
'mysheet.tar' => 1,
'sam.json.example' => 1,
'.scutinizer.yml' => 1,
'djegjambundle.php' => 1,
'davidjegatjimportbundle.php' => 1,
'semantic.php' => 1,
'guard.php' => 1,
'activerecordbehavior.php' => 1,
'pure' => 1,
'elorfinresourcebundle.php' => 1,
'elorfinjsonapibundle.php' => 1,
'oxidfactory.php' => 1,
'oxidawaretrait.php' => 1,
'oxidawareinterface.php' => 1,
'oxidaware.php' => 1,
'databaseinstaller.php' => 1,
'assettransitions.php' => 1,
'search_hooks.php' => 1,
'icondirect.php' => 1,
'topicposts.php' => 1,
'elgg.xml' => 1,
'console.config.php.example' => 1,
'elsassseeraiweresarticlebundle.php' => 1,
'monologfluentdbundle.php' => 1,
'elendevwidgetbundle.php' => 1,
'elendevroxyfilemanbundle.php' => 1,
'simpleimageproxyfactory.php' => 1,
'simpleimageproxy.php' => 1,
'nofileimageproxy.php' => 1,
'imageproxyfactory.php' => 1,
'imageproxy.php' => 1,
'elendevimagebundle.php' => 1,
'elendevcheckoutbundle.php' => 1,
'checkoutserviceprovider.php' => 1,
'checkoutservice.php' => 1,
'elorfinuserbundle.php' => 1,
'elsassseeraiweresbarbundle.php' => 1,
'elasticpushbundle.php' => 1,
'omnidesk.php' => 1,
'modelguidbase.php' => 1,
'managerbase.php' => 1,
'componentbase.php' => 1,
'epdoctrinelockbundle.php' => 1,
'epdisplaybundle.php' => 1,
'epasynceventdispatcherbundle.php' => 1,
'basebox' => 1,
'frisbee-demo.gif' => 1,
'plafile.yml' => 1,
'phpsql.php' => 1,
'oneline.php' => 1,
'phpa2o.php' => 1,
'cachesubscriber.php' => 1,
'elsassseeraiweresmenubundle.php' => 1,
'twiginflectionbundle.php' => 1,
'twigcachebundle.php' => 1,
'simplearraybundle.php' => 1,
'placeholditprovider.php' => 1,
'gravatarbundle.php' => 1,
'fakerserviceprovider.php' => 1,
'fakerbundle.php' => 1,
'embedlyserviceprovider.php' => 1,
'embedlybundle.php' => 1,
'emagistermemcachedbundle.php' => 1,
'tabular.php' => 1,
'composer.json.meow' => 1,
'elsassseeraiweresuserbundle.php' => 1,
'checkoutresult.php' => 1,
'webprofilerextrabundle.php' => 1,
'staff.php' => 1,
'suggestions.php' => 1,
'zipcodevalidator.php' => 1,
'pricevalidator.php' => 1,
'paymentresponse.php' => 1,
'omnikassa.php' => 1,
'.phpqa.yml' => 1,
'edgetexybundle.php' => 1,
'overseer.php' => 1,
'edgeanalyticsbundle.php' => 1,
'edge5appbackendbundle.php' => 1,
'stringtype.php' => 1,
'arraytype.php' => 1,
'tweets.php' => 1,
'streaming.php' => 1,
'psyduck.php' => 1,
'saved.php' => 1,
'friends.php' => 1,
'directmessage.php' => 1,
'fql.php' => 1,
'venue.php' => 1,
'organizer.php' => 1,
'fileoperations.php' => 1,
'accounts.php' => 1,
'generatedcodebar.php' => 1,
'config.rb.dst' => 1,
'phpspec.travis.yml' => 1,
'propel.yml' => 1,
'easytekdoctrinecacheinvalidatorbundle.php' => 1,
'eduardtrayanfaststoragebundle.php' => 1,
'hasherinterface.php' => 1,
'twigprofilerengine.php' => 1,
'cli-dom' => 1,
'elaoerrornotifierbundle.php' => 1,
'elaothemetwitterbootstrap3bundle.php' => 1,
'elaoparameterizerbundle.php' => 1,
'elaojsonhttpformbundle.php' => 1,
'elaoformtranslationbundle.php' => 1,
'elaoformbundle.php' => 1,
'elaobrowserdetectorbundle.php' => 1,
'elaoadminbundle.php' => 1,
'elaocmsslotbundle.php' => 1,
'notes tbd' => 1,
'cli-xed' => 1,
'hls-downloader-cli' => 1,
'xpath-cli' => 1,
'hashertrait.php' => 1,
'ua.list' => 1,
'cli-cache' => 1,
'cache-cli' => 1,
'phpunit_1.xml' => 1,
'.gitignore_1' => 1,
'uricomponentinterface.php' => 1,
'tld.php' => 1,
'schemes.php' => 1,
'httpscheme.php' => 1,
'constantstrait.php' => 1,
'standarddeshasher.php' => 1,
'saltinterface.php' => 1,
'hashes.php' => 1,
'aqlexpression.php' => 1,
'acehelper.php' => 1,
'textinterface.php' => 1,
'phplinqprovider.sln' => 1,
'croncronbundle.php' => 1,
'installhandler.php' => 1,
'templates' => 1,
'courtyardforumbundle.php' => 1,
'inkstandplugintestbundle.php' => 1,
'basic-example.php' => 1,
'twigprofiledengine.php' => 1,
'corespheretwigprofilerbundle.php' => 1,
'controllerserviceprovider.php' => 1,
'controllerinspector.php' => 1,
'randlib.c.patch' => 1,
'phplinqprovider.v12.suo' => 1,
'wordpress.sh' => 1,
'crossknowledgedevicedetectbundle.php' => 1,
'speed-up-essentials-plugin.php' => 1,
'screenshot_categories.jpg' => 1,
'screenshot_access_rights.jpg' => 1,
'screenshot_categories_view.jpg' => 1,
'screenshot_backend_view.jpg' => 1,
'tiersarchivagemap.php' => 1,
'tiersarchivage.php' => 1,
'ecoffrefort.php' => 1,
'consoneoecoffrefortbundle.php' => 1,
'coffremap.php' => 1,
'coffre.php' => 1,
'connectsbtranslationbundle.php' => 1,
'crossknowledgedatatablebundle.php' => 1,
'crowdreactivecloudresizerbundle.php' => 1,
'connecthollandpiccolocontentbundle.php' => 1,
'audittrailmodule.php' => 1,
'd2personmodule.php' => 1,
'd2messagesmodule.php' => 1,
'd2mailermodule.php' => 1,
'd2fixrmodule.php' => 1,
'd2finvmodule.php' => 1,
'd2filesmodule.php' => 1,
'd2companymodule.php' => 1,
'd2calendarmodule.php' => 1,
'd1statusmodule.php' => 1,
'd1filesmodule.php' => 1,
'translation_app.php' => 1,
'd1companymodule.php' => 1,
'personal_finance_level_data.sql' => 1,
'spell' => 1,
'd1systemmodule.php' => 1,
'edifactdatamodule.php' => 1,
'dbdiff' => 1,
'flitch' => 1,
'dabsquaredmssqlbundle.php' => 1,
'dabsquaredpushnotificationsbundle.php' => 1,
'cydopresenterbundle.php' => 1,
'cuteninjapersonabundle.php' => 1,
'cuteninjaparabolabundle.php' => 1,
'cuteninjamemoriabundle.php' => 1,
'cscorebundle.php' => 1,
'xmltemp.xml' => 1,
'xmlgenerator.php' => 1,
'tulipapibundle.php' => 1,
'connecthollandpiccolocmsbundle.php' => 1,
'finvmodule.php' => 1,
'lengthexception.php' => 1,
'handleresponseinterface.php' => 1,
'formatinterface.php' => 1,
'fieldhandlerusagetrait.php' => 1,
'fieldhandlerinterface.php' => 1,
'constraintinterface.php' => 1,
'unexpectedvalueexception.php' => 1,
'underflowexception.php' => 1,
'rangeexception.php' => 1,
'overflowexception.php' => 1,
'outofrangeexception.php' => 1,
'outofboundsexception.php' => 1,
'logicexception.php' => 1,
'exceptioninterface.php' => 1,
'redirectinterface.php' => 1,
'exceptionhandlerinterface.php' => 1,
'errorthrownasexception.php' => 1,
'domainexception.php' => 1,
'badfunctioncallexception.php' => 1,
'usereventinterface.php' => 1,
'updateeventinterface.php' => 1,
'triggerinterface.php' => 1,
'systemeventinterface.php' => 1,
'readeventinterface.php' => 1,
'initialiseeventinterface.php' => 1,
'displayeventinterface.php' => 1,
'deleteeventinterface.php' => 1,
'createeventinterface.php' => 1,
'validateresponseinterface.php' => 1,
'uploadinterface.php' => 1,
'urlhistorybehavior.php' => 1,
'paginationinterface.php' => 1,
'urlhistory.php' => 1,
'userdatainterface.php' => 1,
'messagesinterface.php' => 1,
'flashmessageinterface.php' => 1,
'encryptinterface.php' => 1,
'cookieinterface.php' => 1,
'authorisationinterface.php' => 1,
'authenticationinterface.php' => 1,
'activityinterface.php' => 1,
'namespaceinterface.php' => 1,
'classloaderinterface.php' => 1,
'parseinterface.php' => 1,
'updatemodelinterface.php' => 1,
'factorybatchinterface.php' => 1,
'updatecontrollerinterface.php' => 1,
'readmodelinterface.php' => 1,
'readcontrollerinterface.php' => 1,
'queryusagetrait.php' => 1,
'modelregistryinterface.php' => 1,
'initialisecontrollerinterface.php' => 1,
'deletemodelinterface.php' => 1,
'deletecontrollerinterface.php' => 1,
'createmodelinterface.php' => 1,
'createcontrollerinterface.php' => 1,
'translateinterface.php' => 1,
'captureuntranslatedstringinterface.php' => 1,
'scheduleinterface.php' => 1,
'd2tasksmodule.php' => 1,
'personmodule.php' => 1,
'aceasset.php' => 1,
'datavalues.php' => 1,
'decibel.config.php' => 1,
'mustache.php' => 1,
'preview.jpg' => 1,
'ajaxpageloading.js' => 1,
'trovitapi.php' => 1,
'paris-generator' => 1,
'shellstartup.php' => 1,
'davidmikesimonbotticellibundle.php' => 1,
'davidforestimgbundle.php' => 1,
'davidbadurafixturesbundle.php' => 1,
'davidbadurafakerbundle.php' => 1,
'cf.php' => 1,
'datavalues.mw.php' => 1,
'decibel.manifest.xml' => 1,
'datavalues.i18n.php' => 1,
'dolldapbundle.php' => 1,
'darvinwebmaillinkerbundle.php' => 1,
'darvinutilsbundle.php' => 1,
'darvinuserbundle.php' => 1,
'darvinsitemapbundle.php' => 1,
'darvinimagebundle.php' => 1,
'darvincontentbundle.php' => 1,
'darvinbotdetectorbundle.php' => 1,
'nntmux' => 1,
'nnbase.php' => 1,
'two.php' => 1,
'three.php' => 1,
'decibel.info.php' => 1,
'decibel.php' => 1,
'wallposterbundle.php' => 1,
'derstoffelcarreraloggerbundle.php' => 1,
'ace.php' => 1,
'aureolmanagerbundle.php' => 1,
'd4mebaybundle.php' => 1,
'permissiontrait.php' => 1,
'laravelpermissionrolesserviceprovider.php' => 1,
'cli-install.php' => 1,
'deskpro-api.php' => 1,
'dprepobundle.php' => 1,
'exportation_documentation' => 1,
'license.jscookmenu' => 1,
'readme.php-saml' => 1,
'license.php-saml' => 1,
'apiauth.php' => 1,
'decibel.tables.xml' => 1,
'recordreplacer.php' => 1,
'kmjzillowbundle.php' => 1,
'kmjupdatebundle.php' => 1,
'kmjtoolkitbundle.php' => 1,
'kmjsyncbundle.php' => 1,
'kmjpaypalbridgebundle.php' => 1,
'kmjcronbundle.php' => 1,
'kmjchanneladvisorbundle.php' => 1,
'kmjawsbundle.php' => 1,
'calendarlinks.php' => 1,
'defaultvalueakeneoinlineeditbundle.php' => 1,
'deepomatic.php' => 1,
'decibeluninstaller.php' => 1,
'one.php' => 1,
'recaptchabundle.php' => 1,
'tlbexcel.php' => 1,
'srceen_shot_list_settings.png' => 1,
'formatnum.i18n.magic.php' => 1,
'formatnum.hooks.php' => 1,
'dzunkeslackbundle.php' => 1,
'dzunkefeatureflagsbundle.php' => 1,
'genconfig.php' => 1,
'iocapp' => 1,
'test-steam-api-key.php_sample' => 1,
'treeassets.php' => 1,
'tcpdi_parser.php' => 1,
'tcpdi.php' => 1,
'selenium-server.jar' => 1,
'dhorchlersympatchbundle.php' => 1,
'srceen_shot_edit_multiplechoice_setting.png' => 1,
'formatnum.php' => 1,
'srceen_shot_edit_integer_setting.png' => 1,
'srceen_shot_edit_date_setting.png' => 1,
'dhorchlerconfigbundle.php' => 1,
'schedulerhelperdate.php' => 1,
'schedulerhelperconnector.php' => 1,
'schedulerhelper.php' => 1,
'recurringtype.php' => 1,
'dhtmlxasset.php' => 1,
'dgoptimizedaccessdecisionmanagerbundle.php' => 1,
'jqplotgraphwidget.php' => 1,
'wikimodule.php' => 1,
'trucksmodule.php' => 1,
'tlbexcelview.php' => 1,
'formatnum.i18n.php' => 1,
'piwik.hooks.php' => 1,
'alice' => 1,
'mongomodel.php' => 1,
'userbitcoinaddresses.settings.php' => 1,
'userbitcoinaddresses.php' => 1,
'userbitcoinaddresses.i18n.aliases.php' => 1,
'wsdltoclass' => 1,
'travis-after.sh' => 1,
'example_cache.php' => 1,
'quandl.php' => 1,
'rust.php' => 1,
'reset-symlinks.sh' => 1,
'gekko-shortener.sublime-project' => 1,
'.example.env.php' => 1,
'elements.sublime-workspace' => 1,
'mongodoc.php' => 1,
'localhostbrowser.php' => 1,
'mongodbconnection.php' => 1,
'runttest.php' => 1,
'php.js' => 1,
'lowmemoryclassloader.php' => 1,
'releaseinfo.php' => 1,
'phpstorm.meta.php' => 1,
'gravatario.php' => 1,
'daminoushkasimplejqueryvalidationbundle.php' => 1,
'damdamdbootstrapbundle.php' => 1,
'daemonsimplifybundle.php' => 1,
'daemongallerybundle.php' => 1,
'daemonfilestoragebundle.php' => 1,
'filesfinderbundle.php' => 1,
'module-google-optimizer.csv' => 1,
'module-google-adwords.csv' => 1,
'repositorybase.php' => 1,
'doxygenlayout.xml' => 1,
'ampisoftdeploybundle.php' => 1,
'autogettersettertrait.php' => 1,
'arrayfactorytrait.php' => 1,
'annotationreaderfetcher.php' => 1,
'annotatedgettersettertrait.php' => 1,
'abstractgettersettertrait.php' => 1,
'acmodeltraitsbundle.php' => 1,
'acloginconveniencebundle.php' => 1,
'testwatch' => 1,
'containerawareroleauthorizer.php' => 1,
'ackalinkabundle.php' => 1,
'doxygen-filter.php' => 1,
'acfiendishbundle.php' => 1,
'fixturesloader.php' => 1,
'serviceresponse.php' => 1,
'acwebservicesbundle.php' => 1,
'actranscodingbundle.php' => 1,
'transcoder.php' => 1,
'preset.php' => 1,
'mimemap.php' => 1,
'filehandlerdefinition.php' => 1,
'mutate.conf.php' => 1,
'mediainfo.php' => 1,
'acmediainfobundle.php' => 1,
'amenophisprincebundle.php' => 1,
'amenophissocialbundle.php' => 1,
'ampuserbundle.php' => 1,
'gatherer.php' => 1,
'wr-dist.ini' => 1,
'typo.php' => 1,
'cosenary' => 1,
'basketinterface.php' => 1,
'basketcomponent.php' => 1,
'imagesbehavior.php' => 1,
'crudactionupdate.php' => 1,
'crudactiondelete.php' => 1,
'crudactioncreate.php' => 1,
'crudactionbase.php' => 1,
'checkowner.php' => 1,
'catalogadmin.php' => 1,
'cryptokey' => 1,
'typorules.php' => 1,
'rutils.php' => 1,
'gathererhelper.php' => 1,
'numeral.php' => 1,
'dt.php' => 1,
'.prjide' => 1,
'phpunit_init.php' => 1,
'dbmsmodule.php' => 1,
'bookmarkmodule.php' => 1,
'accessmodule.php' => 1,
'selftest.php' => 1,
'rar.php' => 1,
'fixturesfromdbgenerator.php' => 1,
'amstaffixextjsrestcommonbundle.php' => 1,
'extjsmodelssaver.php' => 1,
'extjsgetallrequestcreator.php' => 1,
'wr-test.ini' => 1,
'diagrama.png' => 1,
'nf.php' => 1,
'pmg-cdn.php' => 1,
'app.functions.php' => 1,
'app.debugmode.php' => 1,
'instapush.php' => 1,
'votemodule.php' => 1,
'akhannstaticpagebundle.php' => 1,
'redmine-reminder' => 1,
'closuretablebehavior.php' => 1,
'hypemailchimpbundle.php' => 1,
'hypedynamicdatatablesbundle.php' => 1,
'cnertamailingbundle.php' => 1,
'cnertabreadcrumbbundle.php' => 1,
'cnertabehindaproxybundle.php' => 1,
'google-tag-manager.php' => 1,
'grumpy-cat-meme-hmmm.jpg' => 1,
'fu-autop.php' => 1,
'yuzupipelinebundle.php' => 1,
'yuzuarcgisbundle.php' => 1,
'symclass.php' => 1,
'editor-style.css' => 1,
'aequivocarestbundle.php' => 1,
'thumbnailimage.php' => 1,
'aws.global.php.dist' => 1,
'signout.php' => 1,
'ffaboard.sql' => 1,
'createtopic.php' => 1,
'shopifybundle.php' => 1,
'run_phantomjs.sh' => 1,
'app.init.php' => 1,
'esngalaxyauthserviceprovider.php' => 1,
'diagram.uml' => 1,
'mar.php' => 1,
'acsacspanelwordpressbundle.php' => 1,
'acsacspanelusersbundle.php' => 1,
'release.key' => 1,
'acsacspanelsettingsbundle.php' => 1,
'acsacspanelbundle.php' => 1,
'acinst3bundle.php' => 1,
'alsatianformbundle.php' => 1,
'alphalabspaginationbundle.php' => 1,
'alphalabsfoundationbundle.php' => 1,
'alphalabsfilterenginebundle.php' => 1,
'extendedrights.php' => 1,
'testcases.php' => 1,
'style' => 1,
'theme-sample.php' => 1,
'nginxpushstreambundle.php' => 1,
'locationbundle.php' => 1,
'brixtemplatebundle.php' => 1,
'brixcorebundle.php' => 1,
'brixadminbundle.php' => 1,
'symbolclass.php' => 1,
'qevix.php' => 1,
'laravel-5.png' => 1,
