Created
April 21, 2016 12:33
-
-
Save Seldaek/27a141c7e21f1a1e816461b97c199930 to your computer and use it in GitHub Desktop.
PHP Ecosystem Scan
This file has been truncated, but you can view the full file.
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| <?php return array ( | |
| 'file' => | |
| array ( | |
| 'README' => 71549, | |
| '.gitignore' => 56048, | |
| 'LICENSE' => 42975, | |
| '.travis.yml' => 27817, | |
| 'phpunit.xml.dist' => 14730, | |
| 'phpunit.xml' => 12788, | |
| 'composer.lock' => 10886, | |
| '.gitattributes' => 6851, | |
| 'CHANGELOG' => 6765, | |
| '.scrutinizer.yml' => 5365, | |
| 'contributing' => 4027, | |
| '.editorconfig' => 3550, | |
| 'module.php' => 2663, | |
| 'build.xml' => 1832, | |
| '.coveralls.yml' => 1738, | |
| 'index.php' => 1706, | |
| '.php_cs' => 1591, | |
| 'bootstrap.php' => 1152, | |
| 'makefile' => 1120, | |
| '_config.php' => 1054, | |
| 'licence' => 1033, | |
| '.htaccess' => 879, | |
| '.styleci.yml' => 731, | |
| 'phpspec.yml' => 688, | |
| 'VERSION' => 685, | |
| 'autoload_classmap.php' => 645, | |
| 'autoload.php' => 641, | |
| 'example.php' => 628, | |
| 'phpcs.xml' => 619, | |
| 'composer.phar' => 616, | |
| '.codeclimate.yml' => 577, | |
| '.gitmodules' => 553, | |
| 'conduct' => 513, | |
| 'phpunit.php' => 467, | |
| 'COPYING' => 463, | |
| 'test.php' => 455, | |
| 'TODO' => 452, | |
| 'codeception.yml' => 425, | |
| 'CHANGES' => 393, | |
| 'vagrantfile' => 387, | |
| 'UPGRADE' => 381, | |
| 'config.php' => 362, | |
| 'start.php' => 340, | |
| 'package.xml' => 318, | |
| 'autoload_register.php' => 295, | |
| 'manifest.xml' => 291, | |
| 'phpmd.xml' => 290, | |
| 'autoload_function.php' => 289, | |
| 'phpdoc.dist.xml' => 277, | |
| 'install' => 254, | |
| 'box.json' => 246, | |
| '.project' => 242, | |
| 'behat.yml' => 235, | |
| 'phpspec.yml.dist' => 231, | |
| 'circle.yml' => 228, | |
| 'logo.png' => 225, | |
| '.ds_store' => 220, | |
| 'contributors' => 211, | |
| 'authors' => 202, | |
| 'autoloader.php' => 194, | |
| 'index.html' => 193, | |
| 'build.default.properties' => 192, | |
| 'init.php' => 190, | |
| 'notice' => 189, | |
| 'registration.php' => 188, | |
| 'server.php' => 187, | |
| '.bowerrc' => 185, | |
| 'exception.php' => 181, | |
| 'yii.bat' => 180, | |
| '.buildpath' => 170, | |
| 'requirements.php' => 170, | |
| 'CREDITS' => 167, | |
| 'apigen.neon' => 165, | |
| '.env.example' => 163, | |
| 'modman' => 159, | |
| '.semver' => 154, | |
| 'ext_emconf.php' => 151, | |
| '.atoum.php' => 150, | |
| 'ruleset.xml' => 149, | |
| 'build.properties' => 147, | |
| 'artisan' => 141, | |
| 'mkdocs.yml' => 139, | |
| '.check-author.yml' => 136, | |
| 'appveyor.yml' => 136, | |
| 'functions.php' => 133, | |
| 'phpdoc.xml' => 132, | |
| 'favicon.ico' => 131, | |
| 'ext_localconf.php' => 130, | |
| 'demo.php' => 128, | |
| 'change' => 123, | |
| 'config.xml' => 123, | |
| 'client.php' => 122, | |
| 'code-of-conduct' => 122, | |
| 'yii' => 122, | |
| 'MIT-LICENSE' => 120, | |
| 'helpers.php' => 116, | |
| 'dockerfile' => 113, | |
| 'widget.php' => 109, | |
| 'behat.yml.dist' => 109, | |
| 'ride.json' => 107, | |
| 'logo.gif' => 105, | |
| 'routes.php' => 102, | |
| 'screenshot.png' => 100, | |
| 'ext_tables.php' => 99, | |
| 'autoloadexample.php' => 97, | |
| 'robots' => 96, | |
| 'phpunit.travis.xml' => 95, | |
| 'icon.png' => 95, | |
| 'ext_icon.gif' => 94, | |
| 'manifest.php' => 93, | |
| 'doxyfile' => 92, | |
| 'autoload.php.dist' => 92, | |
| 'provides.json' => 91, | |
| 'build.php' => 91, | |
| 'extension.xml' => 91, | |
| 'module.json' => 90, | |
| '.bootstrap.atoum.php' => 90, | |
| 'init_autoloader.php' => 89, | |
| 'docker-compose.yml' => 89, | |
| 'console' => 87, | |
| 'api.php' => 87, | |
| 'install.php' => 83, | |
| 'controller.php' => 83, | |
| 'readme.textile' => 83, | |
| 'build.sh' => 83, | |
| 'phpdox.xml' => 82, | |
| 'copyright' => 81, | |
| 'app.php' => 81, | |
| 'phpmd.xml.dist' => 81, | |
| 'robofile.php' => 80, | |
| 'gemfile' => 79, | |
| 'config.json' => 78, | |
| 'upgrade-2.2' => 78, | |
| 'include.php' => 76, | |
| 'activate.php' => 76, | |
| 'init' => 76, | |
| 'plugin.php' => 75, | |
| 'travis.phpunit.xml' => 74, | |
| 'copying.lesser' => 74, | |
| '.sensiolabs.yml' => 72, | |
| 'init.bat' => 72, | |
| 'serviceprovider.php' => 71, | |
| 'upgrade-2.3' => 71, | |
| 'ext_tables.sql' => 69, | |
| 'cache.php' => 68, | |
| 'phpunit.xml.ci' => 67, | |
| 'code_of_conduct' => 67, | |
| 'router.php' => 67, | |
| 'upgrading' => 66, | |
| 'request.php' => 65, | |
| 'phpci.yml' => 65, | |
| 'application.php' => 64, | |
| 'test' => 63, | |
| 'phpunit.dist.xml' => 62, | |
| 'style.css' => 62, | |
| '.formatter.yml' => 62, | |
| 'collection.php' => 62, | |
| 'response.php' => 62, | |
| 'guardfile' => 61, | |
| 'examples.php' => 61, | |
| 'config.rb' => 61, | |
| 'events.php' => 60, | |
| 'install.sh' => 60, | |
| 'rakefile' => 60, | |
| 'class.pth' => 58, | |
| 'phpdox.xml.dist' => 58, | |
| 'connection.php' => 58, | |
| 'cli-config.php' => 56, | |
| 'mailer.php' => 55, | |
| 'ezinfo.php' => 55, | |
| 'phpspec.yml.ci' => 55, | |
| '.travis.env' => 54, | |
| '.travis.key' => 54, | |
| 'composer.json~' => 53, | |
| 'manager.php' => 53, | |
| '.travis.install' => 53, | |
| 'couscous.yml' => 53, | |
| 'sami.php' => 52, | |
| 'image.php' => 52, | |
| 'factory.php' => 52, | |
| 'DESCRIPTION' => 52, | |
| 'scrutinizer.yml' => 51, | |
| '.travis.composer.config.json' => 51, | |
| '.gush.yml' => 51, | |
| 'upgrade-2.4' => 51, | |
| 'readme.html' => 51, | |
| 'ext_conf_template' => 50, | |
| 'console.php' => 50, | |
| 'activerecord.php' => 49, | |
| 'test.sh' => 49, | |
| 'file.php' => 49, | |
| 'gemfile.lock' => 49, | |
| '.hhconfig' => 49, | |
| '.travis.php.ini' => 49, | |
| 'asset.php' => 48, | |
| 'parser.php' => 48, | |
| 'web.config' => 48, | |
| 'extension.php' => 47, | |
| 'sonar-project.properties' => 47, | |
| 'version.php' => 47, | |
| 'message.php' => 47, | |
| 'sample.php' => 46, | |
| '.hgignore' => 46, | |
| '.coke' => 45, | |
| '.arcconfig' => 45, | |
| 'view.php' => 45, | |
| 'history' => 45, | |
| 'setup.php' => 44, | |
| 'procfile' => 44, | |
| 'manifest.json' => 44, | |
| '.infra.json' => 44, | |
| 'deactivate.php' => 44, | |
| 'session.php' => 43, | |
| 'container.php' => 43, | |
| 'cli.php' => 43, | |
| 'changelog-1.0' => 43, | |
| 'campaignchain.yml' => 43, | |
| 'capfile' => 43, | |
| 'form.php' => 43, | |
| 'box.json.dist' => 42, | |
| 'puli.json' => 42, | |
| 'database.php' => 42, | |
| 'license-mit' => 42, | |
| 'package.php' => 42, | |
| 'peridot.php' => 42, | |
| 'elefant.json' => 41, | |
| 'loader.php' => 41, | |
| 'search.php' => 41, | |
| 'user.php' => 41, | |
| '.state' => 41, | |
| 'language.xml' => 41, | |