'initdatabase.php' => 1,
'timeagoformatter.php' => 1,
'alexdpysimpleaclbundle.php' => 1,
'alexdpyaclbundle.php' => 1,
'phpaudit' => 1,
'batch.cmd' => 1,
'nf_define.php' => 1,
'field_collection.theme.css' => 1,
'eventreposity.php' => 1,
'guildrank.php' => 1,
'guildproperties.php' => 1,
'guildmembership.php' => 1,
'playerproperties.php' => 1,
'playeronline.php' => 1,
'accountregistration.php' => 1,
'accountproperties.php' => 1,
'.stepuprc' => 1,
'identity.php' => 1,
'anunapress.php' => 1,
'speedtest.php' => 1,
'gremlin.php' => 1,
'basiccron.php' => 1,
'creature.php' => 1,
'strogeinterface.php' => 1,
'stroge.php' => 1,
'encryptedstroge.php' => 1,
'drivernotfoundexception.php' => 1,
'cachesessionhandler.php' => 1,
'typehint.php' => 1,
'securitykeygenerator.php' => 1,
'keygeneratorinterface.php' => 1,
'csrftokeninterface.php' => 1,
'accesssecurity.php' => 1,
'terminateinterface.php' => 1,
'routematcherinterface.php' => 1,
'newsitem.php' => 1,
'gender.php' => 1,
'routematchexception.php' => 1,
'appventusdatamigrationbundle.php' => 1,
'taigabundle.php' => 1,
'avpixelartbundle.php' => 1,
'avphpdocfillbundle.php' => 1,
'avmultidomainbundle.php' => 1,
'orderevents.php' => 1,
'appventusmangopayevents.php' => 1,
'appventusmangopaybundle.php' => 1,
'pre-commit.add.sample' => 1,
'appventus.pre-commit.tester' => 1,
'appventusfacebookgraphbundle.php' => 1,
'dybapibundle.php.fix-case' => 1,
'dybapibundle.php' => 1,
'bankconnector.php' => 1,
'spell.php' => 1,
'avbootstrapalmanachbundle.php' => 1,
'aviarybundle.php' => 1,
'avtwitterposterbundle.php' => 1,
'avawesomespoolmailerbundle.php' => 1,
'avossusbundle.php' => 1,
'avlistbundle.php' => 1,
'avbitlybundle.php' => 1,
'avawesomeshortcutsbundle.php' => 1,
'avajaxbundle.php' => 1,
'avautoformfillbundle.php' => 1,
'avasseticinjectorbundle.php' => 1,
'world.php' => 1,
'vocation.php' => 1,
'routematcher.php' => 1,
'routecollector.php' => 1,
'nf_functions.php' => 1,
'bigmath.php' => 1,
'prediscachedriver.php' => 1,
'memcachedriver.php' => 1,
'flushableinterface.php' => 1,
'filecachedriver.php' => 1,
'drivernotflushableexception.php' => 1,
'driveradapterinterface.php' => 1,
'driveradapter.php' => 1,
'configrepository.php' => 1,
'arraycachedriver.php' => 1,
'apccachedriver.php' => 1,
'numeralsystem.php' => 1,
'bignumber.php' => 1,
'threadpool.php' => 1,
'rediscachedriver.php' => 1,
'thread.php' => 1,
'simplethread.php' => 1,
'socketstream.php' => 1,
'socketreal.php' => 1,
'asocket.php' => 1,
'phpgen.php' => 1,
'iphpgenerable.php' => 1,
'customcode.php' => 1,
'eventbuffer.php' => 1,
'eventbasic.php' => 1,
'eventbase.php' => 1,
'hookpiwikanalytics.php' => 1,
'nfc.php' => 1,
'predisclientexception.php' => 1,
'xcachedriver.php' => 1,
'modeldispatcher.php' => 1,
'swiftattachment.php' => 1,
'middlewareexception.php' => 1,
'filtermatchexception.php' => 1,
'filterbag.php' => 1,
'controllerdispatcherinterface.php' => 1,
'ascollector.php' => 1,
'actiondispatcherinterface.php' => 1,
'actiondispatcher.php' => 1,
'accessdispatcherinterface.php' => 1,
'accessdispatcher.php' => 1,
'accessbag.php' => 1,
'swiftmailerdriver.php' => 1,
'swiftattachmentinterface.php' => 1,
'phpmailerdriver.php' => 1,
'zenddatacache.php' => 1,
'phpmailerattachmentinterface.php' => 1,
'phpmailerattachment.php' => 1,
'attachmentinterface.php' => 1,
'serverhttpheaders.php' => 1,
'routenotfoundexception.php' => 1,
'requestheaders.php' => 1,
'redirecturlemptyexception.php' => 1,
'httpresponseexception.php' => 1,
'filenotuploadedexception.php' => 1,
'eventnotfoundexception.php' => 1,
'eventnameexception.php' => 1,
'eventlistenerexception.php' => 1,
'eventcollector.php' => 1,
'field_collections-1316162-227.patch' => 1,
'field_collection.test' => 1,
'appscoassertionvoterbundle.php' => 1,
'multiselectlistbox.php' => 1,
'buttontableexport.php' => 1,
'resourcemanagerinterface.php' => 1,
'filesystemresourcemanager.php' => 1,
'amazons3resourcemanager.php' => 1,
'pjaxfilter.php' => 1,
'inboundmessage.php' => 1,
'inboundcallbackevent.php' => 1,
'inboundcallbackaction.php' => 1,
'deliveryreceipt.php' => 1,
'deliverycallbackevent.php' => 1,
'deliverycallbackaction.php' => 1,
'multiselectlistboxasset.php' => 1,
'multiselect.php' => 1,
'tableexportaction.php' => 1,
'togglecolumnasset.php' => 1,
'toggleaction.php' => 1,
'place.php' => 1,
'timezonepicker.php' => 1,
'statepicker.php' => 1,
'phoneinput.php' => 1,
'numberinput.php' => 1,
'languagepicker.php' => 1,
'googlefontpicker.php' => 1,
'fontsizepicker.php' => 1,
'fontpicker.php' => 1,
'currencypicker.php' => 1,
'buttontableexportasset.php' => 1,
'translateablebehavior.php' => 1,
'colorpicker.php' => 1,
'selenium-server-standalone-2.47.1.jar' => 1,
'missing-builtins.php' => 1,
'inimltest.php' => 1,
'iniml.php' => 1,
'pdo2test.php' => 1,
'pdo2.php' => 1,
'archiemltest.php' => 1,
'archieml.php' => 1,
'init_framework.php' => 1,
'init_config_javascript.php' => 1,
'licence_cecill-b_v1-fr' => 1,
'licence_cecill-b_v1-en' => 1,
'towel.php' => 1,
'update.ps1' => 1,
'basetransliteratorhelper.php' => 1,
'fortytwo-2fa.php' => 1,
'.rsyncignore' => 1,
'tagging.xml' => 1,
'idna.php' => 1,
'additional.php' => 1,
'a3mgrussianpostbundle.php' => 1,
'your.log' => 1,
'tito.php' => 1,
'1.php' => 1,
'photoitem.php' => 1,
'photocollection.php' => 1,
'carbon-pagination.php' => 1,
'transliteratorhelper.php' => 1,
'countrypicker.php' => 1,
'bootstrapformhelperstrait.php' => 1,
'tagtest.php' => 1,
'helper-functions.php' => 1,
'twentystepswemonitbundle.php' => 1,
'twentystepsplacetelbundle.php' => 1,
'twentystepscommonsensurebundle.php' => 1,
'ensureexception.php' => 1,
'ensure.php' => 1,
'twentystepscollmexbundle.php' => 1,
'twentystepsautotablesbundle.php' => 1,
'composer-autoload.php' => 1,
'contao-sass-watch-settings.png' => 1,
'oneupflysystembundle.php' => 1,
'oneupaclbundle.php' => 1,
'composer-bootstrap.php' => 1,
'customizer.php' => 1,
'teslaclientbundle.php' => 1,
'intaropostgressearchbundle.php' => 1,
'intaronativequerybuilderbundle.php' => 1,
'intaromemcachedtagsbundle.php' => 1,
'slackhookserviceprovider.php' => 1,
'htmltotext.php' => 1,
'thecsv.php' => 1,
'wp_mock.php' => 1,
'swiftstream.php' => 1,
'hive' => 1,
'meuptagcommanderbundle.php' => 1,
'meupgeolocationbundle.php' => 1,
'osirisdevshortcutsbundle.php' => 1,
'application.ini-dist' => 1,
'teslaapikeysecuritybundle.php' => 1,
'assembler.php' => 1,
'bootstrapformhelpersasset.php' => 1,
'efeeditemrss2.php' => 1,
's3command.php' => 1,
's3assetmanager.php' => 1,
'cdnassetmanager.php' => 1,
'assetmanagertrait.php' => 1,
'iresourcemanager.php' => 1,
'efsresourcemanager.php' => 1,
'eamazons3resourcemanager.php' => 1,
'escriptboost.php' => 1,
'eclientscriptboost.php' => 1,
'eassetmanagerboost.php' => 1,
'egeoip.php' => 1,
'efeedtag.php' => 1,
'efeeditemrss1.php' => 1,
'assemblerinterface.php' => 1,
'efeeditematom.php' => 1,
'efeeditemabstract.php' => 1,
'efeed.php' => 1,
'.editoconfig' => 1,
'zweigrammjqueryuibundle.php' => 1,
'zweigrammjquerybundle.php' => 1,
'notificationserviceinterface.php' => 1,
'notificationreceiverinterface.php' => 1,
'abstractnotificationservice.php' => 1,
'teslaesyncbundle.php' => 1,
'teslawsbundle.php' => 1,
'tesladtobundle.php' => 1,
'metadatareader.php' => 1,
'config-defaults.php' => 1,
'fdevsblockbundle.php' => 1,
'field_collection.pages.inc' => 1,
'picture.php' => 1,
'asoccompassomatorbundle.php' => 1,
'asocasseticangularjsbundle.php' => 1,
'evercookiewidget.php' => 1,
'artackmxapi.php' => 1,
'artackmxapibundle.php' => 1,
'update_package.sh' => 1,
'build.bootstrap.xml' => 1,
'phpalgo' => 1,
'googleplay-api.php' => 1,
'krsmailbundle.php' => 1,
'license.text' => 1,
'servicecontainerbuilder.php' => 1,
'authenticationfactory.php' => 1,
'basetype.php' => 1,
'abmundidatabasecommandsbundle.php' => 1,
'projectinventorybundle.php' => 1,
'a5syspdfbundle.php' => 1,
'overlaybundle.php' => 1,
'loggedinredirectionbundle.php' => 1,
'easyadminpopupbundle.php' => 1,
'doctrinetraitbundle.php' => 1,
'soaptest.php' => 1,
'test-s3.php' => 1,
'test-http.php' => 1,
'ergo.php' => 1,
'c975lxliffbundle.php' => 1,
'phpbb_session_handler.php' => 1,
'.gitgnore' => 1,
'spsrapi.php' => 1,
'phpbbuservalidation.php' => 1,
'apyjsformvalidationbundle.php' => 1,
'field_collection.module' => 1,
'field_collection.migrate.inc' => 1,
'field_collection.install.orig' => 1,
'field_collection.install' => 1,
'field_collection.info.inc' => 1,
'field_collection.info' => 1,
'field_collection.api.php' => 1,
'field_collection.admin.inc' => 1,
'field-collection-item.tpl.php' => 1,
'accordpostmarkswiftmailerbundle.php' => 1,
'radius' => 1,
'jsfvevents.php' => 1,
'apybreadcrumbtrailbundle.php' => 1,
'spsrexception.php' => 1,
'triviabot.sql' => 1,
'questions.sql.zip' => 1,
'andikickboxbundle.php' => 1,
'websecurity.php' => 1,
'testindex.php' => 1,
'request_logging.php' => 1,
'ajax-get.php' => 1,
'about.php' => 1,
'wpcom-legacy-redirector.php' => 1,
'page-template-finder.php' => 1,
'ms-custom-signup.php' => 1,
'xml_synopsis' => 1,
'tbs_plugin_opentbs.html' => 1,
'phpbbclass.php' => 1,
'phpbb.php' => 1,
'fdevsbowerphpbundle.php' => 1,
'metabuilder.php' => 1,
'tagmanagerinterface.php' => 1,
'taginterface.php' => 1,
'fdevsstaticpagebundle.php' => 1,
'fdevssitemapbundle.php' => 1,
'fdevsroutingbundle.php' => 1,
'fdevspagebundle.php' => 1,
'abstractmigration.php' => 1,
'fdevsmigrationbundle.php' => 1,
'metaregistry.php' => 1,
'metainterface.php' => 1,
'metafactory.php' => 1,
'metabuilderinterface.php' => 1,
'fdevsmenuevents.php' => 1,
'fdevsfilebundle.php' => 1,
'fdevsmenubundle.php' => 1,
'translatorpriority.php' => 1,
'localetrait.php' => 1,
'localetextinterface.php' => 1,
'localeinterface.php' => 1,
'fdevsgeobundle.php' => 1,
'fdevselfinderbundle.php' => 1,
'fdevscontactusbundle.php' => 1,
'fdevscontactlistbundle.php' => 1,
'contactinterface.php' => 1,
'contactfactory.php' => 1,
'connectinterface.php' => 1,
'fdevscatalogbundle.php' => 1,
'fdevstagbundle.php' => 1,
'fdevslocale.php' => 1,
'phpbbwebuser.php' => 1,
'emailbundle.php' => 1,
'assistbundle.php' => 1,
'.samurai' => 1,
'sevenmanagerbundle.php' => 1,
'gradle.properties' => 1,
'shswitchview.iml' => 1,
'typo3-probe.php' => 1,
'nanawebjapaneseholidaybundle.php' => 1,
'nanawebjapaneseformbundle.php' => 1,
'chbox.php' => 1,
'chbox.js' => 1,
'ocf.php' => 1,
'emailreader.php' => 1,
'withdrawform.php' => 1,
'fdevslocalebundle.php' => 1,
'arthemgraphqlbundle.php' => 1,
'following-diagram.png' => 1,
'publishablereadinterface.php' => 1,
'publishableinterface.php' => 1,
'publishworkflow.php' => 1,
'publishtimereadinterface.php' => 1,
'publishtimeinterface.php' => 1,
'publishstartreadinterface.php' => 1,
'publishstartinterface.php' => 1,
'publishreadinterface.php' => 1,
'publishinterface.php' => 1,
'publishendreadinterface.php' => 1,
'publishendinterface.php' => 1,
'appartincorebundle.php' => 1,
'bwccomponentfiribundle.php' => 1,
'module-gift-message.csv' => 1,
'test-update' => 1,
'besimplememcachedbundle.php' => 1,
'besimpledoctrinetypesbundle.php' => 1,
'baun' => 1,
'auto-install.php' => 1,
'symfony2locbundle.php' => 1,
'filestorage.php' => 1,
'server_start.sh' => 1,
'twr' => 1,
'triggermanager.php' => 1,
'processstatushandler.php' => 1,
'innmindprovisionerbundle.php' => 1,
'decisionmanager.php' => 1,
'test-relation' => 1,
'soapmessage.php' => 1,
'test-insert' => 1,
'test-init' => 1,
'test-get' => 1,
'test-delete' => 1,
'bancklehelpdeskbundle.php' => 1,
'bancklecrmbundle.php' => 1,
'update_info' => 1,
'radikal.php' => 1,
'range.php' => 1,
'clockpicker.php' => 1,
'bob.php' => 1,
'browseassets.php' => 1,
'abstractsoapbuilder.php' => 1,
'soaprequestfilter.php' => 1,
'.apigen.neon' => 1,
'trakio.png' => 1,
'beelabsimplepagebundle.php' => 1,
'beelabrecaptcha2bundle.php' => 1,
'beelabphoneverificationbundle.php' => 1,
'beelabpaypalbundle.php' => 1,
'beelabmemoryrepositorybundle.php' => 1,
'beelablaptypebundle.php' => 1,
'becklynstaticrolesbundle.php' => 1,
'becklynradbundle.php' => 1,
'becklynpagetreebundle.php' => 1,
'becklynfacebookbundle.php' => 1,
'beatsbundle.php' => 1,
'sypexdumper.php' => 1,
'remote_url.png' => 1,
'soapresponsefilter.php' => 1,
'mixpanel.png' => 1,
'mailchimp.png' => 1,
'jira.png' => 1,
'hipchat.png' => 1,
'ui-test.php' => 1,
'highrise.png' => 1,
'constant_contact.png' => 1,
'campaignmonitor.png' => 1,
'soapserverbuilder.php' => 1,
'soapserver.php' => 1,
'wsdlhandler.php' => 1,
'wssecuritykey.php' => 1,
'wssecurityfilterclientserver.php' => 1,
'poem.ja' => 1,
'nmbtwigextensionsbundle.php' => 1,
'beelabtestbundle.php' => 1,
'phpdoc.cmd' => 1,
'harbourreleasebundle.module.xml' => 1,
'harbourmailerbundle.php' => 1,
'harbourmailerbundle.module.xml' => 1,
'harbourloggerbundle.php' => 1,
'harbourloggerbundle.module.xml' => 1,
'coralsitebundle.php' => 1,
'coralfilebundle.php' => 1,
'coralfilebundle.module.xml' => 1,
'coralcorebundle.php' => 1,
'coralcontentbundle.php' => 1,
'coralcontentbundle.module.xml' => 1,
'atipikhoawebsocketbundle.php' => 1,
'translator.class.php' => 1,
'harbourunsubscribebundle.module.xml' => 1,
'ashleydawsonsimplepaginationbundle.php' => 1,
'adperfilbundle.php' => 1,
'addependselectbundle.php' => 1,
'adboletabundle.php' => 1,
'wxrnewsbundle.php' => 1,
'wxrgeobundle.php' => 1,
'wxreventbundle.php' => 1,
'wxrdirectorybundle.php' => 1,
'wxrcontentbundle.php' => 1,
'wxrcommonbundle.php' => 1,
'wxrcategorybundle.php' => 1,
'options.yml' => 1,
'artbreadcrumbsbundle.php' => 1,
'harbourreleasebundle.php' => 1,
'harbourunsubscribebundle.php' => 1,
'nmbtinymcebundle.php' => 1,
'predict.php' => 1,
'iodocsgen' => 1,
'update_project_components_statuses.drush.inc' => 1,
'variables.sh' => 1,
'drupal-builder' => 1,
'highcosphinxbundle.php' => 1,
'nocsrf.php' => 1,
'bear.php' => 1,
'php-config.ini' => 1,
'cucumber.yml' => 1,
'filemoduletrait.php' => 1,
'filemodule.php' => 1,
'search.xml' => 1,
'phpbu.xml_example' => 1,
'phpspec.yml.hhvm.7' => 1,
'avtonomsemaphorebundle.php' => 1,
'avtonommediastorageclientbundle.php' => 1,
'avtonomcreolebundle.php' => 1,
'thekwastiwikibundle.php' => 1,
'formalin.uml' => 1,
'autobotposterbundle.php' => 1,
'test-sample-codes.sh' => 1,
'sample-code-php' => 1,
'genclass.sh' => 1,
'aitcmsbundle.php' => 1,
'aurejajobqueuebundle.php' => 1,
'rick.png' => 1,
'phpunit_bs.php' => 1,
'beelabtagbundle.php' => 1,
'beelabuserbundle.php' => 1,
'iqsms_json.php' => 1,
'symfony2appbundle.php' => 1,
'module-bundle.csv' => 1,
'module-bundle-import-export.csv' => 1,
'module-braintree.csv' => 1,
'module-backup.csv' => 1,
'module-backend.csv' => 1,
'module-authorizenet.csv' => 1,
'module-authorization.csv' => 1,
'module-advanced-pricing-import-export.csv' => 1,
'module-admin-notification.csv' => 1,
'ftp.class.php' => 1,
'assertions' => 1,
'env.ministryplatform' => 1,
'blackboxcodepandocontentbundle.php' => 1,
'module-captcha.csv' => 1,
'webpack.config.js' => 1,
'image_moo.php' => 1,
'license-grocery-crud' => 1,
'examples_database.sql.zip' => 1,
'woocommerce-facebook-remarketing.php' => 1,
'emails' => 1,
'emails.php' => 1,
'emails.json' => 1,
'design' => 1,
'bips' => 1,
'birkneralexxenforoauthbundle.php' => 1,
'sub-plugins.php' => 1,
'ikadockcfinderbundle.php' => 1,
'module-cache-invalidate.csv' => 1,
'module-catalog-import-export.csv' => 1,
'resultobject.php' => 1,
'module-cron.csv' => 1,
'module-fedex.csv' => 1,
'module-encryption-key.csv' => 1,
'module-email.csv' => 1,
'module-eav.csv' => 1,
'module-downloadable.csv' => 1,
'module-downloadable-import-export.csv' => 1,
'module-directory.csv' => 1,
'module-dhl.csv' => 1,
'module-developer.csv' => 1,
'module-customer.csv' => 1,
'module-customer-import-export.csv' => 1,
'module-currency-symbol.csv' => 1,
'module-cookie.csv' => 1,
'module-catalog-inventory.csv' => 1,
'module-contact.csv' => 1,
'module-configurable-product.csv' => 1,
'module-configurable-import-export.csv' => 1,
'module-config.csv' => 1,
'module-cms.csv' => 1,
'module-cms-url-rewrite.csv' => 1,
'module-checkout.csv' => 1,
'module-checkout-agreements.csv' => 1,
'module-catalog.csv' => 1,
'module-catalog-widget.csv' => 1,
'module-catalog-url-rewrite.csv' => 1,
'module-catalog-search.csv' => 1,
'module-catalog-rule.csv' => 1,
'cleaninstall' => 1,
'bigfishuserbundle.php' => 1,
'beelabuserpasswordbundle.php' => 1,
'stylista-blogger-navigation.php' => 1,
'mysql.address.sql' => 1,
'bootstrap.tests.php' => 1,
'antwebbundle.php' => 1,
'antuserbundle.php' => 1,
'antmediabundle.php' => 1,
'antadminbundle.php' => 1,
'white-album-external-header.php' => 1,
'wp-s3-must-use.php' => 1,
'wp-manual-cu.php' => 1,
'wp-cxense.php' => 1,
'wa-external-header-v2.php' => 1,
'stylista-menu-plugin.php' => 1,
'bloggernavigation.php' => 1,
'brapibundle.php' => 1,
'trapp' => 1,
'indexsearch' => 1,
'bonnier-admin' => 1,
'bencsigeobundle.php' => 1,
'pubkey.pem' => 1,
'example-quick-configure.json' => 1,
'bellashayepaypalbundle.php' => 1,
'betaup.jpg' => 1,
'modalbasset.php' => 1,
'modalb.php' => 1,
'libpath.php' => 1,
'behatbundle.php' => 1,
'bktrackerhubbundle.php' => 1,
'salesforcestrategy.php' => 1,
'brauthbundle.php' => 1,
'nestedmatcher.php' => 1,
'eavpersisterevents.php' => 1,
'bigfishroutingbundle.php' => 1,
'resolveresourceentities.php' => 1,
'bigfishresourcebundle.php' => 1,
'pagekitgridtypes.php' => 1,
'bigfishpagekitbundle.php' => 1,
'resolvemediaentities.php' => 1,
'mediatypes.php' => 1,
'bigfishmediabundle.php' => 1,
'resolvelanguageentities.php' => 1,
'bigfishlanguagebundle.php' => 1,
'bigfishgridbundle.php' => 1,
'resolveeaventities.php' => 1,
'eavevents.php' => 1,
'brtokenbundle.php' => 1,
'eavcategories.php' => 1,
'bigfisheavbundle.php' => 1,
'testrouting.php' => 1,
'resolvecoreentities.php' => 1,
'bigfishcorebundle.php' => 1,
'resolvecontextentities.php' => 1,
'bigfishcontextbundle.php' => 1,
'bigfishconfigurationbundle.php' => 1,
'brspineapplebundle.php' => 1,
'ebsco-widget.php' => 1,
'bgazeparsedownbundle.php' => 1,
'ocok' => 1,
'bruserapibundle.php' => 1,
'phpunit.example.conf' => 1,
'rtf.class.php' => 1,
'firi.php' => 1,
'movie.rb' => 1,
'taxgator.rb' => 1,
'stocktickerservlet.rb' => 1,
'scratchx' => 1,
'queue.rb~' => 1,
'queue.rb' => 1,
'qaerodiacorp.sav' => 1,
'product.rb' => 1,
'osstartscreen.py' => 1,
'num.rb' => 1,
'notakerpro.aia' => 1,
'mysqldumper1.24.4.zip' => 1,
'movielibrary.rb' => 1,
'middleware' => 1,
'ticker.rb~' => 1,
'middleware.rb' => 1,
'mapsly.zip' => 1,
'mapsly (3).zip' => 1,
'mapsly (2).zip' => 1,
'malaika.zip' => 1,
'listing.rb' => 1,
'f16shell.rb' => 1,
'f16mudtape.rb' => 1,
'f16mudcockpitservlet.rb' => 1,
'chesstize.zip' => 1,
'chesstize (2).zip' => 1,
'bingcherry.zip' => 1,
'ticker.rb' => 1,
'weakhash.rb' => 1,
'archervmexception.rb' => 1,
'american_imperialism2.ppt' => 1,
'compiler.py' => 1,
'collaborant-0.1.0.gem' => 1,
'codecip.py' => 1,
'cockpitguess.py' => 1,
'cargo.cmd' => 1,
'cargo.bat' => 1,
'cards.py' => 1,
'bucketwise-master.zip' => 1,
'autoexec.bat' => 1,
'arp.php' => 1,
'archersys-logo.png' => 1,
'arbylog.rb' => 1,
'alarmpy.py' => 1,
'wikipage.rb' => 1,
'ager.py' => 1,
'activate_docs_gen' => 1,
'activate_docs_gen.bat' => 1,
'acoserver_moodle.sql' => 1,
'acoserver_games.sql' => 1,
'acoserver_admin.sql' => 1,
'acoserver_acoserver.sql' => 1,
'acoserver_acoserver (2).sql' => 1,
'_.swp' => 1,
'_.swo' => 1,
'_.swn' => 1,
'zlibengine.rb' => 1,
'wikipage.rb~' => 1,
'bingcherry.bryapp' => 1,
'archervmcashewtimeserver.rb~' => 1,
'contacts.db' => 1,
'158671-owncloud_editdoc.zip' => 1,
'.git.cmd.swp' => 1,
'.buildinfo' => 1,
'.authorize.php.swp' => 1,
'.ticker.rb.swp' => 1,
'.aerodiaserver.rb.swp' => 1,
'.302.html.swp' => 1,
'-interactive' => 1,
'occ' => 1,
'indie.json' => 1,
'db_structure.xml' => 1,
'copying-agpl' => 1,
'160265-ocdashboard_v1.3.1.zip' => 1,
'tourlib.js' => 1,
'.index.php.swp' => 1,
'landing-page.css' => 1,
'jquery.hipchat.js' => 1,
'canvashoppe-css.css' => 1,
'bootstrap-tour.min.js' => 1,
'bootstrap-tour.min.css' => 1,
'bootstrap-tour.js' => 1,
'bootstrap-tour.css' => 1,
'bootstrap-tour-tutorial' => 1,
'pdfljs.js' => 1,
'copy of index.php' => 1,
'arcavias.php' => 1,
'apichange' => 1,
'arachniasfoundationbundle.php' => 1,
'.index.php.swo' => 1,
'.irb.cmd.swp' => 1,
'archervmcashewtimeserver.rb' => 1,
'aerodiaserver.rb~' => 1,
'archervmcashewlogger.rb~' => 1,
'archervmcashewlogger.rb' => 1,
'archervmcashewdelegator.rb' => 1,
'archersysosoptionsparser.rb~' => 1,
'archersysosoptionsparser.rb' => 1,
'archersysosdate.rb' => 1,
'archersysos.rb' => 1,
'archersysos.gemspec' => 1,
'archerscript' => 1,
'archerdbm.rb' => 1,
'archercgi' => 1,
'aerodiaserver' => 1,
'aerodiaserver.rb' => 1,
'.irb_history' => 1,
'aerodia2.scn' => 1,
'abstractimplementation.rb' => 1,
'abstractarrbyklass.rb' => 1,
'8_imperialism_by_the_united_states2.ppt' => 1,
'7imperialisminjapan2.ppt' => 1,
'302.html' => 1,
'.vimstarter.bat.swp' => 1,
'.taskmanager.py.swp' => 1,
'.login.php.swp' => 1,
'.login.php.swo' => 1,
'.login.php.swn' => 1,
'.irbrc~' => 1,
'.irbrc' => 1,
'conchtack_id.dat' => 1,
'contrib-update.cmd' => 1,
'webicqpro.class.php' => 1,
'tess.py' => 1,
'yo' => 1,
'wallpaper.php' => 1,
'virtphp.phar' => 1,
'vimstarter.bat' => 1,
'uru_rt.exe' => 1,
'uru.ps1.bak' => 1,
'uru.ps1' => 1,
'uru.bat.bak' => 1,
'uru.bat' => 1,
'urllib2.py' => 1,
'time.html' => 1,
'time.css' => 1,
'startup.png' => 1,
'hello-world.php' => 1,
'startscreen.py' => 1,
'startscreen.php' => 1,
'specs.4.8.gz' => 1,
'specs.4.8' => 1,
'sinatra-1.4.5.gem' => 1,
'setupgit.bat' => 1,
'setupgit.ba' => 1,
'setup-owncloud.php' => 1,
'setup-account.py' => 1,
'searchindex.js' => 1,
'sample' => 1,
'rustc.cmd' => 1,
'runestone' => 1,
'yo.cmd' => 1,
'test-gravatar.php' => 1,
'rockpaperscissors.py' => 1,
'validcommentaire.php' => 1,
'erdiko.php' => 1,
'defaultconfiguration.php' => 1,
'arrogancemailrelaybundle.php' => 1,
'apimethodinterface.php' => 1,
'migrator' => 1,
'anonymizer' => 1,
'reactioncompatible.php' => 1,
'reaction.php' => 1,
'actioncompatible.php' => 1,
'config.sample.yml' => 1,
'newstab.php' => 1,
'categorybreadcrumb.php' => 1,
'testlink.php' => 1,
'wp-bird.php' => 1,
'resizeimage.php' => 1,
'readlog.php' => 1,
'maintenance.html' => 1,
'indexok.php' => 1,
'indexmaintenance2.php' => 1,
'imagezoomzone.php' => 1,
'getphotosquare.php' => 1,
'getphotoredimensionnee.php' => 1,
'getphotohome.php' => 1,
'findorphans.php' => 1,
'copypersons.php' => 1,
'mcd archi-strasbourg.mwb' => 1,
'archi_v2.sql' => 1,
'run_f16.rb' => 1,
'riphone.php' => 1,
'contrib-update.cmd~' => 1,
'git.cmd~' => 1,
'latest_specs.4.8.gz' => 1,
'latest_specs.4.8' => 1,
'irb.cmd~' => 1,
'irb.cmd' => 1,
'iostarter.py' => 1,
'installer_apps.php' => 1,
'htdocs.gemspec~' => 1,
'htdocs.gemspec' => 1,
'histogram.py' => 1,
'grillo' => 1,
'gitstat.php' => 1,
'githubstats.phjp' => 1,
'git-lfs.exe' => 1,
'meter.js' => 1,
'genindex.html' => 1,
'game1.py' => 1,
'ftpindex.php' => 1,
'forum.php' => 1,
'f18mud.rb' => 1,
'evennia' => 1,
'etupgit.bat' => 1,
'drupal-7.34.zip' => 1,
'dictionary_of_words.db' => 1,
'dict.rb' => 1,
'desktop-w10.php' => 1,
'desktop-modo.php' => 1,
'decompiler.py' => 1,
'login.php~' => 1,
'moodle.sqk' => 1,
'radius.py' => 1,
'os-mobile.php' => 1,
'pyvenv.cfg' => 1,
'pygubu-asos.py' => 1,
'pyconsole.py' => 1,
'puttytel.exe' => 1,
'putty.exe' => 1,
'pscp.exe' => 1,
'profile_weldon.jpg' => 1,
'prerelease_specs.4.8.gz' => 1,
'prerelease_specs.4.8' => 1,
'pip-selfcheck.json' => 1,
'phpliteadmin_v1-9-5.zip' => 1,
'phpldapadmin-1.2.3.zip' => 1,
'os-desktop.php' => 1,
'moodle.sql' => 1,
'objects.inv' => 1,
'npm.cmd' => 1,
'npm' => 1,
'now.bat' => 1,
'notifications-gateway.php' => 1,
'nodevars.bat' => 1,
'nodejs-portable.bat' => 1,
'node_perfctr_provider.man' => 1,
'node_etw_provider.man' => 1,
'node.exe' => 1,
'news.py' => 1,
'mud_login.rb' => 1,
'movielibrary.rhtml' => 1,
'modelkeybase.php' => 1,
'retrieveresult.php' => 1,
'stg' => 1,
'barcode.php' => 1,
'lightmakerdynamosessionhandlerbundle.php' => 1,
'lightmakercomplexifybundle.php' => 1,
'lightmakerawsbundle.php' => 1,
'litcvideoplayerbundle.php' => 1,
'litctestbundle.php' => 1,
'litckeywordbundle.php' => 1,
'litcheadbundle.php' => 1,
'lextyflashybundle.php' => 1,
'timesync.php' => 1,
'memory.php' => 1,
'gdata.php' => 1,
'dojo.php' => 1,
'levelabdoctrinediscriminatorbundle.php' => 1,
'lilaconceptsbestpracticebundle.php' => 1,
'level42notjaxbbundle.php' => 1,
'gitlabhookbundle.php' => 1,
'dice.php' => 1,
'axel.php' => 1,
'leobenoistsocketbundle.php' => 1,
'swsmapigenericbundle.php' => 1,
'alphavisitortrackingbundle.php' => 1,
'alphatwigbundle.php' => 1,
'alphatagbundle.php' => 1,
'gocardlessenterprisebundle.php' => 1,
'whoopsbundle.php' => 1,
'twitterbundle.php' => 1,
'likibuclient.phar' => 1,
'limeniusaramblageneratorbundle.php' => 1,
'oauthsignaturemethodplaintext.php' => 1,
'nodecollection.php' => 1,
'altstuvizbundle.php' => 1,
'searchaction.php' => 1,
'requestquerytrait.php' => 1,
'curlevent.php' => 1,
'countaction.php' => 1,
'locationpicker.php' => 1,
'.license_header' => 1,
'userserviceprovider.php' => 1,
'transserviceprovider.php' => 1,
'trans.php' => 1,
'languagenegotiator.php' => 1,
'assetcontainer.php' => 1,
'menuserviceprovider.php' => 1,
'limeniusfilesystemrouterbundle.php' => 1,
'hashidsserviceprovider.php' => 1,
'litgrouphttpclientbundle.php' => 1,
'litgroupgearmanbundle.php' => 1,
'litgroupeventloopbundle.php' => 1,
'litgroupdnsbundle.php' => 1,
'service_container.module' => 1,
'service_container.install' => 1,
'service_container.info' => 1,
'hack' => 1,
'linkvaluemobilenotifbundle.php' => 1,
'dynamicformaware.php' => 1,
'filehandlerfactory.php' => 1,
'limeniusreactbundle.php' => 1,
'oauthsignaturemethodrsasha1.php' => 1,
'oauthsignaturemethodhmacsha1.php' => 1,
'altstuvizmain.php' => 1,
'laravist' => 1,
'flowjswidget.php' => 1,
'flowjscontroller.php' => 1,
'flowjsasset.php' => 1,
'flowjs.php' => 1,
'skeletondump.sql' => 1,
'._license' => 1,
'laurentschoolbundle.php' => 1,
'laurentpiabundle.php' => 1,
'laurentbulletinbundle.php' => 1,
'api_details.dist.php' => 1,
'laulamanappsodrbundle.php' => 1,
'daybreakstudiosairbrakebundle.php' => 1,
'lapalabsuserprofilebundle.php' => 1,
'megaplanauth.php' => 1,
'lapalabsskeletonbundle.php' => 1,
'lapalabsratingbundle.php' => 1,
'lapalabscurrencybundle.php' => 1,
'lapalabscountrybundle.php' => 1,
'readme-1.0' => 1,
'landmarxuserbundle.php' => 1,
'landmarxlocationbundle.php' => 1,
'landmarxlandmarkbundle.php' => 1,
'lankitjquerybundle.php' => 1,
'lankitdatatablesbundle.php' => 1,
'netlicensing.php' => 1,
'integrationtest.sh' => 1,
'lpisearchbundle.php' => 1,
'mpauthexception.php' => 1,
'refresh.sh' => 1,
'modelstate.php' => 1,
'funmismsbundle.php' => 1,
'lightaccessbundle.php' => 1,
'imodel.php' => 1,
'generatorbundle.php' => 1,
'distributionbundle.php' => 1,
'libreoffice.cde' => 1,
'convert.cde' => 1,
'cde.uname' => 1,
'cde.options' => 1,
'cde.log' => 1,
'cde.full-environment' => 1,
'cde-exec' => 1,
'smshandler.php' => 1,
'responsehandler.php' => 1,
'lswautomaticupdatebundle.php' => 1,
'funmiresponserbundle.php' => 1,
'pagehandler.php' => 1,
'funmipaginationbundle.php' => 1,
'picturehandler.php' => 1,
'funmifilebundle.php' => 1,
'ledjinsyliussagepaybundle.php' => 1,
'ledjinsagepaybundle.php' => 1,
'lswversioninformationbundle.php' => 1,
'lswsecurecontrollerbundle.php' => 1,
'lswremotetemplatebundle.php' => 1,
'lswguzzlebundle.php' => 1,
'lswgettexttranslationbundle.php' => 1,
'lswdefaultroutingbundle.php' => 1,
'altstuvizcolorhelper.php' => 1,
'shellcommand.php' => 1,
'lpikernelbundle.php' => 1,
'mwsimplecrudgeneratorbundle.php' => 1,
'banner.jpg' => 1,
'test_streamer.php' => 1,
'doc_config.ini' => 1,
'phpta.xsd' => 1,
'phpta.xml' => 1,
'phpta' => 1,
'aippreferencebundle' => 1,
'provisioner.sh' => 1,
'ma27apikeyauthenticationevents.php' => 1,
'ma27apikeyauthenticationbundle.php' => 1,
'mwsimplelinodednsmanagerbundle.php' => 1,
'forobundle.php' => 1,
'mwsimplecrawlsitebundle.php' => 1,
'juidatepicker.php' => 1,
'mwsimpleadmincrudbundle.php' => 1,
'genfunctions.php' => 1,
'my_plugin.php' => 1,
'bootstrap-confirmation.js' => 1,
'mesduserbundle.php' => 1,
'mesdsettingsbundle.php' => 1,
'mesdphantasosclientbundle.php' => 1,
'mesdjasperreportviewerbundle.php' => 1,
'mesdjasperreportbundle.php' => 1,
'license-flowl-jasper' => 1,
'phpvs' => 1,
'subfieldinterface.php' => 1,
'bottomline.php' => 1,
'juidatepickerasset.php' => 1,
'subspecinterface.php' => 1,