| '.dunitconfig' => 41, | |
| '.rmt.yml' => 40, | |
| 'change.xml' => 40, | |
| 'admin.php' => 40, | |
| 'screenshot-1.png' => 40, | |
| 'travis.php.ini' => 40, | |
| 'base.php' => 39, | |
| 'event.php' => 39, | |
| 'ext_icon.png' => 39, | |
| 'phinx.yml' => 39, | |
| 'pallo.json' => 39, | |
| '.env' => 39, | |
| 'phprelease.ini' => 38, | |
| 'screenshot.jpg' => 38, | |
| 'query.php' => 38, | |
| 'phpcs.xml.dist' => 37, | |
| 'curl.php' => 37, | |
| 'template_map.php' => 37, | |
| '.gitreview' => 37, | |
| 'shippable.yml' => 37, | |
| 'runtests.sh' => 37, | |
| 'default-enable' => 37, | |
| 'coverage-checker.php' => 37, | |
| 'uninstall.php' => 37, | |
| '.old-scrutinizer.yml' => 36, | |
| 'versioning' => 36, | |
| 'html.php' => 36, | |
| '.travis.sh' => 36, | |
| 'gulpfile.js' => 36, | |
| 'package.ini' => 36, | |
| 'route.php' => 36, | |
| '.jshintrc' => 36, | |
| 'phpunit.phar' => 36, | |
| '_tests_bootstrap.php' => 36, | |
| 'phpunit' => 35, | |
| 'codeception.dist.yml' => 35, | |
| 'ini.php' => 34, | |
| 'plugin.xml' => 34, | |
| 'assets.php' => 34, | |
| 'release' => 34, | |
| 'documentation' => 34, | |
| 'cacert.pem' => 34, | |
| 'roadmap' => 34, | |
| '.sami.php' => 34, | |
| 'descriptor.php' => 33, | |
| 'repository.php' => 33, | |
| 'options.php' => 33, | |
| 'main.php' => 33, | |
| '.package.yml' => 32, | |
| 'config.yml' => 32, | |
| 'wp-cli.yml' => 32, | |
| 'generate-api.sh' => 32, | |
| '.dockerignore' => 31, | |
| 'page.php' => 31, | |
| 'phpunit.xml.travis' => 31, | |
| 'icon.svg' => 31, | |
| 'command.php' => 31, | |
| 'activefield.php' => 31, | |
| 'header.php' => 31, | |
| 'news' => 31, | |
| 'tests.php' => 30, | |
| 'http.php' => 30, | |
| 'helper.php' => 30, | |
| 'unlicense' => 30, | |
| 'constants.php' => 29, | |
| 'model.php' => 29, | |
| 'validator.php' => 29, | |
| 'settings.php' => 29, | |
| 'run-tests.sh' => 29, | |
| 'cs.sh' => 29, | |
| 'build.properties.dev' => 29, | |
| 'core.php' => 29, | |
| 'db.php' => 29, | |
| 'packages.json' => 29, | |
| '.php_cs.dist' => 29, | |
| 'auth.php' => 29, | |
| '.atoum.bootstrap.php' => 28, | |
| 'license_afl' => 28, | |
| 'readme.mkd' => 28, | |
| 'footer.php' => 28, | |
| '.tavis.yml' => 28, | |
| 'src.php' => 28, | |
| 'tests.xml' => 28, | |
| 'phpunit.sh' => 28, | |
| 'wercker.yml' => 28, | |
| 'build.properties.default' => 27, | |
| 'menu.php' => 27, | |
| '.phpspec_cs' => 27, | |
| 'activeform.php' => 27, | |
| 'configuration.php' => 27, | |
| 'phpunit-bootstrap.php' => 27, | |
| 'installer.php' => 27, | |
| '.travis.composer.php' => 27, | |
| 'button.php' => 27, | |
| 'logger.php' => 26, | |
| 'nav.php' => 26, | |
| 'dispatcher.php' => 26, | |
| 'generator.php' => 26, | |
| 'update.php' => 26, | |
| 'activequery.php' => 26, | |
| 'phpmd.sh' => 26, | |
| 'stub.php' => 25, | |
| 'translation.php' => 25, | |
| 'run_tests.sh' => 25, | |
| 'build.jenkins.xml' => 25, | |
| 'redirect.php' => 25, | |
| 'registry.php' => 25, | |
| 'assetbundle.php' => 25, | |
| 'benchmark.php' => 25, | |
| 'make-toc' => 25, | |
| 'upgrade-2.0' => 25, | |
| 'php.ini' => 25, | |
| 'component.php' => 25, | |
| 'makedoc.sh' => 25, | |
| 'init.sh' => 25, | |
| 'release-notes' => 25, | |
| '.mailmap' => 25, | |
| 'icon.php' => 25, | |
| 'humans' => 25, | |
| 'error.php' => 25, | |
| 'url.php' => 25, | |
| 'template.php' => 25, | |
| 'json.php' => 25, | |