'streamperklandingbundle.php' => 1,
'el_gr.csv' => 1,
'da_dk.csv' => 1,
'cs_cz.csv' => 1,
'ar_sa.csv' => 1,
'twigster.phar' => 1,
'magloftezmagicbundle.php' => 1,
'finfo.php' => 1,
'streamperkuserbundle.php' => 1,
'streamperkthemebundle.php' => 1,
'streamperkserverbundle.php' => 1,
'streamperkschedulebundle.php' => 1,
'streamperkpollbundle.php' => 1,
'streamperkcorebundle.php' => 1,
'juidatepickerlanguageasset.php' => 1,
'madrakiopersistentcommandbundle.php' => 1,
'madrakioextendablepermissionsbundle.php' => 1,
'madrakioextendableconfigurationbundle.php' => 1,
'madrakioeasyparameterdeploymentbundle.php' => 1,
'madrakioeasycrondeploymentbundle.php' => 1,
'madrakioeasyadminbundle.php' => 1,
'statemachinevisualizationbundle.php' => 1,
'pave' => 1,
'mactroniquephpcachebundle.php' => 1,
'juitimepicker.php' => 1,
'juidatetimepickerlanguageasset.php' => 1,
'juidatetimepickerasset.php' => 1,
'juidatetimepicker.php' => 1,
'subfield.php' => 1,
'subspec.php' => 1,
'shellresult.php' => 1,
'.htaccess.alt' => 1,
'humanreadablecache.php' => 1,
'compose.php' => 1,
'commentparser.php' => 1,
'pageannotatorbundle.php' => 1,
'lumbendilrottentomatoesbundle.php' => 1,
'lumbendilsharedroutersbundle.php' => 1,
'genetic' => 1,
'amp-console.php' => 1,
'amp-console' => 1,
'.kitchen.yml' => 1,
'lukaszmordawskicampaignmonitorbundle.php' => 1,
'download-configuration.php' => 1,
'luisdeimosencryptbundle.php' => 1,
'iauthenticate.php' => 1,
'lpfactorynestedsetroutingbundle.php' => 1,
'googlecustomsearch.php' => 1,
'favoritebundle.php' => 1,
'multilingualbegavior.php' => 1,
'lorenzschaefhelppagesbundle.php' => 1,
'helppages.php' => 1,
'lordbainefusionchartsbundle.php' => 1,
'lordbaineamchartsbundle.php' => 1,
'phpsass.php' => 1,
'test.scss' => 1,
'l8actioncolumn.php' => 1,
'vlchttpbundle.php' => 1,
'terminal.php' => 1,
'restler.php' => 1,
'icompose.php' => 1,
'speciterator.php' => 1,
'm6webapiexceptionbundle.php' => 1,
'positionorrangeinterface.php' => 1,
'positionorrange.php' => 1,
'marcspecparser.php' => 1,
'marcspecinterface.php' => 1,
'marcspec.php' => 1,
'comparisonstringinterface.php' => 1,
'comparisonstring.php' => 1,
'wild_combination.php' => 1,
'm6webphpprocessmanagerbundle.php' => 1,
'm6webfirewallbundle.php' => 1,
'm6webdomainuserbundle.php' => 1,
'coke' => 1,
'm4nuobjectroutebundle.php' => 1,
'iidentifyuser.php' => 1,
'm4numultidomainbundle.php' => 1,
'sqlgeo.php' => 1,
'geojsonsql.php' => 1,
'nmi3step.php' => 1,
'glide.php' => 1,
'fpdiext.php' => 1,
'git-pre-commit' => 1,
'fb-channel.php' => 1,
'conversion' => 1,
'xero.php' => 1,
'appserver.php' => 1,
'iuseauthentication.php' => 1,
'iprovidemultiversionapi.php' => 1,
'lpinewsbundle.php' => 1,
'lpifilebundle.php' => 1,
'en_us.csv' => 1,
'loginnotificatorinterface.php' => 1,
'kphoenrulerzbundle.php' => 1,
'kphoensmssenderbundle.php' => 1,
'kphoencontactbundle.php' => 1,
'hoarouterbundle.php' => 1,
'kphoendoctrinestatemachinebundle.php' => 1,
'justtexts-plugin.js' => 1,
'rulematcher.php' => 1,
'pagetemplate.php' => 1,
'pagegenerator.php' => 1,
'flushcache.php' => 1,
'userrepositoryinterface.php' => 1,
'loginservicetest.php' => 1,
'authenticatortest.php' => 1,
'janrain-union.php' => 1,
'authservicetestbase.php' => 1,
'activateservicetest.php' => 1,
'checkcwdplugin.php' => 1,
'listviewer.php' => 1,
'infologbundle.php' => 1,
'jjstoolchainbundle.php' => 1,
'jjssystemsettingsbundle.php' => 1,
'jjsresponseconverterbundle.php' => 1,
'joshuaestesgooglebundle.php' => 1,
'build.yml' => 1,
'joshuaestesamazonbundle.php' => 1,
'dutchdigitvalidator.php' => 1,
'kphoengaufretteextrasbundle.php' => 1,
'dataset.sql' => 1,
'jonnnhdynamicbundle.php' => 1,
'testovani' => 1,
'kfkitbundle.php' => 1,
'kfiuploadbundle.php' => 1,
'kfigeobundle.php' => 1,
'kfiframeworkbundle.php' => 1,
'webpageutils.php' => 1,
'kficmsbundle.php' => 1,
'kfibackupbundle.php' => 1,
'wtechrestbundle.php' => 1,
'wtechformbundle.php' => 1,
'html_icon.svg' => 1,
'validatorpanel.php' => 1,
'xxxx.blemc' => 1,
'somefoo' => 1,
'knonetranslatebundle.php' => 1,
'x' => 1,
'console.json' => 1,
'karolnettwigratingfilterbundle.php' => 1,
'.updateignore' => 1,
'changesfetcher.php' => 1,
'changesfetcherbundle.php' => 1,
'activpikentitymanagergeneratorbundle.php' => 1,
'activpikstompbundle.php' => 1,
'activpikfeedbackbundle.php' => 1,
'usage_with_anax-mvc' => 1,
'connectionpdo.php' => 1,
'migration_array.php' => 1,
'dbug.doxyfile' => 1,
'dutchdigitserviceprovider.php' => 1,
'user_recovery_password.sql' => 1,
'topdown.php' => 1,
'jsondumpdata.php' => 1,
'romannumberformatter.php' => 1,
'entrypoint.php' => 1,
'parserhooks.php' => 1,
'parserhooks.i18n.php' => 1,
'defaultconfig.php' => 1,
'maps_settings.php' => 1,
'maps.resources.php' => 1,
'maps.php' => 1,
'maps.i18n.namespaces.php' => 1,
'maps.i18n.magic.php' => 1,
'maps.i18n.alias.php' => 1,
'maps.hooks.php' => 1,
'jazawordpressintegrationbundle.php' => 1,
'subpagelist.i18n.magic.php' => 1,
'jazadrupalintegrationbundle.php' => 1,
'm3d.php' => 1,
'env.inc.php' => 1,
'triageclient.php' => 1,
'composer.json.sample' => 1,
'composerscripts.php' => 1,
'strip' => 1,
'structure.mdj' => 1,
'phpthumb.config.php.default' => 1,
'var-dump-check.php' => 1,
'var-dump-check' => 1,
'parallel-lint.php' => 1,
'parallel-lint' => 1,
'romannumberformattertest.php' => 1,
'subpagelist.php' => 1,
'user_permission.sql' => 1,
'rssitemawareinterface.php' => 1,
'jokubasrlithuaniannamesdeclensionbundle.php' => 1,
'jpcportfoliobundle.php' => 1,
'base-db.sql' => 1,
'walt' => 1,
'phpspec-coverage.yml' => 1,
'qt-faststart' => 1,
'ffprobe' => 1,
'ffmpeg' => 1,
'jmoatiswarrotbootstrapbundle.php' => 1,
'jmoatigeneratorbundle.php' => 1,
'jmoatiexiftoolbundle.php' => 1,
'rssitemawaretrait.php' => 1,
'rsschannelawaretrait.php' => 1,
'subpagelist.settings.php' => 1,
'rsschannelawareinterface.php' => 1,
'cmfrssbundle.php' => 1,
'jtuserbundle.php' => 1,
'jtadsbundle.php' => 1,
'gozer_config_template.php' => 1,
'create_oauth_tables.sql' => 1,
'checkoutruapi.php' => 1,
'jquery.masked.datevalidator.min.js' => 1,
'jquery.masked.datevalidator.js' => 1,
'jhovanictcpdfbundle.php' => 1,
'blockmodelsasset.php' => 1,
'blockmodels.php' => 1,
'validator.i18n.php' => 1,
'ongoingsitemapbundle.php' => 1,
'compare_schemas.drush.inc' => 1,
'lcpdocusignbundle.php' => 1,
'kunstmaangeneratorbundle.php' => 1,
'kunstmaanseobundle.php' => 1,
'kunstmaansearchbundle.php' => 1,
'kunstmaanredirectbundle.php' => 1,
'kunstmaanpagepartbundle.php' => 1,
'kunstmaannodesearchbundle.php' => 1,
'kunstmaannodebundle.php' => 1,
'kunstmaannewrelicbundle.php' => 1,
'kunstmaanmenubundle.php' => 1,
'kunstmaanmediapagepartbundle.php' => 1,
'kunstmaanlivereloadbundle.php' => 1,
'kunstmaanleadgenerationbundle.php' => 1,
'kunstmaanlanguagechooserbundle.php' => 1,
'kunstmaanformbundle.php' => 1,
'kunstmaantaggingbundle.php' => 1,
'kunstmaanfixturesbundle.php' => 1,
'kunstmaandashboardbundle.php' => 1,
'setup_project.sh' => 1,
'upgrade-x.x' => 1,
'upgrade-3.5' => 1,
'kunstmaanbehatbundle.php' => 1,
'kunstmaanarticlebundle.php' => 1,
'kunstmaanadminnodebundle.php' => 1,
'kunstmaanadminlistbundle.php' => 1,
'pangu.php' => 1,
'pangu-test.php' => 1,
'pangu-cli.php' => 1,
'config_databases.php' => 1,
'kunstmaansitemapbundle.php' => 1,
'kunstmaanusermanagementbundle.php' => 1,
'personawidget.php' => 1,
'lcstudiosqacommandbundle.php' => 1,
'lzaztecnotificationbundle.php' => 1,
'example-advanced.php' => 1,
'lrotherfieldnotificationbundle.php' => 1,
'form_example.php' => 1,
'example_usage.php' => 1,
'lpuploaderbundle.php' => 1,
'userscontroller.php' => 1,
'wp-config-custom-sample.php' => 1,
'robots.txt.dist' => 1,
'template-selector.php' => 1,
'wpsymfonyform.php' => 1,
'reflectionfixturebundle.php' => 1,
'lcstudiosmetacommandbundle.php' => 1,
'kunstmaanutilitiesbundle.php' => 1,
'lcstudiosldapbundle.php' => 1,
'mainmigration.php' => 1,
'aceeditorwidget.php' => 1,
'sortlist.php' => 1,
'log_out.php' => 1,
'kyoushufoundationbundle.php' => 1,
'asseticcontrollersubstitute.php' => 1,
'kwrztwigexceptionbundle.php' => 1,
'odnoklassnikistrategy.php' => 1,
'spaceport' => 1,
'gfc' => 1,
'kunstmaanvotingbundle.php' => 1,
'kunstmaanviewbundle.php' => 1,
'to-do' => 1,
'personauseridentity.php' => 1,
'environment.drush.inc' => 1,
'crunchuseradminbundle.php' => 1,
'parameters.yml~' => 1,
'wellsfargoachbundle.php' => 1,
'kitanopelbundle.php' => 1,
'kitanopaymentsipsbundle.php' => 1,
'kitanopaymentfakebundle.php' => 1,
'kitanopaymentcmcicbundle.php' => 1,
'paymentexception.php' => 1,
'kitanopaymentevents.php' => 1,
'kitanopaymentbundle.php' => 1,
'kitanocachebundle.php' => 1,
'kingboard.zip' => 1,
'ccp' => 1,
'crunchssibundle.php' => 1,
'profilesbehat3drupal.yml.sample' => 1,
'crunchcachecontrolbundle.php' => 1,
'cache-control.phar' => 1,
'kutilbundle.php' => 1,
'biogena-data.php' => 1,
'kifdoctrinetotypescriptbundle.php' => 1,
'enforce.php' => 1,
'khaldounvatvalidationbundle.php' => 1,
'urlgenerator.class.php' => 1,
'sync_tools.drush.inc' => 1,
'multidrush.drush.inc' => 1,
'multidrush.class.php' => 1,
'diagnostics.drush.inc' => 1,
'example.env.drushrc.php' => 1,
'profiles.yml.sample' => 1,
'projects.yml.sample' => 1,
'persona.php' => 1,
'readme-sk.texy' => 1,
'inittool.php' => 1,
'kchsmsapibundle.php' => 1,
'facebookconnectrestbundle.php' => 1,
'pixiv.php' => 1,
'kotori.php' => 1,
'maxim3.jpg' => 1,
'koodimonni-modifications.php' => 1,
'yandexmetrikabundle.php' => 1,
'readme.rus' => 1,
'handlersocketbundle.php' => 1,
'asseticstaticgzipbundle.php' => 1,
'validate' => 1,
'brouziesphinxybundle.php' => 1,
'settings.yml.sample' => 1,
'brouziecrossdomainauthbundle.php' => 1,
'musefactory.php' => 1,
'muse.php' => 1,
'knptimebundle.php' => 1,
'knprevealbundle.php' => 1,
'gh-changelog-template.tpl' => 1,
'knppaginatorbundle.php' => 1,
'knpoauthbundle.php' => 1,
'knpmediaexposerbundle.php' => 1,
'knpmarkupvalidatorbundle.php' => 1,
'knpmailjetbundle.php' => 1,
'knplasttweetsbundle.php' => 1,
'knpconsoleautocompletebundle.php' => 1,
'en_pt.csv' => 1,
'es_es.csv' => 1,
'yiiquaggaasset.php' => 1,
'bmconsole.php' => 1,
'bmdataobjectmap.php' => 1,
'bmdataobjectfield.php' => 1,
'bmdataobject.php' => 1,
'bmdaemon.php' => 1,
'bmcustomwebsession.php' => 1,
'bmcustomuser.php' => 1,
'bmcustomtextprocessor.php' => 1,
'bmcustomsession.php' => 1,
'bmcustomremoteprocedure.php' => 1,
'bmcustomcontentprovider.php' => 1,
'bmcustomapplication.php' => 1,
'bmcurl.php' => 1,
'bmcgi.php' => 1,
'bmffdata.php' => 1,
'bmcachelink.php' => 1,
'bmapi.php' => 1,
'load_dumps.sh' => 1,
'lib' => 1,
'ignoredfiles.tar' => 1,
'backup.sh' => 1,
'nicparrycurlbundle.php' => 1,
'codememedaemonbundle.php' => 1,
'nibynoolfitbitstoragebundle.php' => 1,
'nibynoolfitbitinterfacebundle.php' => 1,
'nhacsamdatatablesbundle.php' => 1,
'nimworkerbundle.php' => 1,
'bmdatetime.php' => 1,
'bmffobject.php' => 1,
'nimvaccinebundle.php' => 1,
'bmreferencefield.php' => 1,
'karma' => 1,
'vhost.example' => 1,
'nicocontactbundle.php' => 1,
'corezoid.php' => 1,
'sonataextendsbundle' => 1,
'lumensonataextendsbundle.php' => 1,
'test-runner' => 1,
'bmxcache.php' => 1,
'bmtools.php' => 1,
'bmtextprocessor.php' => 1,
'bmstemmer.php' => 1,
'bmreferencemap.php' => 1,
'bmredis.php' => 1,
'bmfilemanager.php' => 1,
'bmpersistentcachelink.php' => 1,
'bmpage.php' => 1,
'bmphpsession.php' => 1,
'bmmysqllink.php' => 1,
'bmmigration.php' => 1,
'bmmetadataobject.php' => 1,
'bmmailer.php' => 1,
'bmlog.php' => 1,
'bmimageresizemodule.php' => 1,
'bmimigrate.php' => 1,
'bmhtmlpage.php' => 1,
'bmgenerator.php' => 1,
'bmflashsession.php' => 1,
'nimwebbundle.php' => 1,
'nimmissionbundle.php' => 1,
'filesource.php' => 1,
'sugarcrmrestbundle-devdoc-0.2.pdf' => 1,
'datatableevents.php' => 1,
'netteamdddbundle.php' => 1,
'vendors' => 1,
'nercuryreverseinjectionbundle.php' => 1,
'sample-web.php' => 1,
'sample-newsletter.php' => 1,
'fresque.ini' => 1,
'fresque' => 1,
'nxprutilsbundle.php' => 1,
'builds' => 1,
'neodorksonataredirectbundle.php' => 1,
'sugarrestbundle.php' => 1,
'nemfontawesomebundle.php' => 1,
'abstractcommtoolbuilder.php' => 1,
'nemangularjsbundle.php' => 1,
'neklandeditionbundle.php' => 1,
'neklandbaseadminbundle.php' => 1,
'neirda24toolsbundle.php' => 1,
'html2canvasproxyevents.php' => 1,
'html2canvasproxybundle.php' => 1,
'liipthemeprovidertags.php' => 1,
'liipthemeproviderbundle.php' => 1,
'nebumixrtvalidationbundle.php' => 1,
'update_doc.sh' => 1,
'sample_data.json' => 1,
'dicts.php' => 1,
'autocorrect.php' => 1,
'netteamdatatablebundle.php' => 1,
'campaigncommtool.php' => 1,
'nimformbundle.php' => 1,
'excelrowinterface.php' => 1,
'nimcorebundle.php' => 1,
'apache-2.4_vhost.conf' => 1,
'newbridgegreenextjsbundle.php' => 1,
'bootstrapmarkdown.php' => 1,
'composer.sh' => 1,
'gendoc.sh' => 1,
'netpositivediscriminatormapbundle.php' => 1,
'whosonlinebundle.php' => 1,
'uploadexcelevents.php' => 1,
'uploadexcelbundle.php' => 1,
'rowvalidatorinterface.php' => 1,
'mivalidador.php' => 1,
'excelrow.php' => 1,
'commtoolbuilderinterface.php' => 1,
'ejemplo.php' => 1,
'transactionalsending.php' => 1,
'jangomailfosuser.php' => 1,
'jangomailbundle.php' => 1,
'jangomail.php' => 1,
'campaignsending.php' => 1,
'abstractsending.php' => 1,
'sectionfactory.php' => 1,
'commtooltemplatebundle.php' => 1,
'templateview.php' => 1,
'optimecommtoolbundle.php' => 1,
'controlfactory.php' => 1,
'commtoolfactory.php' => 1,
'solidifier' => 1,
'nileadloaderbundle.php' => 1,
'iplocation.php' => 1,
'unisenderwrapper.php' => 1,
'openclassroomscachebundle.php' => 1,
'openclassroomsakismetbundle.php' => 1,
'.srcutinizer.yml' => 1,
'openwidezendcaptchabundle.php' => 1,
'openwidesynchronizeldapuserbundle.php' => 1,
'openwidepublishservicebundle.php' => 1,
'openwideagendabundle.php' => 1,
'opaleexternaluribundle.php' => 1,
'opaleconsoleexceptionbundle.php' => 1,
'timestampmacro.php' => 1,
'redis-driver-installer.sh' => 1,
'unisender.php' => 1,
'olousouzianatlasbundle.php' => 1,
'openclassroomsdoctrinecacheextensionbundle.php' => 1,
'olousouzianakitabundle.php' => 1,
'ngsfformbundle.php' => 1,
'mongorevisionbehavior.php' => 1,
'winmerge images only.flt' => 1,
'winmerge client only.flt' => 1,
'fuelstart db.sql' => 1,
'fs' => 1,
'fuelphp license' => 1,
'fuel start license' => 1,
'chartistasset.php' => 1,
'chartist.php' => 1,
'steamio.php' => 1,
'openclassroomscustomeriobundle.php' => 1,
'openclassroomselasticsearchbundle.php' => 1,
'aws_et.php' => 1,
'opiferrulesenginebundle.php' => 1,
'orbitaleintegrationbundle.php' => 1,
'references.php' => 1,
'commandresponse.php' => 1,
'commandoptions.php' => 1,
'orbitalegrypbundle.php' => 1,
'orbitalegamebundle.php' => 1,
'entitymerger.php' => 1,
'emptyclassmetadata.php' => 1,
'baseentityrepository.php' => 1,
'orbitalecmsbundle.php' => 1,
'orbitaleapibundle.php' => 1,
'manload.php' => 1,
'opiferredirectbundle.php' => 1,
'openclassroomsoneskybundle.php' => 1,
'opiferformbundle.php' => 1,
'opifereavbundle.php' => 1,
'opifercrudbundle.php' => 1,
'testfile' => 1,
'eden.php' => 1,
'hafasxmlinterface.xsd' => 1,
'leggimi' => 1,
'opencontentopenmagazinebundle.php' => 1,
'openizijsonwebprofilerbundle.php' => 1,
'make_release.sh' => 1,
'openclassroomsusecasebundle.php' => 1,
'openclassroomstranslationbundle.php' => 1,
'openclassroomsserviceproxybundle.php' => 1,
'oire_mail.php' => 1,
'sendsmscomponent.php' => 1,
'basicobject.php' => 1,
'eauth.php' => 1,
'novaezresponsiveimagesbundle.php' => 1,
'notifierbundle.php' => 1,
'excelarray.class.php' => 1,
'apache.conf' => 1,
'iauthservice.php' => 1,
'eopenidservice.php' => 1,
'eoauthservice.php' => 1,
'eoauth2service.php' => 1,
'eauthwidget.php' => 1,
'eauthuseridentity.php' => 1,
'eauthservicebase.php' => 1,
'eauthredirectwidget.php' => 1,
'example-google_apps.php' => 1,
'sf2helperssftpbundle.php' => 1,
'__autoload.php' => 1,
'nobox' => 1,
'nsutilbundle.php' => 1,
'nssecuritybundle.php' => 1,
'nsflashbundle.php' => 1,
'nsfilteredpaginationbundle.php' => 1,
'filteredpagination.php' => 1,
'nsdistancebundle.php' => 1,
'nssonatadoctrineormadminbundle.php' => 1,
'nsacesonatabundle.php' => 1,
'nsacebundle.php' => 1,
'validatingbasicobject.php' => 1,
'ibasicobjectmemcache.php' => 1,
'novaezseobundle.php' => 1,
'nyxisgooglemapbundle.php' => 1,
'iconsasset.php' => 1,
'init.yml' => 1,
'responsetemplate.php' => 1,
'octopod.php' => 1,
'basehandler.php' => 1,
'googleloginbutton.php' => 1,
'proxy-manager.svg' => 1,
'proxy-manager.png' => 1,
'stability' => 1,
'finalizer' => 1,
'oisfunctions.php' => 1,
'translator_config.yml' => 1,
'translator_config.diff.yml' => 1,
'spyc-0.5.zip' => 1,
'cache.appcache' => 1,
'october' => 1,
'oxikoneapibundle.php' => 1,
'cookbook.jpg' => 1,
'solrconfig.xml' => 1,
'solrconfig-5.xml' => 1,
'schema-5.xml' => 1,
'logging.properties' => 1,
'core.properties' => 1,
'synonyms' => 1,
'stopwords' => 1,
'opcvm360wrapperbundle.php' => 1,
'oktolabmediaevent.php' => 1,
'oktolabmediabundle.php' => 1,
'october.yaml' => 1,
'qqwry.dat' => 1,
'socialbundle.php' => 1,
'et_ee.csv' => 1,
'run-cept' => 1,
'sprite' => 1,
'make-junctions' => 1,
'sitcom.yml' => 1,
'sitcom' => 1,
'sigurd' => 1,
'signals-pre-false-filter.yml' => 1,
'signals-post-false-filter.yml' => 1,
'signals' => 1,
'make-links' => 1,
'composer-1426786617.json.bak' => 1,
'maquinette' => 1,
'run-cepts' => 1,
'make-messages' => 1,
'staple' => 1,
'make-cept' => 1,
'hedron' => 1,
'.hedron.example.yml' => 1,
'travis-ocular.sh' => 1,
'i18n-extractor' => 1,
'twitterextension.php' => 1,
'authenticationexception.php' => 1,
'distancematrix.php' => 1,
'bytesdocraptorbundle.php' => 1,
'itunes-m3u' => 1,
'rce.sublime-workspace' => 1,
'rce.sublime-project' => 1,
'sprite.yml' => 1,
'whitelist.yml' => 1,
'marijnkoesencodegeneratorbundle.php' => 1,
'breadcrumbsutility.php' => 1,
'.gitingore' => 1,
'herokuwebapiserviceprovider.php' => 1,
'herokuwebapi.php' => 1,
'rapidauthorization.php' => 1,
'clientpreferences.php' => 1,
'availablepreferences.php' => 1,
'tumblroauth.php' => 1,
'abstractoauthclient.php' => 1,
'linkedinoauth.php' => 1,
'instagramoauth.php' => 1,
'ccouchconnect.php' => 1,
'matthimatikeropcachebundle.php' => 1,
'annotationparserinterface.php' => 1,
'.zamm-example.yml' => 1,
'annotationparameter.php' => 1,
'annotationobject.php' => 1,
'annotationmethod.php' => 1,
'annotationfunctiontrait.php' => 1,
'annotationfunction.php' => 1,
'annotationclass.php' => 1,
'techpafannotationfirewallbundle.php' => 1,
'mattdunbarusermicroservicebundle.php' => 1,
'matthecathtmlcompressorbundle.php' => 1,
'fort' => 1,
'htmlpurifier.standalone.php' => 1,
'autouploader.php' => 1,
'zamm' => 1,
'config.local.php-dist' => 1,
'mbrightrepresentbundle.php' => 1,
'bambooapibundle.php' => 1,
'phparray.class.php' => 1,
'sfs-mass-ip-checker.php' => 1,
'phpmussel.php' => 1,
'people' => 1,
'changelog-v1' => 1,
'baseassets.php' => 1,
'ajaxinputwidget.php' => 1,
'ajaxinputasset.php' => 1,
'routefinder.php' => 1,
'accessobject.php' => 1,
'eventloginterface.php' => 1,
'eventlogindb.php' => 1,
'phparray.test.php' => 1,
'magweldispatcherbundle.php' => 1,
'majescmsbundle.php' => 1,
'zh_cn.csv' => 1,
'uk_ua.csv' => 1,
'tr_tr.csv' => 1,
'sk_sk.csv' => 1,
'pt_pt.csv' => 1,
'pt_br.csv' => 1,
'nl_nl.csv' => 1,
'lv_lv.csv' => 1,
'it_it.csv' => 1,
'hu_hu.csv' => 1,
'hr_hr.csv' => 1,
'he_il.csv' => 1,
'fi_fi.csv' => 1,
'majesblogbundle.php' => 1,
'majescorebundle.php' => 1,
'v2.0.zip' => 1,
'logs-schema-mysql.sql' => 1,
'v1.1.zip' => 1,
'v1-0.zip' => 1,
'kanda.php' => 1,
'kbase.php' => 1,
'exception_handler' => 1,
'likebroapirequest.php' => 1,
'mannewhipchatbundle.php' => 1,
'mango.php' => 1,
'mmmediabundle.php' => 1,
'mmcmfroutingbundle.php' => 1,
'mmcmfnodebundle.php' => 1,
'mmcmfmenubundle.php' => 1,
'zendeskbundle.php' => 1,
'majesmediabundle.php' => 1,
'malwarebytestestbundle.php' => 1,
'malwarebytesformmetadatabundle.php' => 1,
'malwarebytesaltamirabundle.php' => 1,
'chartfactory.php' => 1,
'altamira-config.ini' => 1,
'asbowhoswhoevents.php' => 1,
'asbowhoswhobundle.php' => 1,
'alfrescodocument.php' => 1,
'alfrescodoc-joomla.xml' => 1,
'alfrescodoc-joomla.php' => 1,
'alfresco_cmis_api.php' => 1,
'majessocialbundle.php' => 1,
'majessearchbundle.php' => 1,
'mediamonksrestapibundle.php' => 1,
'daemonbundle.php' => 1,
'vssresourcesfirewallbundle.php' => 1,
'morphodoindexerbundle.php' => 1,
'mrgreenstuffaclsonataadminextensionbundle.php' => 1,
'url_shortener.sqlite' => 1,
'php.travis.ini' => 1,
'foundation' => 1,
'myext.php' => 1,
'steppaginationfactory.php' => 1,
'paginationiteratorinterface.php' => 1,
'paginationiterator.php' => 1,
'paginationfactoryinterface.php' => 1,
'neighbourpaginationfactory.php' => 1,
'logpaginationfactory.php' => 1,
'fullpaginationfactory.php' => 1,
'morphodocrawlerbundle.php' => 1,
'mrmentityvalidationbundle.php' => 1,
'platform.ini' => 1,
'php.5.5' => 1,
'repositories.json' => 1,
'morkethmvcbundle.php' => 1,
'morannonbundle.php' => 1,
'moovlyrecurlybundle.php' => 1,
'robots.prod' => 1,
'robots.dev' => 1,
'channel.html' => 1,
'getval' => 1,
'envfile.php' => 1,
'thbaseservicetest.php' => 1,
'thbaseservice.thrift' => 1,
'dbg.php' => 1,
'mrmisotestbundle.php' => 1,
'hbase.thrift' => 1,
'mykeestagbundle.php' => 1,
'vssoauthextensionbundle.php' => 1,
'phpoole.php' => 1,
'napasformextrabundle.php' => 1,
'user_guide_magento2.pdf' => 1,
'guide_utilisation_magento2.pdf' => 1,
'modify.php' => 1,
'add.php' => 1,
'nfcuploadbundle.php' => 1,
'pubstack' => 1,
'nzourlencryptorbundle.php' => 1,
'nzograbberbundle.php' => 1,
'nzofiledownloaderbundle.php' => 1,
'mykeesmediabundle.php' => 1,
'.travis.yml~' => 1,
'mykeescommentbundle.php' => 1,
'mvcblogbundle.php' => 1,
'restedservice.php' => 1,
'restedbundle.php' => 1,
'abstractresource.php' => 1,
'mykrzysiusmsapibundle.php' => 1,
'tour.php' => 1,
'bootstraptourpluginasset.php' => 1,
'mustached_test.sql' => 1,
'myextensionslist.json' => 1,
'config.cson' => 1,
'bagel.cmd.html' => 1,
'.tgitconfig' => 1,
'hbasetest.php' => 1,
'mollom.class.inc' => 1,
'jiraapibundle.php' => 1,
'adminltebootstrap.php' => 1,
'build-repo.php' => 1,
'wunderdatamailchimpbundle.php' => 1,
'filter' => 1,
'zsh_completion' => 1,
'moosh.php' => 1,
'framelayout.php' => 1,
'moderatorpanel.php' => 1,
'linkwidget.php' => 1,
'framewidget.php' => 1,
'imageuploadwidget.php' => 1,
'fileuploadwidget.php' => 1,
'brainthemebootstrap.php' => 1,
'blogbootstrap.php' => 1,
'bar.navigation.panel.latte' => 1,
'migrate.sh' => 1,
'makedb.sh' => 1,
'getconfig' => 1,
'appinit.bat' => 1,
'appinit' => 1,
'commentatorasset.php' => 1,
'fontcolorbyimage.class.php' => 1,
'mewesktwigexcelbundle.php' => 1,
'cjuidatetimepicker.php' => 1,
'dash.html' => 1,
'yii2_start_slider.sql' => 1,
'widgetapn.php' => 1,
'stashapibundle.php' => 1,
'navigationpanel.php' => 1,
'couchbaseconnection.php' => 1,
'xxxreadme' => 1,
'mmdhelperbundle.php' => 1,
'uploadreadme' => 1,
'viewcount.php' => 1,
'sendslackbestarticles.php' => 1,
'readerserviceprovider.php' => 1,
'ireader.php' => 1,
'crawlfeed.php' => 1,
'blogcontroller.php' => 1,
'articlecontroller.php' => 1,
'cashive.php' => 1,
'mmdsourceboxbundle.php' => 1,
'mmdmcmonitorbundle.php' => 1,
'mmdimprovbundle.php' => 1,
'mmdgooglewebfontscachebundle.php' => 1,
'quaver.sql' => 1,
'mmdgithubapicachebundle.php' => 1,
'mmdcassandrabundle.php' => 1,
'mmdcaptchabundle.php' => 1,
'mmdapebundle.php' => 1,
'igniterelasticachebundle.php' => 1,
'validate.json' => 1,
'.validate.json' => 1,
'misatobootstrapduallistboxbundle.php' => 1,
'minify_html.php' => 1,
'minishlinkwebpushbundle.php' => 1,
'minecraftjp.php' => 1,
'testbootstrap.php' => 1,
'codeigniterinstructions' => 1,
'barcode-test.php' => 1,
'yiiquagga.php' => 1,
'epilgrimmodifyrequestheadersbundle.php' => 1,
'easyajax.php' => 1,
'urltoquery.php' => 1,
'reject-and-notify.php' => 1,
'raph.php' => 1,
'pentothal.php' => 1,
'occipital-in-theme-guide' => 1,
'occipital.php' => 1,
'screenshot-03.png' => 1,
'screenshot-02.png' => 1,
'screenshot-01.png' => 1,
'fcpch-helpers.php' => 1,
'fcpch-admin.php' => 1,
'fc-post-content-handler.php' => 1,
'cleverrules.php' => 1,
'url_to_query.php' => 1,
'ajax-template-part.php' => 1,
'checklist' => 1,
'jstorage.min.js' => 1,
'jstorage.js' => 1,
'jquery.md5.min.js' => 1,
'jquery.md5.js' => 1,
'gizlabtranslationbundle.php' => 1,
'single_post_layout.html' => 1,
'single_post_header.html' => 1,
'header.html' => 1,
'head.html' => 1,
'base.html' => 1,
'urltoqueryitem.php' => 1,
'gliferycrudabstractdatabundle.php' => 1,
'archive.plugin.php' => 1,
'providerservice.php' => 1,
'grcsinternalmessagesbundle.php' => 1,
'gouttewordpressbundle.php' => 1,
'gouttetreebundle.php' => 1,
'blackboard' => 1,
'wp-goracash.php' => 1,
'app.yaml.dist' => 1,
'gollumsflibsassbundle.php' => 1,
'bugsnagplugin.php' => 1,
'gterrortracker.php' => 1,
'goldenlineimgixbundle.php' => 1,
'goldenlinealgoliabundle.php' => 1,
'publisherservice.php' => 1,
'gointegrohateoasbundle.php' => 1,
'gliferyentityhiddentypebundle.php' => 1,
'mailchimpbundle.php' => 1,
'acltreebundle.php' => 1,
'dastatbundle.php' => 1,
'dapaginatorbundle.php' => 1,
'daoauthserverbundle.php' => 1,
'daoauthclientbundle.php' => 1,
'daauthcommonbundle.php' => 1,
'daapiserverbundle.php' => 1,
'daapiclientbundle.php' => 1,
'dalessbundle.php' => 1,
'dadibundle.php' => 1,
'gttcryptbundle.php' => 1,
'cryptorregistry.php' => 1,
'rss.plugin.php' => 1,
'archive.html' => 1,
'threads.php' => 1,
'haloapi.class.php' => 1,
'gcobngtablebundle.php' => 1,
'class-gamajo-template-loader.php' => 1,
'phpunit.record.xml' => 1,
'phpunit.live.xml' => 1,
'garethpsainsburryscraperbundle.php' => 1,
'garethpphotosbundle.php' => 1,
'garethpitsalwaysfivebundle.php' => 1,
'translatorbundle.php' => 1,
'gabe96multi5bundle.php' => 1,
'gayaphpsandboxbundle.php' => 1,
'ioformbundle.php' => 1,
'gtheronrestbundle.php' => 1,
'ggteambreadcrumbbundle.php' => 1,
'bugs.php' => 1,
'formdatepickerfield.php' => 1,
'datepickerfield.php' => 1,
'formaddresspickerfield.php' => 1,
'addresspickerfield.php' => 1,
'please' => 1,
'lensesframework.pdf' => 1,
'funstaffredirectevents.php' => 1,
'funstaffredirectbundle.php' => 1,
'fwslayoutbundle.php' => 1,
'frydrynotificationbundle.php' => 1,
'mqtranslate_xhaleera_addons.php' => 1,
'mqtranslate_wphacks.php' => 1,
'mqtranslate_widget_qtranslate-slug.php' => 1,
'externaltrackingbundle.php' => 1,
'demotext.php' => 1,
'write.html' => 1,
'widgettwigextension.php' => 1,
'posts.html' => 1,
'edit.html' => 1,
'admin_header.html' => 1,
'admin_head.html' => 1,
'admin_base.html' => 1,
'admin.plugin.php' => 1,
'admin.html' => 1,
'stream-laravel.sublime-project' => 1,
'gitignore' => 1,
'sfvoterbundle.php' => 1,
'mastersliderasset.php' => 1,
'masterslider.php' => 1,
'widgetregistryinterface.php' => 1,
'flatplane.inc.php' => 1,
'widgetregistry.php' => 1,
'ws_logo.jpeg' => 1,
'goswebsocketbundle.php' => 1,
'gospubsubrouterbundle.php' => 1,
'gosmailerbundle.php' => 1,
'gosformbundle.php' => 1,
'gosfixturebundle.php' => 1,
'fixture.php' => 1,
'querybuildableinterface.php' => 1,
'gosentityrepository.php' => 1,
'settings_sample.ini' => 1,
'genedyscsrfroutebundle.php' => 1,
'gendoriaparamconverterbundle.php' => 1,
'grcstorbundle.php' => 1,
'binstring.example1.php' => 1,
'mqtranslate_widget.inc.php' => 1,
'abstractcacheadapter.php' => 1,
'abstractentitybodydecorator.php' => 1,
'toarrayinterface.php' => 1,
'hasdispatcherinterface.php' => 1,
'fromconfiginterface.php' => 1,
'abstracthasdispatcher.php' => 1,
'zf2cacheadapter.php' => 1,
'zf1cacheadapter.php' => 1,
'nullcacheadapter.php' => 1,
'doctrinecacheadapter.php' => 1,
'closurecacheadapter.php' => 1,
'cacheadapterinterface.php' => 1,
'cacheadapterfactory.php' => 1,
'notifyingbatch.php' => 1,
'entitybody.php' => 1,
'historybatch.php' => 1,
'flushingbatch.php' => 1,
'exceptionbufferingbatch.php' => 1,
'batchtransferinterface.php' => 1,
'batchsizedivisor.php' => 1,
'batchrequesttransfer.php' => 1,
'batchinterface.php' => 1,
'batchdivisorinterface.php' => 1,
'batchcommandtransfer.php' => 1,
'batchclosuretransfer.php' => 1,
'batchclosuredivisor.php' => 1,
'batchbuilder.php' => 1,
'cachingentitybody.php' => 1,
'entitybodyinterface.php' => 1,
'dson.php' => 1,
'messageformatter.php' => 1,
'callbackbackoffstrategy.php' => 1,
'backoffstrategyinterface.php' => 1,
'backoffplugin.php' => 1,
'backofflogger.php' => 1,
'abstracterrorcodebackoffstrategy.php' => 1,
'abstractbackoffstrategy.php' => 1,
'asyncplugin.php' => 1,