| 'migration.php' => 25, | |
| 'humbug.json.dist' => 24, | |
| 'callback.php' => 24, | |
| 'phing.xml' => 24, | |
| 'datepicker.php' => 24, | |
| 'phpunit.hhvm.xml' => 24, | |
| 'fontawesomeasset.php' => 24, | |
| 'ext_autoload.php' => 24, | |
| 'dropdown.php' => 24, | |
| 'service.php' => 24, | |
| 'pom.xml' => 24, | |
| 'boot.php' => 24, | |
| 'phpunit-ci.xml' => 23, | |
| 'docs' => 23, | |
| 'manifest.yml' => 23, | |
| 'ext.php' => 23, | |
| 'screenshot-2.png' => 23, | |
| 'readme_ru' => 23, | |
| 'config.ini' => 23, | |
| 'facadeprovider.php' => 23, | |
| 'environment.php' => 23, | |
| 'readme.ru' => 23, | |
| 'util.php' => 23, | |
| 'coverage.clover' => 22, | |
| 'koharness.php' => 22, | |
| 'filesystem.php' => 22, | |
| 'log.php' => 22, | |
| 'run.php' => 22, | |
| '.config' => 22, | |
| 'setup' => 22, | |
| '.gitlab-ci.yml' => 22, | |
| 'readme.md~' => 22, | |
| 'cron.php' => 22, | |
| 'querybuilder.php' => 22, | |
| 'worker.php' => 22, | |
| '.phpdoc-md' => 22, | |
| '.travis.install.sh' => 22, | |
| 'infra.php' => 22, | |
| 'login.php' => 21, | |
| 'debug.php' => 21, | |
| 'dependencies.ini' => 21, | |
| 'finder.php' => 21, | |
| 'codesniffer.ruleset.xml' => 21, | |
| '.drone.yml' => 21, | |
| 'momentasset.php' => 21, | |
| 'api' => 21, | |
| 'sidebar.php' => 21, | |
| 'config.yml.dist' => 20, | |
| 'setup.sh' => 20, | |
| 'metadata.php' => 20, | |
| 'config.php.dist' => 20, | |
| 'load.php' => 20, | |
| 'rmt.json' => 20, | |
| 'classloader.php' => 20, | |
| 'wp-config.php' => 20, | |
| 'module-config.json' => 20, | |
| 'alert.php' => 20, | |
| 'markdown.php' => 20, | |
| 'build' => 20, | |
| 'rmt' => 20, | |
| 'filter.php' => 20, | |
| 'composer.yml' => 19, | |
| '404.php' => 19, | |
| 'navbar.php' => 19, | |
| 'post-install' => 19, | |
| 'tcpdf.php' => 19, | |
| 'travis.yml' => 19, | |
| '.composer-auth.json' => 19, | |
| 'releases.json' => 19, | |
| 'notes' => 19, | |
| 'single.php' => 19, | |
| 'license-2.0' => 19, | |
| 'backmatter' => 19, | |
| 'common.php' => 19, | |
| 'utils.php' => 19, | |
| '.dreamfactory.php' => 19, | |
| 'mail.php' => 19, | |
| 'bundle.php' => 19, | |
| 'tinymce.php' => 19, | |
| 'coreasset.php' => 18, | |
| 'phpcs-ruleset.xml' => 18, | |
| 'upgrade-3.0' => 18, | |
| 'bob_config.php' => 18, | |
| '.appveyor.yml' => 18, | |
| 'scripthandler.php' => 18, | |
| 'handler.php' => 18, | |
| 'builder.php' => 18, | |
| 'release_notes' => 18, | |
| 'dynamicreturntypemeta.json' => 18, | |
| 'license-agpl' => 18, | |
| 'archive.php' => 18, | |
| 'tinymceasset.php' => 18, | |
| 'phpunit_bootstrap.php' => 18, | |
| 'translator.php' => 18, | |
| 'license-commercial-websites' => 18, | |
| 'usage' => 18, | |
| 'jfusion.xml' => 18, | |
| 'graph.php' => 18, | |
| 'update' => 18, | |
| 'license-commercial-website' => 18, | |
| 'dev.phpunit.xml' => 18, | |
| 'license-commercial-saas' => 18, | |
| 'map.php' => 18, | |
| 'index-test.php' => 17, | |
| 'deps' => 17, | |
| 'contribute' => 17, | |
| 'changelog.yml' => 17, | |
| 'action.php' => 17, | |
| 'uploader.php' => 17, | |
| 'arr.php' => 17, | |
| 'readme_en' => 17, | |
| 'ext_typoscript_setup' => 17, | |
| 'build.local.xml' => 17, | |
| 'errorhandler.php' => 17, | |
| 'fig.yml' => 17, | |
| 'exampleconfig.yaml' => 17, | |
| 'autoload.json' => 17, | |
| 'docs.php' => 17, | |
| 'connect.php' => 17, | |
| 'clearsessions.php' => 17, | |