'parserregistry.php' => 1,
'zf2logadapter.php' => 1,
'zf1logadapter.php' => 1,
'psrlogadapter.php' => 1,
'monologlogadapter.php' => 1,
'logadapterinterface.php' => 1,
'ioemittingentitybody.php' => 1,
'closurelogadapter.php' => 1,
'arraylogadapter.php' => 1,
'abstractlogadapter.php' => 1,
'methodproxyiterator.php' => 1,
'filteriterator.php' => 1,
'chunkediterator.php' => 1,
'appenditerator.php' => 1,
'precomputedinflector.php' => 1,
'memoizinginflector.php' => 1,
'inflectorinterface.php' => 1,
'staticclient.php' => 1,
'redirectplugin.php' => 1,
'readlimitentitybody.php' => 1,
'abstractbatchdecorator.php' => 1,
'guilroprotectionproxybundle.php' => 1,
'binstring.example2.php' => 1,
'emptytimespan.php' => 1,
'grossumcontactbundle.php' => 1,
'basejob.php' => 1,
'facebookserviceprovider.php' => 1,
'dgjiraauthbundle.php' => 1,
'grifisdoctrinetableprefixbundle.php' => 1,
'greibitpaneladminbundle.php' => 1,
'phpserial.php' => 1,
'tex2pnghandler.php' => 1,
'gregwartex2pngbundle.php' => 1,
'slidey.php' => 1,
'timespan.php' => 1,
'planning.php' => 1,
'phpnet.php' => 1,
'grossumcustomentitymanagerbundle.php' => 1,
'license.htm' => 1,
'gnuplot.php' => 1,
'gregwarcaptchabundle.php' => 1,
'csvfile.php' => 1,
'tasks.properties' => 1,
'joomla' => 1,
'icontaineraware.php' => 1,
'composer-screenshot.png' => 1,
'documentation.css' => 1,
'relativepath.example1.php' => 1,
'opencmd.bat' => 1,
'binstringstatic.php' => 1,
'binstring.php' => 1,
'grossumcorebundle.php' => 1,
'grossumextendedformtypebundle.php' => 1,
'phpcbf.phar' => 1,
'blockrepository.php' => 1,
'generator.js' => 1,
'gthmrdfbundle.php' => 1,
'_inuit.scss' => 1,
'_defaults.scss' => 1,
'gtacoolinuitcssbundle.php' => 1,
'gtacoolhtml5inuitcssboilerplatebundle.php' => 1,
'version.sh' => 1,
'userrepository.php' => 1,
'repositoryexception.php' => 1,
'optionrepository.php' => 1,
'langrepository.php' => 1,
'contentrepository.php' => 1,
'routetranslation.php' => 1,
'grossumfeedbackbundle.php' => 1,
'optioncategory.php' => 1,
'contenttranslation.php' => 1,
'blocktype.php' => 1,
'blocktranslation.php' => 1,
'basetree.php' => 1,
'laravel_helpers.php' => 1,
'optionsservice.php' => 1,
'cmsseeder.php' => 1,
'blockhandler.php' => 1,
'blockfinder.php' => 1,
'abstractserviceprovider.php' => 1,
'baseuservalidator.php' => 1,
'grossumnewsbundle.php' => 1,
'mqtranslate_widget.php' => 1,
'mqtranslate_utils.php' => 1,
'curlbackoffstrategy.php' => 1,
'inline_entity.module' => 1,
'levels.php' => 1,
'infos.php' => 1,
'block_xp.php' => 1,
'csv2md' => 1,
'loguser.php' => 1,
'grafizzi.dox' => 1,
'web_install.sh' => 1,
'code-mockup-dataprovider.php' => 1,
'build-release.ps1' => 1,
'fact-finder-php-library.sublime-project' => 1,
'eyjarestdemobundle.php' => 1,
'eyjarestbundle.php' => 1,
'inline_entity.info.yml' => 1,
'archinspec.yml.dist' => 1,
'wsdl_generator.info.yml' => 1,
'sql_users.php' => 1,
'secure.php' => 1,
'php-components.php' => 1,
'rfc-version-2-0' => 1,
'exeumiscbundle.php' => 1,
'exeuapaiiobundle.php' => 1,
'exeuamazonecsbundle.php' => 1,
'savewithaudittrailbehavior.php' => 1,
'searchresult.php' => 1,
'quickaddress.php' => 1,
'qaqueryheader.php' => 1,
'visuals.php' => 1,
'.editorconf' => 1,
'qaauthentication.php' => 1,
'lcnimageuploaderbundle.php' => 1,
'fastspring.php' => 1,
'some-file' => 1,
'fastfeedbundle.php' => 1,
'key.pem' => 1,
'sparkleshare' => 1,
'objectevent.php' => 1,
'injectdispatcher.php' => 1,
'.sparkleshare' => 1,
'.scrutnizer.yml' => 1,
'apache_license' => 1,
'lcnweatherforecastbundle.php' => 1,
'lcntemplateblockbundle.php' => 1,
'submitresponse.php' => 1,
'laskgen' => 1,
'matchresponse.php' => 1,
'matchquery.php' => 1,
'flagresponse.php' => 1,
'factualsubmittor.php' => 1,
'factualrectangle.php' => 1,
'factualpost.php' => 1,
'factualpoint.php' => 1,
'factualflagger.php' => 1,
'factualclearor.php' => 1,
'factualboost.php' => 1,
'diffsresponse.php' => 1,
'diffsquery.php' => 1,
'bareresponse.php' => 1,
'qagetdata.php' => 1,
'promptset.php' => 1,
'filedb.inc' => 1,
'eriktrapmanreleasecommandbundle.php' => 1,
'userguide' => 1,
'exception' => 1,
'gliald' => 1,
'complex' => 1,
'003-glial.conf' => 1,
'sf_logo.png' => 1,
'uitinytblwidget.php' => 1,
'jfixedheadertablewidget.php' => 1,
'tray-php.sublime-project' => 1,
'escape' => 1,
'ldap_auth.php' => 1,
'eriktrapmanwebcommandbundle.php' => 1,
'cycleargamebundle.php' => 1,
'bootstrapper.example.php' => 1,
'eriktrapmancqrankingparserbundle.php' => 1,
'ttl.php' => 1,
'rename.php' => 1,
'module_testcase.php' => 1,
'helpermodule.php' => 1,
'model.yml' => 1,
'license.skeleton' => 1,
'get_version.php' => 1,
'get_filetags.php' => 1,
'get_composer.php' => 1,
'dependency.php' => 1,
'precommit.php' => 1,
'createsymlinks.php' => 1,
'assegai' => 1,
'conf.example.php' => 1,
'picklist.php' => 1,
'evercodetwigextensionsbundle.php' => 1,
'formattedaddress.php' => 1,
'bulksearchresult.php' => 1,
'bulksearchitem.php' => 1,
'exercisehtmlpurifierbundle.php' => 1,
'exsterminalbundle.php' => 1,
'exserrorbundle.php' => 1,
'ex3vformerrorsbundle.php' => 1,
'diagnostics' => 1,
'slickasset.php' => 1,
'emsettingsbundle.php' => 1,
'emoauthbundle.php' => 1,
'evercodefaqbundle.php' => 1,
'evercodepagebundle.php' => 1,
'objectomatic.php' => 1,
'evercodehipchatmonologbundle.php' => 1,
'evercodeblogbundle.php' => 1,
'evercodebannerbundle.php' => 1,
'ekironmqbundle.php' => 1,
'classcountcollector.php' => 1,
'uml-generator-php.yml.dist' => 1,
'.uml-generator-php.yml' => 1,
'upgrade_auto.sh' => 1,
'php_upgrade_to_5.5.sh' => 1,
'create_certificat_nginx.sh' => 1,
'base.sh' => 1,
'evelabsphealngbundle.php' => 1,
'edblogbundle.php' => 1,
'filedb' => 1,
'faultmem.php' => 1,
'mqtranslate_services.php' => 1,
'hgtanhellodoctrinemongodbbundle.php' => 1,
'.blackfire.travis.ini.enc' => 1,
'benchmark.sh' => 1,
'cookbook-fixers' => 1,
'hgtanhellosalesforcebundle.php' => 1,
'hgtanhellorabbitmqbundle.php' => 1,
'hgtanhellojirarestapibundle.php' => 1,
'hgtanhellograylogbundle.php' => 1,
'fobhellouserbundle.php' => 1,
'fobhellorestbundle.php' => 1,
'fobhellooauthserverbundle.php' => 1,
'fobhellocommentbundle.php' => 1,
'fobhelloelasticabundle.php' => 1,
'foacronbundle.php' => 1,
'fosadvancedencoderbundle.php' => 1,
'acf-sync.php' => 1,
'scmsasset.php' => 1,
'sblogasset.php' => 1,
'categoriesasset.php' => 1,
'commonasset.php' => 1,
'oistwebauthbundle.php' => 1,
'fortibbcodebundle.php' => 1,
'square.php' => 1,
'formalibreworkspacesubscriptionbundle.php' => 1,
'formalibresupportbundle.php' => 1,
'formalibrereservationbundle.php' => 1,
'formalibrereadspeakerbundle.php' => 1,
'formalibrepresencebundle.php' => 1,
'sismo' => 1,
'foshttpcachebundle.php' => 1,
'formalibrepiabundle.php' => 1,
'dynamicloaderbar.php' => 1,
'mqtranslate_javascript.php' => 1,
'mqtranslate_hooks.php' => 1,
'mqtranslate_core.php' => 1,
'mqtranslate_configuration.php' => 1,
'mqtranslate.php' => 1,
'class-gf-bitrix24.php' => 1,
'bitrix24.php' => 1,
'validfluent.php' => 1,
'frojd-segments.php' => 1,
'frojd-image-menu.php' => 1,
'loader.latte' => 1,
'dynamicloaderexception.php' => 1,
'messengerplatform.php' => 1,
'locallang_csh_ttaddress.xml' => 1,
'victoirewidgetsocialpagebundle.php' => 1,
'victoirewidgetsearchbundle.php' => 1,
'victoirewidgetprogressbundle.php' => 1,
'victoirewidgetmailchimpnewsletterbundle.php' => 1,
'victoirewidgetloginbundle.php' => 1,
'victoirewidgetlocaleswitcherbundle.php' => 1,
'victoirewidgetdatebundle.php' => 1,
'victoirewidgetcookielawbundle.php' => 1,
'victoirewidgetconnectbundle.php' => 1,
'victoirewidgetcardbundle.php' => 1,
'victoirewidgetaggregateratingbundle.php' => 1,
'victoirewidgetpicturecomparatorbundle.php' => 1,
'locallang_tca.xml' => 1,
'formalibreplatformadministrationbundle.php' => 1,
'formalibreofficeconnectbundle.php' => 1,
'faultmemasync.php' => 1,
'mpjaxblock.php' => 1,
'radiusstrategy.php' => 1,
'radiusclient.php' => 1,
'ldapstrategy.php' => 1,
'flagship-library.php' => 1,
'flagbitmetricsbundle.php' => 1,
'flagbitcurrencybundle.php' => 1,
'creating_commands' => 1,
'runnercomponent.php' => 1,
'inlinerunner.php' => 1,
'baserunner.php' => 1,
'readmoreasset.php' => 1,
'readmore.php' => 1,
'footableasset.php' => 1,
'newplugin.php' => 1,
'flagsasset.php' => 1,
'calendarasset.php' => 1,
'devbridge-autocomplete.jquery.json' => 1,
'fz_log.php' => 1,
'fz_limonade.php' => 1,
'fz_helper_view.php' => 1,
'fz_config.php' => 1,
'multilanguage.php' => 1,
'fievelajaxtablebundle.php' => 1,
'zabbixcomponent.php' => 1,
'providers.json' => 1,
'feftaddressbundle.php' => 1,
'featurebrowser.yml.dist' => 1,
'flexmodelbundle.php' => 1,
'broken-links.php' => 1,
'formalibrejobbundle.php' => 1,
'product.tpl' => 1,
'formalibrebulletinbundle.php' => 1,
'forcec' => 1,
'plugin_packages' => 1,
'hooks_events_results' => 1,
'wordpresscomposertoolsplugin.php' => 1,
'flyingstructbundle.php' => 1,
'bujsonresponsebundle.php' => 1,
'buextraparamconverterbundle.php' => 1,
'vacancy.tpl' => 1,
'text.tpl' => 1,
'slider.tpl' => 1,
'project.tpl' => 1,
'person.tpl' => 1,
'plugin-cms.php' => 1,
'person-tiles.tpl' => 1,
'news.tpl' => 1,
'menu.tpl' => 1,
'featured_list.tpl' => 1,
'breadcrumbs.tpl' => 1,
'banner.tpl' => 1,
'fieldentityinterface.php' => 1,
'.styleci.yaml' => 1,
'.codeclimat.yaml' => 1,
'flubbigbangbundle.php' => 1,
'fsbproxybundle.php' => 1,
'requirementchecker.php' => 1,
'popular-posts.php' => 1,
'constantbackoffstrategy.php' => 1,
'exponentialbackoffstrategy.php' => 1,
'barcodefactory.php' => 1,
'imaticimportbundle.php' => 1,
'mysql-transfer.sh' => 1,
'mysql-restore.sh' => 1,
'mysql-remote-restore.sh' => 1,
'mysql-remote-backup.sh' => 1,
'mysql-csv-to-sql.php' => 1,
'mysql-backup.sh' => 1,
'api_calls.php' => 1,
'api_callback.php' => 1,
'testpdf.pdf' => 1,
'travis.config.ini' => 1,
'passport.php' => 1,
'importoption.php' => 1,
'anchovycurlbundle.php' => 1,
'icms_version.php' => 1,
'fr_fr.theme.frontend_magento_luma.csv' => 1,
'fr_fr.theme.frontend_magento_blank.csv' => 1,
'fr_fr.module.magento_wishlist.csv' => 1,
'fr_fr.module.magento_widget.csv' => 1,
'fr_fr.module.magento_weee.csv' => 1,
'fr_fr.module.magento_webapisecurity.csv' => 1,
'fr_fr.module.magento_webapi.csv' => 1,
'fr_fr.module.magento_variable.csv' => 1,
'fr_fr.module.magento_usps.csv' => 1,
'fr_fr.module.magento_user.csv' => 1,
'fr_fr.module.magento_urlrewrite.csv' => 1,
'fr_fr.module.magento_ups.csv' => 1,
'mysql-tunnel.sh' => 1,
'module.css' => 1,
'fr_fr.module.magento_translation.csv' => 1,
'ircategorybundle.php' => 1,
'irzonebundle.php' => 1,
'irproductevents.php' => 1,
'irproductbundle.php' => 1,
'irorderevents.php' => 1,
'irorderbundle.php' => 1,
'irnewsevents.php' => 1,
'irnewsbundle.php' => 1,
'ircustomerevents.php' => 1,
'ircustomerbundle.php' => 1,
'ircontactevents.php' => 1,
'ircontactbundle.php' => 1,
'ircategoryevents.php' => 1,
'ircartevents.php' => 1,
'module_rtl.css' => 1,
'ircartbundle.php' => 1,
'iraddressbundle.php' => 1,
'infinitedevelopersweatherwidgetbundle.php' => 1,
'infinitedevelopersbase64bundle.php' => 1,
'infernosquadcalculationbundle.php' => 1,
'migrationawaremodule.php' => 1,
'migrationawareinterface.php' => 1,
'bakery' => 1,
'gopher' => 1,
'logsafecheddargetterbundle.php' => 1,
'incenteevtranslationcheckerbundle.php' => 1,
'inpostvalidationbundle.php' => 1,
'dashboard.png' => 1,
'fr_fr.module.magento_ui.csv' => 1,
'fr_fr.module.magento_theme.csv' => 1,
'ingewikkeldwrapperbundle.php' => 1,
'fr_fr.module.magento_downloadable.csv' => 1,
'fr_fr.module.magento_indexer.csv' => 1,
'fr_fr.module.magento_importexport.csv' => 1,
'fr_fr.module.magento_groupedproduct.csv' => 1,
'fr_fr.module.magento_googleoptimizer.csv' => 1,
'fr_fr.module.magento_googleanalytics.csv' => 1,
'fr_fr.module.magento_googleadwords.csv' => 1,
'fr_fr.module.magento_giftmessage.csv' => 1,
'fr_fr.module.magento_fedex.csv' => 1,
'fr_fr.module.magento_encryptionkey.csv' => 1,
'fr_fr.module.magento_email.csv' => 1,
'fr_fr.module.magento_eav.csv' => 1,
'fr_fr.module.magento_downloadableimportexport.csv' => 1,
'fr_fr.module.magento_directory.csv' => 1,
'fr_fr.module.magento_layerednavigation.csv' => 1,
'fr_fr.module.magento_dhl.csv' => 1,
'fr_fr.module.magento_developer.csv' => 1,
'fr_fr.module.magento_deploy.csv' => 1,
'fr_fr.module.magento_customerimportexport.csv' => 1,
'fr_fr.module.magento_customer.csv' => 1,
'fr_fr.module.magento_currencysymbol.csv' => 1,
'fr_fr.module.magento_cron.csv' => 1,
'fr_fr.module.magento_cookie.csv' => 1,
'fr_fr.module.magento_contact.csv' => 1,
'fr_fr.module.magento_configurableproduct.csv' => 1,
'fr_fr.module.magento_config.csv' => 1,
'fr_fr.module.magento_cms.csv' => 1,
'fr_fr.module.magento_checkoutagreements.csv' => 1,
'fr_fr.module.magento_integration.csv' => 1,
'fr_fr.module.magento_marketplace.csv' => 1,
'fr_fr.module.magento_taximportexport.csv' => 1,
'fr_fr.module.magento_review.csv' => 1,
'fr_fr.module.magento_tax.csv' => 1,
'fr_fr.module.magento_swatches.csv' => 1,
'fr_fr.module.magento_store.csv' => 1,
'fr_fr.module.magento_sitemap.csv' => 1,
'fr_fr.module.magento_shipping.csv' => 1,
'fr_fr.module.magento_sendfriend.csv' => 1,
'fr_fr.module.magento_search.csv' => 1,
'fr_fr.module.magento_salessequence.csv' => 1,
'fr_fr.module.magento_salesrule.csv' => 1,
'fr_fr.module.magento_sales.csv' => 1,
'fr_fr.module.magento_rule.csv' => 1,
'fr_fr.module.magento_rss.csv' => 1,
'fr_fr.module.magento_reports.csv' => 1,
'fr_fr.module.magento_mediastorage.csv' => 1,
'fr_fr.module.magento_quote.csv' => 1,
'fr_fr.module.magento_productvideo.csv' => 1,
'fr_fr.module.magento_productalert.csv' => 1,
'fr_fr.module.magento_persistent.csv' => 1,
'fr_fr.module.magento_paypal.csv' => 1,
'fr_fr.module.magento_payment.csv' => 1,
'fr_fr.module.magento_pagecache.csv' => 1,
'fr_fr.module.magento_offlineshipping.csv' => 1,
'fr_fr.module.magento_offlinepayments.csv' => 1,
'fr_fr.module.magento_newsletter.csv' => 1,
'fr_fr.module.magento_newrelicreporting.csv' => 1,
'fr_fr.module.magento_multishipping.csv' => 1,
'fr_fr.module.magento_msrp.csv' => 1,
'irzoneevents.php' => 1,
'build.clip.php' => 1,
'fr_fr.module.magento_catalogwidget.csv' => 1,
'jcookieasset.php' => 1,
'ibtablemanagerbundle.php' => 1,
'rbacmodule.php' => 1,