| 'bootstrap.hh' => 17, | |
| 'upgrade-1.1' => 17, | |
| 'config-sample.php' => 17, | |
| 'component.json' => 16, | |
| 'peridot.hh' => 16, | |
| 'openid.php' => 16, | |
| 'xvengine.json' => 16, | |
| 'sage.config' => 16, | |
| 'table.php' => 16, | |
| 'screenshot-3.png' => 16, | |
| 'views.php' => 16, | |
| 'select2asset.php' => 16, | |
| '.travis.composer.json' => 16, | |
| 'clientinterface.php' => 16, | |
| 'gridview.php' => 16, | |
| '.atoum.travis.php' => 16, | |
| 'changelog-1.1' => 16, | |
| 'tcpdf_parser.php' => 16, | |
| 'tasks' => 16, | |
| 'html.inc' => 16, | |
| 'change_log' => 16, | |
| 'review' => 15, | |
| 'panel.php' => 15, | |
| 'modal.php' => 15, | |
| 'breadcrumbs.php' => 15, | |
| 'cacheinterface.php' => 15, | |
| 'infra.js' => 15, | |
| 'nginx.conf' => 15, | |
| 'sms.php' => 15, | |
| 'ckeditor.php' => 15, | |
| 'bootstrap.php.dist' => 15, | |
| 'queue.php' => 15, | |
| 'testrunner.yml' => 15, | |
| 'readme.ja' => 15, | |
| 'starter.php' => 15, | |
| 'travis-php.ini' => 15, | |
| '.php_cs.php' => 15, | |
| 'deploy.sh' => 15, | |
| 'copying lesser' => 15, | |
| '.arclint' => 15, | |
| 'testing' => 15, | |
| '.phpstorm.meta.php' => 15, | |
| 'xmlrpc.php' => 15, | |
| 'storage.php' => 15, | |
| 'migrations.yml' => 15, | |
| 'datetimepicker.php' => 15, | |
| 'config.example.php' => 15, | |
| '.env.dist' => 15, | |
| 'faq' => 15, | |
| 'phpunit.bat' => 14, | |
| 'composer.php' => 14, | |
| 'psr2tabs.xml' => 14, | |
| 'inputwidget.php' => 14, | |
| 'examples' => 14, | |
| 'codesniffer' => 14, | |
| 'kernel.php' => 14, | |
| 'paginator.php' => 14, | |
| 'htaccess' => 14, | |
| 'xml.php' => 14, | |
| 'phpcompatinfo.json' => 14, | |
| 'bootstrap.sh' => 14, | |
| '.travis.coverage.sh' => 14, | |
| 'pagination.php' => 14, | |
| 'humbug.json' => 14, | |
| 'example.html' => 14, | |
| '.version' => 14, | |
| 'run-tests' => 14, | |
| 'readme-git' => 14, | |
| 'example.png' => 14, | |
| '.cloak.toml' => 14, | |
| 'tag.php' => 14, | |
| '.travis-phpunit.xml' => 14, | |
| 'feed.php' => 14, | |
| 'date.php' => 14, | |
| 'lab.config' => 14, | |
| '.coveralls.toml' => 14, | |
| 'build-pre-commit.xml' => 14, | |
| 'config' => 14, | |
| 'node.php' => 14, | |
| 'grumphp.yml' => 14, | |
| 'license.mit' => 14, | |
| 'comments.php' => 14, | |
| 'buttongroup.php' => 14, | |
| 'select2.php' => 13, | |
| 'datetimepickerasset.php' => 13, | |
| 'readme-ru' => 13, | |
| 'serializer.php' => 13, | |
| 'schema.php' => 13, | |
| 'entity.php' => 13, | |
| 'mpdf.php' => 13, | |
| 'testcase.php' => 13, | |
| 'datepickerasset.php' => 13, | |
| 'blok.php' => 13, | |
| 'provision.sh' => 13, | |
| 'theme.php' => 13, | |
| 'item.php' => 13, | |
| 'taskfile' => 13, | |
| 'requirements' => 13, | |
| 'deploy.php' => 13, | |
| 'upload.php' => 13, | |
| 'codeclimate.sh' => 13, | |
| 'app.json' => 13, | |
| 'validation.php' => 13, | |
| '.scrunitizer.yml' => 13, | |
| 'phar-stub.php' => 13, | |
| 'boxfile' => 13, | |
| 'progress.php' => 13, | |
| 'guide' => 13, | |
| 'result.php' => 13, | |
| 'author.php' => 13, | |
| '.htaccess.sample' => 13, | |
| 'sphinxsearchbundle.php' => 13, | |
| 'prolog.php' => 13, | |
| 'oauth.php' => 13, | |
| 'recipe.php' => 13, | |
| 'default_option.php' => 12, | |
| 'readme.org' => 12, | |
| 'tcpdf_autoconfig.php' => 12, | |
| 'content.php' => 12, | |
| 'tcpdf_import.php' => 12, | |
| 'phpunit.xml-dist' => 12, | |