'redisman.php' => 1,
'messages_conf_redisman' => 1,
'messages_conf_app' => 1,
'jgallerywidget.php' => 1,
'jgalleryasset.php' => 1,
'iconpicker.php' => 1,
'timelineitem.php' => 1,
'timeline' => 1,
'tile.php' => 1,
'smallbox.php' => 1,
'flashalerts.php' => 1,
'socialstatsbundle.php' => 1,
'extadminlteasset.php' => 1,
'exampletimelineitem.php' => 1,
'insightly.php' => 1,
'inoritwitterappbundle.php' => 1,
'innovataxonomybundle.php' => 1,
'innovasupportbundle.php' => 1,
'innovapathbundle.php' => 1,
'innovanondigitalresourcebundle.php' => 1,
'innovametronomebundle.php' => 1,
'innovamediaresourcebundle.php' => 1,
'innovalearningpathbundle.php' => 1,
'innovagitterbundle.php' => 1,
'innovaforummultimodalbundle.php' => 1,
'smartcodebundle.php' => 1,
'itcollectorbundle.php' => 1,
'innovafakerbundle.php' => 1,
'phpunit-wordpress-browser.xml.dist' => 1,
'docodile' => 1,
'arc2jsonldconverter.php' => 1,
'redistarget.php' => 1,
'tvmazeincludes.php' => 1,
'fatcowiconsbundle.php' => 1,
'testastring.php' => 1,
'jorgehernanodmrelationshipviewbundle.php' => 1,
'wp-l10n-validator.php' => 1,
'ignores-cache-generator.php' => 1,
'wp-http-testcase.php' => 1,
'pimple.json' => 1,
'phpunit-wordpress.xml.dist' => 1,
'phpunit-joomla.xml.dist' => 1,
'involvaitadminltebundle.php' => 1,
'phpunit-joomla-browser.xml.dist' => 1,
'jaiuserbundle.php' => 1,
'jaicontactbundle.php' => 1,
'configstore.php' => 1,
'easylang.php' => 1,
'jmosecommandschedulerbundle.php' => 1,
'parsleybundle.php' => 1,
'work' => 1,
'iteoformfilterbundle.php' => 1,
'irvyneembedlybundle.php' => 1,
'involvaitjqueryuibundle.php' => 1,
'involvaitfoundationbundle.php' => 1,
'involvaitfontawesomebundle.php' => 1,
'innovafavoritebundle.php' => 1,
'description-pak' => 1,
'crawlerinterface.php' => 1,
'innmindneo4jbundle.php' => 1,
'nullquery.php' => 1,
'nullpath.php' => 1,
'nullfragment.php' => 1,
'fragmentinterface.php' => 1,
'authorityinterface.php' => 1,
'authority.php' => 1,
'notinterface.php' => 1,
'compositeinterface.php' => 1,
'routeloader.php' => 1,
'innmindrestbundle.php' => 1,
'reflectionobject.php' => 1,
'instanciatorinterface.php' => 1,
'typedcollectioninterface.php' => 1,
'pathinterface.php' => 1,
'typedcollection.php' => 1,
'symbol.php' => 1,
'stringableinterface.php' => 1,
'stringprimitive.php' => 1,
'sizeableinterface.php' => 1,
'setinterface.php' => 1,
'sequenceinterface.php' => 1,
'primitiveinterface.php' => 1,
'pair.php' => 1,
'nameinterface.php' => 1,
'mediatypeinterface.php' => 1,
'lazyadapterinterface.php' => 1,
'domcrawlerfactory.php' => 1,
'nullscheme.php' => 1,
'clauseinterface.php' => 1,
'innovacollecticielbundle.php' => 1,
'formats.php' => 1,
'innovaaudiorecorderbundle.php' => 1,
'innovaangularuitreebundle.php' => 1,
'innovaangularuitranslationbundle.php' => 1,
'innovaangularuitinymcebundle.php' => 1,
'innovaangularuisortablebundle.php' => 1,
'innovaangularuiresourcepickerbundle.php' => 1,
'innovaangularuipageslidebundle.php' => 1,
'innovaangularjsbundle.php' => 1,
'innovaactivitybundle.php' => 1,
'urlresolver.php' => 1,
'storages.php' => 1,
'resourcebuilder.php' => 1,
'entitybuilder.php' => 1,
'cypher.php' => 1,
'definitioncompiler.php' => 1,
'compilerpassinterface.php' => 1,
'repositoryfactory.php' => 1,
'persisterinterface.php' => 1,
'metadatas.php' => 1,
'metadatafactoryinterface.php' => 1,
'metadatabuilder.php' => 1,
'managerfactory.php' => 1,
'identitymatch.php' => 1,
'identityinterface.php' => 1,
'entityfactoryinterface.php' => 1,
'transactions.php' => 1,
'resultinterface.php' => 1,
'fr_fr.module.magento_checkout.csv' => 1,
'fr_fr.module.magento_catalogurlrewrite.csv' => 1,
'httpbackoffstrategy.php' => 1,
'happyrnormaldistributionbundle.php' => 1,
'ajaxcreatetable.php' => 1,
'template.html.twig' => 1,
'listitems.js' => 1,
'headoomediasocialapibundle.php' => 1,
'headoomailjetbundle.php' => 1,
'headooecommercebundle.php' => 1,
'haverkamp87userbundle.php' => 1,
'haverkamp87corebundle.php' => 1,
'authentication_2016-04-19.sql' => 1,
'happyruserprojectbundle.php' => 1,
'happyrstompbundle.php' => 1,
'happyrslugifybundle.php' => 1,
'happyrmq2phpbundle.php' => 1,
'ajaximportfile.php' => 1,
'happyrlocationbundle.php' => 1,
'happyrlinkedinbundle.php' => 1,
'identifierinterface.php' => 1,
'happyrmailerbundle.php' => 1,
'happyrgooglesiteauthenticatorbundle.php' => 1,
'happyrgooglegeocoderbundle.php' => 1,
'happyrgoogleapibundle.php' => 1,
'happyrgoogleanalyticsbundle.php' => 1,
'happyrexcerptbundle.php' => 1,
'happyreventtrackerbundle.php' => 1,
'happyrcloudflarebundle.php' => 1,
'happyrbirthdaybundle.php' => 1,
'ajaxfulltext.php' => 1,
'ajaxquery.php' => 1,
'travisconfigs.tar.enc' => 1,
'fakeprocessbuilder.php' => 1,
'prepper-stop.sh' => 1,
'prepper-stop.php' => 1,
'prepper-stop.bat' => 1,
'prepper-start.sh' => 1,
'prepper-start.php' => 1,
'prepper-start.bat' => 1,
'testresult' => 1,
'.gitignor' => 1,
'tokenize' => 1,
'hipi18nroutingbundle.php' => 1,
'htcnowtaxibundle.php' => 1,
'.twgit' => 1,
'fakeprocess.php' => 1,
'ajaxsavecolumnedit.php' => 1,
'hexmediauserbundle.php' => 1,
'hexmediatimeformatterbundle.php' => 1,
'hexmediaknockoutbundle.php' => 1,
'hexmediaknockoutbootstrapbundle.php' => 1,
'hexmediacontentbundle.php' => 1,
'hexmediaasseticbundle.php' => 1,
'hexmediaadministratorbundle.php' => 1,
'arduinoclient.php' => 1,
'echofor.php' => 1,
'editcolumn.php' => 1,
'dboverview.php' => 1,
'ajaxsaveuseredit.php' => 1,
'ajaxsaveedit.php' => 1,
'hanfreysparkpostbundle.php' => 1,
'hdconfig.php' => 1,
'admin_index.php' => 1,
'cookieplugin.php' => 1,
'phpstreamrequestfactory.php' => 1,
'configloaderinterface.php' => 1,
'cachingconfigloader.php' => 1,
'abstractconfigloader.php' => 1,
'oauthplugin.php' => 1,
'md5validatorplugin.php' => 1,
'commandcontentmd5plugin.php' => 1,
'logplugin.php' => 1,
'historyplugin.php' => 1,
'errorresponseplugin.php' => 1,
'errorresponseexceptioninterface.php' => 1,
'curlauthplugin.php' => 1,
'skiprevalidation.php' => 1,
'multisite' => 1,
'revalidationinterface.php' => 1,
'denyrevalidation.php' => 1,
'defaultrevalidation.php' => 1,
'defaultcancachestrategy.php' => 1,
'defaultcachestorage.php' => 1,
'defaultcachekeyprovider.php' => 1,
'cancachestrategyinterface.php' => 1,
'callbackcancachestrategy.php' => 1,
'cachestorageinterface.php' => 1,
'cachekeyproviderinterface.php' => 1,
'truncatedbackoffstrategy.php' => 1,
'reasonphrasebackoffstrategy.php' => 1,
'linearbackoffstrategy.php' => 1,
'streamrequestfactoryinterface.php' => 1,
'class-h1-auto-image-download-admin.php' => 1,
'hd4helper.js' => 1,
'aplikasidakwah.sql' => 1,
'hdstore.php' => 1,
'hdextra.php' => 1,
'hddevice.php' => 1,
'hdcache.php' => 1,
'hdbase.php' => 1,
'hd4.php' => 1,
'halbehatwizardbundle.php' => 1,
'halbehattoolsbundle.php' => 1,
'hobtokenbundle.php' => 1,
'commonbundle.php' => 1,
'hobapibundle.php' => 1,
'run.py' => 1,
'espendzenddbbundle.php' => 1,
'class-h1-auto-image-download.php' => 1,
'hadesarchitectnotificationbundle.php' => 1,
'jsonschemabundle.php' => 1,
'ssql.php' => 1,
'basiq.php' => 1,
'infogen.php' => 1,
'app.css' => 1,
'listtable.twig' => 1,
'dbtools.php' => 1,
'dockerfile.phpspec' => 1,
'dockerfile.composer' => 1,
'supervisorasset.php' => 1,
'h1-auto-image-download.php' => 1,
'h1-auto-image-download.js' => 1,
'hotaru.php' => 1,
'htaccess_default' => 1,
'fr_fr.module.magento_catalogsearch.csv' => 1,
'phantom.js' => 1,
'cartpositionbehaviour.php' => 1,
'cartposition.php' => 1,
'sharebar.php' => 1,
'ipinfodb.php' => 1,
'currencyconverterinterface.php' => 1,
'currencyconverter.php' => 1,
'countrytocurrency.php' => 1,
'jabberjaxlbundle.php' => 1,
'ikimeapagebundle.php' => 1,
'ikimeackeditorbundle.php' => 1,
'imtdatagridbundle.php' => 1,
'planet' => 1,
'ifgmaclinterfacebundle.php' => 1,
'fr_fr.component.magento2_base.csv' => 1,
'id4vmenubundle.php' => 1,
'stikairinitbundle.php' => 1,
'icode4foodjqueryuibundle.php' => 1,
'packagemanager.png' => 1,
'itlizedzurbfoundationbundle.php' => 1,
'itlizedsocialbundle.php' => 1,
'pagerduty.php' => 1,
'requestreader.php' => 1,
'rsmartload.php' => 1,
'rsmartloadhelper.php' => 1,
'rsmartloadclientscript.php' => 1,
'seleniumtestcasedoc.php' => 1,
'iq2iprestashopwebservicebundle.php' => 1,
'sharebutton.php' => 1,
'fr_fr.custom.imaginaerum.csv' => 1,
'extdirectaction.php' => 1,
'fr_fr.module.magento_adminnotification.csv' => 1,
'fr_fr.module.magento_catalogrule.csv' => 1,
'fr_fr.module.magento_cataloginventory.csv' => 1,
'fr_fr.module.magento_catalogimportexport.csv' => 1,
'fr_fr.module.magento_catalog.csv' => 1,
'fr_fr.module.magento_captcha.csv' => 1,
'fr_fr.module.magento_bundle.csv' => 1,
'fr_fr.module.magento_braintree.csv' => 1,
'fr_fr.module.magento_backup.csv' => 1,
'fr_fr.module.magento_backend.csv' => 1,
'fr_fr.module.magento_authorizenet.csv' => 1,
'fr_fr.module.magento_authorization.csv' => 1,
'fr_fr.module.magento_advancedpricingimportexport.csv' => 1,
'fr_fr.lib.lib_web_mage_validation_validation_js.csv' => 1,
'fr_fr.deprecated.imaginaerum.after.2.0.0.csv' => 1,
'fr_fr.lib.lib_web_mage_validation_js.csv' => 1,
'fr_fr.lib.lib_web_mage_translate_inline_vde_js.csv' => 1,
'fr_fr.lib.lib_web_mage_translate_inline_js.csv' => 1,
'fr_fr.lib.lib_web_mage_menu_js.csv' => 1,
'fr_fr.lib.lib_web_mage_loader_old_js.csv' => 1,
'fr_fr.lib.lib_web_mage_loader_js.csv' => 1,
'fr_fr.lib.lib_web_mage_dropdown_js.csv' => 1,
'fr_fr.lib.lib_web_mage_decorate_js.csv' => 1,
'fr_fr.lib.lib_web_mage_backend_suggest_js.csv' => 1,
'fr_fr.lib.lib_web_mage_adminhtml_wysiwyg_widget_js.csv' => 1,
'fr_fr.lib.lib_web_mage_adminhtml_backup_js.csv' => 1,
'fr_fr.deprecated.imaginaerum.after.2.0.3.csv' => 1,
'fr_fr.deprecated.imaginaerum.after.2.0.2.csv' => 1,
'extdirectmanager.php' => 1,
'process_settings.php' => 1,
'hotflofeaturetogglebundle.php' => 1,
'usecase' => 1,
'idcicontactformbundle.php' => 1,
'idcicolorschemebundle.php' => 1,
'idcicodegeneratorbundle.php' => 1,
'codegeneratormanager.php' => 1,
'awssesbundle.php' => 1,
'idciadmingeneratorbundle.php' => 1,
'patches.php' => 1,
'logging.services.yml' => 1,
'logging.module' => 1,
'logging.info' => 1,
'icansloggingbundle.php' => 1,
'hypolayoutbundle.php' => 1,
'frameworks' => 1,
'idciextraformbundle.php' => 1,
'debugging' => 1,
'mwbsexporterbundle.php' => 1,
'lazyguy' => 1,
'fuzzypeanut.php' => 1,
'ip2location.class.php' => 1,
'ip2location_products_catalog.pdf' => 1,
'htimelightcmsbundle.php' => 1,
'hsererouter.php' => 1,
'hoanotificationevents.php' => 1,
'hoanotificationbundle.php' => 1,
'dacorpextraevents.php' => 1,
'dacorpextrabundle.php' => 1,
'hotflosupervisorbundle.php' => 1,
'idciexporterbundle.php' => 1,
'idcifilterformbundle.php' => 1,
'logconfig.xml' => 1,
'fullcalendar.css' => 1,
'default.settings.php' => 1,
'tableexport.js' => 1,
'tableexport.jquery.json' => 1,
'jquery.base64.js' => 1,
'html2canvas.js' => 1,
'project-assembly.xml' => 1,
'lang-all.js' => 1,
'gcal.js' => 1,
'fullcalendar.print.css' => 1,
'fullcalendar.min.js' => 1,
'fullcalendar.min.css' => 1,
'fullcalendar.js' => 1,
'mailchimp-tools.php' => 1,
'idcigenealogybundle.php' => 1,
'mailchimp-functions.php' => 1,
'illdatacitedoibundle.php' => 1,
'qqq.t' => 1,
'.sams' => 1,
'idciwebpagescreenshotbundle.php' => 1,
'idcistepbundle.php' => 1,
'idcisimpleschedulebundle.php' => 1,
'idcisimplemetadatabundle.php' => 1,
'idcisimplemediabundle.php' => 1,
'idcipartnerbundle.php' => 1,
'idcinotificationbundle.php' => 1,
'idcinotificationapiclientbundle.php' => 1,
'idcinavbarbundle.php' => 1,
'gitlabmodel.php' => 1,
'modulebootstrap.php' => 1,
'baffordbowerbundle.php' => 1,
'examples_database.sql' => 1,
'intellijsetup' => 1,
'affirm.json' => 1,
'groovey.jpg' => 1,
'modulequery.php' => 1,
'moduleeventsinterface.php' => 1,
'objectmodelinterface.php' => 1,
'objectmodel.php' => 1,
'modelformasset.php' => 1,
'invokeevent.php' => 1,
'formnameevent.php' => 1,
'arraymodel.php' => 1,
'license-image-crud' => 1,
'grizzlylabuibundle.php' => 1,
'slack.hooks.php' => 1,
'grizzlylabmailerbundle.php' => 1,
'grinfeld_phpjsonable.phar' => 1,
'timingfield.scss' => 1,
'timingfield.min.js' => 1,
'timingfield.js' => 1,
'timingfield.css' => 1,
'grimmlinkalipaybundle.php' => 1,
'ymcomponent.php' => 1,
'awscomponent.php' => 1,
'gaspfile' => 1,
'gremosubscriptionbundle.php' => 1,
'gremopjaxbundle.php' => 1,
'grunchmercadopagobundle.php' => 1,
'prestashop' => 1,
'gremohighchartsbundle.php' => 1,
'.travis.phpunit.xml.dist' => 1,
'web-test.php' => 1,
'commanderbundle.php' => 1,
'ispconfig-cli.phar' => 1,
'ispconfig-cli.dist.yml' => 1,
'environment.example.ini' => 1,
'validaterule.php' => 1,
'dataspringdemobundle.php' => 1,
'guiyomhgoogleauthenticatorbundle.php' => 1,
'clips' => 1,
'.env-sample.php' => 1,
'udfangularjsbundle.php' => 1,
'undfangulartransbundle.php' => 1,
'kebhubapi.php' => 1,
'gtriasaddorselectbundle.php' => 1,
'donatopathwellbundle.php' => 1,
'ninjamutexbundle.php' => 1,
'donatogenerichwioauthproxybundle.php' => 1,
'donatohttpservicebundle.php' => 1,
'yamlconfig.php' => 1,
'arrayconfig.php' => 1,
'donatohttpproxiedbuzzbundle.php' => 1,
'plan_test.php' => 1,
'plan.php' => 1,
'sweethome' => 1,
'task.xml' => 1,
'hint.jpg' => 1,
'gtriastimepickerbundle.php' => 1,
'gremohmacauthenticationbundle.php' => 1,
'gremocaptchaformbundle.php' => 1,
'wellknowntext.php' => 1,
'cachetoolbundle.php' => 1,
'gpatonparsebundle.php' => 1,
'gpatonlabelconverterbundle.php' => 1,
'gotakkviewmodelbundle.php' => 1,
'doc.ini' => 1,
'wsdl.xml' => 1,
'contactemail.ss' => 1,
'extensions.yml' => 1,
'gordalinamangopaybundle.php' => 1,
'ifmbevents.php' => 1,
'gordalinaifmbbundle.php' => 1,
'gordalinamixpanelbundle.php' => 1,
'gordalinaeasypaybundle.php' => 1,
'phpunit.full.xml' => 1,
'demoportalbundle.php' => 1,
'youtubereporting.php' => 1,
'youtubeanalytics.php' => 1,
'webmasters.php' => 1,
'webfonts.php' => 1,
'vision.php' => 1,
'urlshortener.php' => 1,
'toolresults.php' => 1,
'taskqueue.php' => 1,
'tagmanager.php' => 1,
'storagetransfer.php' => 1,
'spectrum.php' => 1,
'siteverification.php' => 1,
'shoppingcontent.php' => 1,
'helloworld.hello.xml' => 1,
'vagrant-up' => 1,
'gremobuzzbundle.php' => 1,
'pkg_sales.xml' => 1,
'yiimandrill.php' => 1,
'scriptcore.php' => 1,
'design.jpg' => 1,