| 'import.php' => 12, | |
| 'phpunit-ci.xml.dist' => 12, | |
| 'phpmd-pre-commit.xml' => 12, | |
| 'template.xml' => 12, | |
| 'docblox.dist.xml' => 12, | |
| 'typeaheadasset.php' => 12, | |
| 'ueditor.php' => 12, | |
| '_ide_helper.php' => 12, | |
| 'upgrade_to_1_2' => 12, | |
| 'run-test' => 12, | |
| 'install.xml' => 12, | |
| 'config_fonts.php' => 12, | |
| 'mpdf.css' => 12, | |
| 'compile.sh' => 12, | |
| 'inflector.php' => 12, | |
| 'releasenotes' => 12, | |
| 'wp-config-sample.php' => 12, | |
| 'wechat.php' => 12, | |
| 'cache.properties' => 12, | |
| 'browser.php' => 12, | |
| 'preview.png' => 12, | |
| 'tcpdf_barcodes_2d.php' => 12, | |
| 'install.sql' => 12, | |
| 'tcpdf_barcodes_1d.php' => 12, | |
| 'test-cov' => 12, | |
| 'connectioninterface.php' => 12, | |
| 'pearfarm.spec' => 12, | |
| 'package.xml.tmpl' => 12, | |
| 'revision' => 12, | |
| 'config.doxy' => 12, | |
| 'config.default.php' => 12, | |
| 'updates.php' => 12, | |
| 'demo.html' => 12, | |
| 'codecept.phar' => 12, | |
| 'runtests' => 12, | |
| 'path.php' => 12, | |
| 'register.php' => 12, | |
| 'config.m4' => 12, | |
| 'oauthtoken.php' => 12, | |
| 'cli' => 12, | |
| '.pullapprove.yml' => 12, | |
| 'rss.php' => 12, | |
| 'index' => 12, | |
| 'update.sh' => 11, | |
| 'compress.php' => 11, | |
| 'gpl' => 11, | |
| 'wp-links-opml.php' => 11, | |
| 'progbar.css' => 11, | |
| 'wp-settings.php' => 11, | |
| 'wp-mail.php' => 11, | |
| 'wp-login.php' => 11, | |
| 'wp-load.php' => 11, | |
| 'phpconfig.ini' => 11, | |
| 'color.php' => 11, | |
| '.directory' => 11, | |
| 'wp-trackback.php' => 11, | |
| 'data.php' => 11, | |
| 'wp-cron.php' => 11, | |
| 'wp-comments-post.php' => 11, | |
| 'homestead' => 11, | |
| 'wp-blog-header.php' => 11, | |
| 'wp-activate.php' => 11, | |
| 'wp-signup.php' => 11, | |
| 'samson.php' => 11, | |
| 'props.json' => 11, | |
| 'compiler.php' => 11, | |
| 'lib.php' => 11, | |
| 'logout.php' => 11, | |
| 'container.yml' => 11, | |
| 'cookie.php' => 11, | |
| 'license.lgpl' => 11, | |
| 'usermodule.php' => 11, | |
| 'yii.php' => 11, | |
| 'class.ext_update.php' => 11, | |
| 'activefixture.php' => 11, | |
| 'mysql.php' => 11, | |
| 'export.php' => 11, | |
| 'config.sample.php' => 11, | |
| '.hgtags' => 11, | |
| 'upgrade-2.1' => 11, | |
| 'tabs.php' => 11, | |
| 'assets.json' => 11, | |
| 'runner.php' => 11, | |
| 'release.sh' => 11, | |
| '404.html' => 11, | |
| 'usage.php' => 11, | |
| 'setting.php' => 11, | |
| 'document.php' => 11, | |
| 'typecheck' => 11, | |
| 'di.yml' => 11, | |
| 'phpspec.hhvm.yml' => 11, | |
| 'str.php' => 11, | |
| 'changelog-2.0' => 11, | |
| 'dumper.php' => 11, | |
| 'composers.php' => 11, | |
| 'crossdomain.xml' => 11, | |
| 'field.php' => 11, | |
| 'phpunit.bootstrap.php' => 11, | |
| 'daterangepicker.php' => 11, | |
| 'resetter.php' => 10, | |
| 'oauth2.php' => 10, | |
| 'payment.php' => 10, | |
| 'phpunit.coverage.xml' => 10, | |
| 'fileloader.php' => 10, | |
| 'php.ini.sample' => 10, | |
| 'qrcode.php' => 10, | |
| 'sidenav.php' => 10, | |
| 'tests.sh' => 10, | |
| 'text.php' => 10, | |
| '.bumpversion.cfg' => 10, | |
| 'phakefile' => 10, | |
| 'daterangepickerasset.php' => 10, | |
| 'sitemap.php' => 10, | |
| 'get.php' => 10, | |
| 'task.php' => 10, | |
| '.run' => 10, | |
| 'test.html' => 10, | |
| 'store.php' => 10, | |
| 'create-phar.php' => 10, | |
| 'bootstrap-dev.php' => 10, | |
| 'doxygen.conf' => 10, | |
| 'apigen.yml' => 10, | |
| 'kindeditorasset.php' => 10, | |
| 'adminasset.php' => 10, | |
| 'license.html' => 10, | |
| 'nitpick.json' => 10, | |
| 'qa-tools.json' => 10, | |
| 'adminmodule.php' => 10, | |
| 'readme.asciidoc' => 10, | |
| 'readme-ja' => 10, | |
| 'convert.php' => 10, | |
| 'crypt.php' => 10, | |
| 'globals.php' => 10, | |
| 'facade.php' => 10, | |
| 'runtests.bat' => 10, | |
| '.eslintrc' => 10, | |
| 'slider.php' => 10, | |
| '.jshintignore' => 10, | |
| 'info' => 10, | |
| 'captcha.php' => 10, | |
| 'vendors.php' => 10, | |
| 'apiary.apib' => 10, | |
| 'contributing.textile' => 10, | |
| 'ueditorasset.php' => 10, | |
| 'make-unit' => 10, | |
| 'run-tests-coverage' => 10, | |
| 'context.php' => 10, | |
| 'compile.php' => 10, | |
| 'module.conf.yaml' => 10, | |
| 'module.yaml' => 10, | |
| 'ajax.php' => 10, | |
| 'lgpl-3.0' => 10, | |
| 'analytics.php' => 10, | |
| 'formbuilder.php' => 10, | |
| 'autocompleteasset.php' => 10, | |
| 'example2.php' => 10, | |
| '.travis_shell_after_success.sh' => 10, | |
| 'authaction.php' => 10, | |
| '.travis.yml.dist' => 10, | |
| 'bootstrapasset.php' => 10, | |
| 'autoload.inc.php' => 10, | |
| 'splclassloader.php' => 10, | |
| 'invalidresponseexception.php' => 10, | |
| 'viewrenderer.php' => 10, | |
| 'uri.php' => 10, | |
| 'run-me.bat' => 10, | |
| 'bugfree.json' => 10, | |
| 'baseclient.php' => 10, | |
| 'translate.php' => 9, | |
| 'installation' => 9, | |
| 'hwioauthbundle.php' => 9, | |
| 'phpunit.local.xml' => 9, | |
| 'wrapper.php' => 9, | |
| 'imagecache.php' => 9, | |
| 'adminlteasset.php' => 9, | |
| 'aoe-logo.png' => 9, | |
| 'pager.php' => 9, | |
| 'app.yaml' => 9, | |
| 'dependencies' => 9, | |
| 'dco' => 9, | |
| 'token.php' => 9, | |
| 'build.xml.dist' => 9, | |
| 'currency.php' => 9, | |
| 'phpspec-ci.yml' => 9, | |
| '.-travis.yml' => 9, | |
| '.travis.ini' => 9, | |
| '.gitignore~' => 9, | |
| 'argument.php' => 9, | |
| 'connectionfactory.php' => 9, | |
| 'manual' => 9, | |
| 'compatibility.php' => 9, | |
| 'theme.xml' => 9, | |
| 'xmlseclibs.php' => 9, | |
| 'group.php' => 9, | |
| 'object.php' => 9, | |
| 'security.php' => 9, | |
| 'changelog-0.x' => 9, | |
| '.jscsrc' => 9, | |
| 'badge.php' => 9, | |
| 'htmlbuilder.php' => 9, | |
| 'sami-config.php' => 9, | |
| 'sami.config.php' => 9, | |
| 'lisence' => 9, | |
| 'phpunit-functional.xml.dist' => 9, | |
| 'phpunit-coverage.xml' => 9, | |
| 'managerregistry.php' => 9, | |
| 'email.php' => 9, | |
| 'apigen.conf' => 9, | |
| 'formatter.php' => 9, | |
| 'mddoc.xml' => 9, | |
| 'tutorial.php' => 9, | |
| 'docs.json' => 9, | |
| 'tags' => 9, | |
| 'sonatauserbundle.php' => 9, | |
| 'tree.php' => 9, | |
| 'helloworld.php' => 9, | |
| 'crawler.php' => 9, | |
| 'actioncolumn.php' => 9, | |
| 'paths.php' => 9, | |
| 'category.php' => 9, | |
| 'pakefile.php' => 9, | |
| 'example1.php' => 9, | |
| 'vendors.sh' => 9, | |
| 'composer.json.dist' => 9, | |
| 'composer' => 9, | |
| '.phpcs.xml' => 9, | |
| 'i18n.php' => 9, | |
| 'cname' => 9, | |
| 'phpunit.xsd' => 9, | |
| 'thumbnail.php' => 9, | |
| 'package.sh' => 9, | |
| 'yiic.php' => 9, | |
| 'issue_template' => 9, | |
| 'processor.php' => 9, | |
| 'readme.php' => 9, | |
| 'lang.php' => 9, | |
| 'activeassets.php' => 9, | |
| 'development_readme' => 9, | |
| 'hacking' => 9, | |
| 'twitter.php' => 9, | |