'install_demo.sh' => 1,
'install_demo.bat' => 1,
'.coverage.yml' => 1,
'.drush-lock-update' => 1,
'.eclipse-php-formatter.xml' => 1,
'phpari.php' => 1,
'phpari.ini' => 1,
'ixr_xmlrpc.php' => 1,
'pkg_translations.xml' => 1,
'pkg_articles.xml' => 1,
'markethubbundle.php' => 1,
'arrayvalidator.php' => 1,
'queries' => 1,
'polylang-slug.php' => 1,
'config.yml.default' => 1,
'ofreader' => 1,
'grachevenumbundle.php' => 1,
'grachevcronbundle.php' => 1,
'deploy.default.properties' => 1,
'inputreader.php' => 1,
'githelper.php' => 1,
'gitdeploy.php' => 1,
'ftphelper.php' => 1,
'sevendigitalbundle.php' => 1,
'effect.php' => 1,
'flush_privileges.php' => 1,
'resourceviews.php' => 1,
'imagemanagerexception.php' => 1,
'hackzillabarcodebundle.php' => 1,
'procergslogincidadaobadgesbundle.php' => 1,
'hacfirequestdumperbundle.php' => 1,
'phpfa' => 1,
'hacfiobjectbridgebundle.php' => 1,
'haberbergerredisstoragebundle.php' => 1,
'romenumber.php' => 1,
'nonobject.php' => 1,
'filetools.php' => 1,
'feast.php' => 1,
'arraystatic.php' => 1,
'pathnizer.php' => 1,
'period.php' => 1,
'hackzillaticketbundle.php' => 1,
'silpionloggerextrabundle.php' => 1,
'h4ccalicefixturesbundle.php' => 1,
'hnmessageformatbundle.php' => 1,
'widgets.html' => 1,
'typo.html' => 1,
'two-sidebars.html' => 1,
'tables.html' => 1,
'support.html' => 1,
'structure.html' => 1,
'simplechartsloadedviajson.zip' => 1,
'simplechart.zip' => 1,
'right-sidebar.html' => 1,
'hackzillafosuserbridgebundle.php' => 1,
'ticketevents.php' => 1,
'offline.html' => 1,
'phockito_globals.php' => 1,
'wikimate.php' => 1,
'pheditor.php' => 1,
'faraso.class.php' => 1,
'hamepub' => 1,
'roles.png' => 1,
'resources.png' => 1,
'permissions.png' => 1,
'hamaryuginhmeekrodbbundle.php' => 1,
'hamaryuginhgoogleanalyticsbundle.php' => 1,
'littlesnapper.php' => 1,
'__bootstrap.php' => 1,
'awscloudsearchbundle.php' => 1,
'phockitosilverstripe.php' => 1,
'ticketrole.php' => 1,
'phockito.php' => 1,
'hamcresttypebridge_globals.php' => 1,
'hamcresttypebridge.php' => 1,
'hadonraaddressbundle.php' => 1,
'metamaterial.php' => 1,
'mm_user.php' => 1,
'mm_taxonomy.php' => 1,
'mm_metabox.php' => 1,
'mm_mediaaccess.php' => 1,
'mm_loop.php' => 1,
'mm_dashboard.php' => 1,
'hackzillapasswordgeneratorbundle.php' => 1,
'hackzillabootstrapbundle.php' => 1,
'profile.html' => 1,
'no-sidebar.html' => 1,
'recover_password.php' => 1,
'wee.php' => 1,
'pointcutinjector.php' => 1,
'pointcut.php' => 1,
'patternvalueset.php' => 1,
'patternnamespace.php' => 1,
'patternfunction.php' => 1,
'patternfilename.php' => 1,
'patternclass.php' => 1,
'pattern.php' => 1,
'aoptests.php' => 1,
'aop.php' => 1,
'weeplugininterface.php' => 1,
'weepluginabstract.php' => 1,
'gwkmailjetbundle.php' => 1,
'file_put_contents_backup.php' => 1,
'gwkdynamosessionbundle.php' => 1,
'gwinntinymcefastloadbundle.php' => 1,
'gw-config.php.dist' => 1,
'cakeblog.sql' => 1,
'mohostrategy.php' => 1,
'zero-header.jpg' => 1,
'.scruitinzr.yml' => 1,
'nicescrollasset.php' => 1,
'nicescroll.php' => 1,
'jquerycustomcontentscrollerasset.php' => 1,
'jquerycustomcontentscroller.php' => 1,
'create_translations.sh' => 1,
'switch_project.php' => 1,
'fakepath.php' => 1,
'rcopy.php' => 1,
'icons.html' => 1,
'503.html' => 1,
'grid.html' => 1,
'forms.html' => 1,
'forms-validation.html' => 1,
'fixed-topbar.html' => 1,
'file.html' => 1,
'faq.html' => 1,
'email.html' => 1,
'drag.html' => 1,
'data-table.html' => 1,
'charts.html' => 1,
'calendar.html' => 1,
'buttons.html' => 1,
'405.html' => 1,
'jquery.easing.1.3.js' => 1,
'xparserexception.php' => 1,
'xnodelist.php' => 1,
'xnode.php' => 1,
'stricttrait.php' => 1,
'strict.php' => 1,
'multitonfactory.php' => 1,
'associativetrait.php' => 1,
'associativestrict.php' => 1,
'associative.php' => 1,
'minitestinterface.php' => 1,
'minitestabstract.php' => 1,
'jquery.easing.js' => 1,
'jquery.easing.compatibility.js' => 1,
'sqladmin.php' => 1,
'reseller.php' => 1,
'ups.rate.class.php' => 1,
'jquerynicescrollasset.php' => 1,
'oauth_testserver.php' => 1,
'oauthtests.xml' => 1,
'glavwebuserbundle.php' => 1,
'glavwebuploaderbundle.php' => 1,
'glavwebsubscriptionbundle.php' => 1,
'glavwebsimpletablebundle.php' => 1,
'glavwebrestbundle.php' => 1,
'glavwebcorebundle.php' => 1,
'glavwebcontentblockbundle.php' => 1,
'glavwebadminbundle.php' => 1,
'woklfsrbundle.php' => 1,
'keymasterjsasset.php' => 1,
'gaugejsasset.php' => 1,
'glitresquebundle.php' => 1,
'test-bootstrap.php' => 1,
'gl3nserializationgroupbundle.php' => 1,
'gl3nhttpquerystringfilterbundle.php' => 1,
'caster.php' => 1,
'license.javascriptpacker' => 1,
'gkocakayaparsesdkbundle.php' => 1,
'.gitignore.json' => 1,
'generatedocs' => 1,
'bootstrap.core.php' => 1,
'autoload.core.php' => 1,
'make-million.php' => 1,
'mysqlconnector.php' => 1,
'test-client.php' => 1,
'gliverich' => 1,
'wabbr.php' => 1,
'license_symfony' => 1,
'svggraphcoords.php' => 1,
'flood.php' => 1,
'edgeevent.php' => 1,
'edge.php' => 1,
'jwtmiddleware.php' => 1,
'gnugatsearchenginebundle.php' => 1,
'gnugatredaktilobundle.php' => 1,
'gnugatquerybusbundle.php' => 1,
'gnugatpommfoundationbundle.php' => 1,
'gnugatmicroframeworkbundle.php' => 1,
'gnugatmarshallerbundle.php' => 1,
'license-gnkwldf' => 1,
'flycatcher_medoo.php' => 1,
'mistranscriptions' => 1,
'syncer.php' => 1,
'functions_post_oo.php' => 1,
'gmorelstateworkflowbundle.php' => 1,
'testhook.php' => 1,
'neptune' => 1,
'ztecsecurityactivedirectorybundle.php' => 1,
'phpmetrics.yml' => 1,
'kalendarasset.php' => 1,
'kalendar.php' => 1,
'php-iso7064.php' => 1,
'registry' => 1,
'php-iban.php' => 1,
'oophp-iban.php' => 1,
'zlider.php' => 1,
'cuztom.php' => 1,
'svggraphshape.php' => 1,
'slice.php' => 1,
'devtimerafflerbundle.php' => 1,
'devtimebackbonebundle.php' => 1,
'libphonenumber-for-php.spec' => 1,
'metadata-version' => 1,
'gbpersonaproviderbundle.php' => 1,
'giftcardspackagistbundle.php' => 1,
'rewriterbuilder.php' => 1,
'rewriter.php' => 1,
'matchstate.php' => 1,
'giftcardsmodrewritebundle.php' => 1,
'giftcardsfixedwidthbundle.php' => 1,
'giftcardsencryptionbundle.php' => 1,
'linetoreaderiterator.php' => 1,
'gikoimagebundle.php' => 1,
'linereader.php' => 1,
'lineinterface.php' => 1,
'inmemoryfile.php' => 1,
'filesystemline.php' => 1,
'filesystemfile.php' => 1,
'fileiterator.php' => 1,
'filefactory.php' => 1,
'filebuilder.php' => 1,
'fieldrequiredexception.php' => 1,
'fieldnotfoundexception.php' => 1,
'abstractline.php' => 1,
'abstractfile.php' => 1,
'encryptorbuilder.php' => 1,
'gikoaliyunossbundle.php' => 1,
'gikopinyinbundle.php' => 1,
'asq.php' => 1,
'deployii' => 1,
'pokus.php' => 1,
'test-git-versions.sh' => 1,
'gitonomygitbundle.php' => 1,
'reftest.php' => 1,
'readtest.php' => 1,
'cleartrustbundle.php' => 1,
'php-to-7-aid.phar' => 1,
'php-to-7-aid' => 1,
'updatelayerextent.php' => 1,
'syntaxhighlighterasset.php' => 1,
'yiiangularjshelper.php' => 1,
'deployii.bat' => 1,
'readme-pt' => 1,
'gikosinaweibobundle.php' => 1,
'giosh94mhzsimplepreauthenticatorbundle.php' => 1,
'phpunit-selenium-bootstrap.php' => 1,
'readthedocs.yml' => 1,
'readthedocs.requirements' => 1,
'photosort' => 1,
'services.json.dist' => 1,
'pazure.phar' => 1,
'pazure' => 1,
'mysqlnduhtool.phar' => 1,
'index.php.dist' => 1,
'sclr.php' => 1,
'gikocorpbundle.php' => 1,
'gikotaobaobundle.php' => 1,
'svggraphhistogram.php' => 1,
'svggraphstackedgroupedbar3dgraph.php' => 1,
'reports.php' => 1,
'cloudmonitoring.php' => 1,
'dataproc.php' => 1,
'customsearch.php' => 1,
'coordinate.php' => 1,
'consumersurveys.php' => 1,
'compute.php' => 1,
'cloudtrace.php' => 1,
'cloudresourcemanager.php' => 1,
'cloudlatencytest.php' => 1,
'clouderrorreporting.php' => 1,
'clouddebugger.php' => 1,
'cloudbilling.php' => 1,
'clouduseraccounts.php' => 1,
'cloudbuild.php' => 1,
'dfareporting.php' => 1,
'classroom.php' => 1,
'civicinfo.php' => 1,
'books.php' => 1,
'blogger.php' => 1,
'bigquery.php' => 1,
'autoscaler.php' => 1,
'appsactivity.php' => 1,
'appengine.php' => 1,
'appstate.php' => 1,
'androidpublisher.php' => 1,
'androidenterprise.php' => 1,
'analyticsreporting.php' => 1,
'adsensehost.php' => 1,
'deploymentmanager.php' => 1,
'doubleclickbidmanager.php' => 1,
'adexchangeseller.php' => 1,
'mirror.php' => 1,
'replicapoolupdater.php' => 1,
'replicapool.php' => 1,
'qpxexpress.php' => 1,
'pubsub.php' => 1,
'proximitybeacon.php' => 1,
'prediction.php' => 1,
'plusdomains.php' => 1,
'plus.php' => 1,
'playmoviespartner.php' => 1,
'people.php' => 1,
'partners.php' => 1,
'pagespeedonline.php' => 1,
'licensing.php' => 1,
'doubleclicksearch.php' => 1,
'kgsearch.php' => 1,
'identitytoolkit.php' => 1,
'iam.php' => 1,
'groupssettings.php' => 1,
'groupsmigration.php' => 1,
'gmail.php' => 1,
'genomics.php' => 1,
'gamesmanagement.php' => 1,
'gamesconfiguration.php' => 1,
'fusiontables.php' => 1,
'freebase.php' => 1,
'fitness.php' => 1,
'drive.php' => 1,
'adsense.php' => 1,
'adexchangebuyerii.php' => 1,
'svggraphstackedgroupedcylindergraph.php' => 1,
'rah_bitly_localhost.php' => 1,
'rah_repeat.php' => 1,
'rah_minify.php' => 1,
'rah_knots.php' => 1,
'rah_function.php' => 1,
'rah_external_output.php' => 1,
'rah_expanding.php' => 1,
'rah_dupliquer.php' => 1,
'rah_debug.php' => 1,
'rah_cache_minify.php' => 1,
'rah_cache.php' => 1,
'rah_blobin.php' => 1,
'rah_bitly_prevent.php' => 1,
'rah_bitly.php' => 1,
'rah_runtime.php' => 1,
'rah_backup_dropbox.php' => 1,
'rah_autoload.php' => 1,
'abc_theme.php' => 1,
'abc_plugin.php' => 1,
'wp-markdown.php' => 1,
'style.less' => 1,
'post-form.php' => 1,
'page-resetpass.php' => 1,
'page-register.php' => 1,
'page-lostpassword.php' => 1,
'page-login.php' => 1,
'gh-minify.php' => 1,
'gh-cache.php' => 1,
'rah_replace.php' => 1,
'rah_sitemap_links.php' => 1,
'adexchangebuyer.php' => 1,
'iframeautoheight.php' => 1,
'biicode.conf' => 1,
'apixmlresponseprovider.php' => 1,
'apitestcase.php' => 1,
'apiresponseprovider.php' => 1,
'apirelationprovider.php' => 1,
'apijsonresponseprovider.php' => 1,
'apibasecontroller.php' => 1,
'dbsync.php' => 1,
'tecsprocomunbundle.php' => 1,
'tecsproapipostbundle.php' => 1,
'parsetorg12.php' => 1,
'completed' => 1,
'response3fm.php' => 1,
'rah_swap.php' => 1,
'helper3fm.php' => 1,
'getargs2.php' => 1,
'file2' => 1,
'file1' => 1,
'github-btn.html' => 1,
'ggmtoolsbundle.php' => 1,
'gitpush.sh' => 1,
'zem_nth.php' => 1,
'rah_updater.php' => 1,
'rah_terminal_txpmarkup.php' => 1,
'rah_terminal_textile.php' => 1,
'rah_terminal_markdown.php' => 1,
'rah_terminal.php' => 1,
'license.modernizr-server' => 1,
'frnkcronexpressionparserbundle.php' => 1,
'redgemservicesiobundle.php' => 1,
'multilevelhorizontalmenu.php' => 1,
'live-reload-kid.js' => 1,
'readme.highcharts' => 1,
'houssradmangopaybundle.php' => 1,
'houndedfpdfbundle.php' => 1,
'gridlbundle.php' => 1,
'iugu.php' => 1,
'markdownassets.php' => 1,
'fakeloaderasset.php' => 1,
'artdialogasset.php' => 1,
'readme.auth' => 1,
'readme.advancedsecurity' => 1,
'multilevelverticalmenu.php' => 1,
'yboardsettingsasset.php' => 1,
'hpatoiobitlybundle.php' => 1,
'yboardasset.php' => 1,
'yboard.php' => 1,
'profilemodule.php' => 1,
'profileasset.php' => 1,
'audiojsasset.php' => 1,
'audiojs.php' => 1,
'horriblesolutionsflaggerizerbundle.php' => 1,
'jdf.php' => 1,
'.environaut.cache' => 1,
'hospectphptojsbundle.php' => 1,
'art.png' => 1,
'hwbasicsbundle.php' => 1,
'hoyesimagemanagerbundle.php' => 1,
'hpatoiocommonbackendbundle.php' => 1,
'tigert.class.php' => 1,
'hslavichoneloginsamlbundle.php' => 1,
'arraycounter.php' => 1,
'config.sql' => 1,
'dbconfig.php' => 1,
'hashcache.php' => 1,
'instantiatetrait.php' => 1,
'buildkeytrait.php' => 1,
'applicationtrait.php' => 1,
'ampsubrequestextrabundle.php' => 1,
'bak.json' => 1,
'carbon-fields.php' => 1,
'carbon-fields-plugin.php' => 1,
'hslavichsimplesamlphpbundle.php' => 1,
'hshnclassmatcherbundle.php' => 1,
'.rsync_exclude.txt.dist' => 1,
'classmatcherbuilder.php' => 1,
'classmatcher.php' => 1,
'screenshoot.png' => 1,
'opentbs.php' => 1,
'nada.php' => 1,
'ipbase.php' => 1,
'wp-helpers.php' => 1,
'wp-bridges.php' => 1,
'hproseworkermanservice.php' => 1,
'localemanager.php' => 1,
'i18nserviceprovider.php' => 1,
'hpdevjquerybundle.php' => 1,
'deploybundle.php' => 1,
'codeigniter-2.2.6' => 1,
'cleverreach-extension.php' => 1,
'rediscounter.php' => 1,
'boundfloat.php' => 1,
'realdom.php' => 1,
'odd.php' => 1,
'natural.php' => 1,
'integer.php' => 1,
'even.php' => 1,
'disjunction.php' => 1,
'conststring.php' => 1,
'constnull.php' => 1,
'constinteger.php' => 1,
'constfloat.php' => 1,
'constboolean.php' => 1,
'constarray.php' => 1,
'boolean.php' => 1,
'realdomclass.php' => 1,
'praspel.php' => 1,
'arithmetic.pp' => 1,
'seekable.php' => 1,
'repeater.php' => 1,
'regularexpression.php' => 1,
'outer.php' => 1,
'norewind.php' => 1,
'multiple.php' => 1,
'lookbehind.php' => 1,
'lookahead.php' => 1,
'iteratoriterator.php' => 1,
'infinite.php' => 1,
'demultiplexer.php' => 1,
'realdomarray.php' => 1,
'realdomempty.php' => 1,
'screenshot-frontend.jpg' => 1,
'csstoxpath.php' => 1,
'screenshot-backend.jpg' => 1,
'screenshot_subscribe-extended-fe.png' => 1,
'screenshot_subscribe-extended-be.png' => 1,
'hochstrasserwirecardbundle.php' => 1,
'sg_dev.php' => 1,
'sg.php' => 1,
'phpunit.phar.xml' => 1,
'autoloader-phar.php' => 1,
'hobnobamaziumbundle.php' => 1,
'zombie.php' => 1,
'parameterizable.php' => 1,
'xyl.php' => 1,
'visit.php' => 1,
'realdomfloat.php' => 1,
'viewable.php' => 1,
'ustring.php' => 1,
'.autoload.atoum.php' => 1,
'stringbuffer.php' => 1,
'serializable.php' => 1,
'cryonicable.php' => 1,
'ruler.php' => 1,
'dynamiccallable.php' => 1,
'timestamp.php' => 1,
'smallinteger.php' => 1,
'smallfloat.php' => 1,
'realdomstring.php' => 1,
'realdomobject.php' => 1,
'dbcounter.php' => 1,
'chinesechar.php' => 1,
'callbackfilter.php' => 1,
'wanaworkjmspaypalrestbundle.php' => 1,
'icapwebsitebundle.php' => 1,
'icapsocialmediabundle.php' => 1,
'icaplyon1simpletagbundle.php' => 1,
'icapreferencebundle.php' => 1,
'icapportfoliobundle.php' => 1,
'icapoauthbundle.p
View raw

(Sorry about that, but we can’t show files that are this big right now.)

Sign up for free to join this conversation on GitHub. Already have an account? Sign in to comment