| 'getting_started' => 9, | |
| 'daemon.php' => 9, | |
| 'loaderinterface.php' => 9, | |
| 'authentication.php' => 9, | |
| 'font info' => 8, | |
| 'copying.lib' => 8, | |
| 'gpl-license' => 8, | |
| 'bootstrap_phpunit.php' => 8, | |
| 'sami_docs.php' => 8, | |
| 'codemirrorasset.php' => 8, | |
| 'yaml.php' => 8, | |
| 'giiasset.php' => 8, | |
| 'spark.info' => 8, | |
| 'yiic' => 8, | |
| 'settings.gradle' => 8, | |
| 'elements.php' => 8, | |
| 'log' => 8, | |
| 'build.gradle' => 8, | |
| 'ckeditorasset.php' => 8, | |
| 'screenshot-index.png' => 8, | |
| 'screenshot-4.png' => 8, | |
| 'qc.yml' => 8, | |
| 'portkey.json' => 8, | |
| 'backend.php' => 8, | |
| 'fancyboxasset.php' => 8, | |
| 'readme_cn' => 8, | |
| '.jms.yml' => 8, | |
| 'config_lang2fonts.php' => 8, | |
| 'simple_html_dom.php' => 8, | |
| 'build.bat' => 8, | |
| 'deploy' => 8, | |
| 'lang2fonts.css' => 8, | |
| 'config_script2lang.php' => 8, | |
| 'uploadbehavior.php' => 8, | |
| 'adwords.php' => 8, | |
| 'process.php' => 8, | |
| 'script_behat.sh' => 8, | |
| 'kahlan-config.php' => 8, | |
| 'script_phpunit.sh' => 8, | |
| '.borisrc' => 8, | |
| 'gallerymanager.php' => 8, | |
| 'versions' => 8, | |
| 'styles.css' => 8, | |
| 'packagexmlsetup.php' => 8, | |
| 'doc' => 8, | |
| 'oauth1.php' => 8, | |
| 'index.tpl' => 8, | |
| 'gallerybehavior.php' => 8, | |
| 'htmlserviceprovider.php' => 8, | |
| 'collect.php' => 8, | |
| 'databaseserviceprovider.php' => 8, | |
| 'time.php' => 8, | |
| 'contribution' => 8, | |
| 'eventinterface.php' => 8, | |
| 'changelog-2.1' => 8, | |
| 'phpexcel.php' => 8, | |
| '.bower.json' => 8, | |
| 'indexmanager.php' => 8, | |
| 'php-cs-fixer' => 8, | |
| 'injector.php' => 8, | |
| 'stream.php' => 8, | |
| 'disqus.php' => 8, | |
| 'setup.py' => 8, | |
| 'howitworks' => 8, | |
| 'tests.bootstrap.php' => 8, | |
| 'info.xml' => 8, | |
| 'schema.xml' => 8, | |
| 'job.php' => 8, | |
| 'sortablegridview.php' => 8, | |
| 'report.php' => 8, | |
| '.px_execute.php' => 8, | |
| 'debug-test.php' => 8, | |
| 'driver.php' => 8, | |
| 'change.log' => 8, | |
| 'basecontroller.php' => 8, | |
| '.apigen.yml' => 8, | |
| 'start.sh' => 8, | |
| 'urlmanager.php' => 8, | |
| 'uploadaction.php' => 8, | |
| 'phpcs.sh' => 8, | |
| 'print.css' => 8, | |
| '.env-example' => 8, | |
| 'push-tests' => 8, | |
| 'driverinterface.php' => 8, | |
| 'tools.php' => 8, | |
| 'codestyle.xml' => 8, | |
| 'locale.php' => 8, | |
| 'dialog.php' => 8, | |
| 'format.php' => 8, | |
| 'n98-magerun.yaml' => 8, | |
| '.pharignore' => 8, | |
| '_bootstrap.php' => 8, | |
| '.php_cs.cache' => 8, | |
| 'layout.php' => 8, | |
| 'compile' => 8, | |
| 'features' => 8, | |
| '.eslintignore' => 8, | |
| 'urlgenerator.php' => 8, | |
| 'run-tests.bat' => 8, | |
| 'moduletrait.php' => 8, | |
| 'readme.en' => 8, | |
| 'manifest' => 8, | |
| 'angularasset.php' => 7, | |
| 'source.php' => 7, | |
| '.coverall.yml' => 7, | |
| 'gpl-3.0' => 7, | |
| 'gravatar.php' => 7, | |
| '._.ds_store' => 7, | |
| 'phinx.php' => 7, | |
| 'baseoauth.php' => 7, | |
| '.config.json' => 7, | |
| 'make.php' => 7, | |
| 'imperaviredactorasset.php' => 7, | |
| 'logo.jpg' => 7, | |
| 'kindeditor.php' => 7, | |
| 'permission.php' => 7, | |
| 'textdirectionimperaviredactorpluginasset.php' => 7, | |
| 'pdo.php' => 7, | |
| 'thanks' => 7, | |
| 'datatable.jpg' => 7, | |
| 'win.runtest.bat' => 7, | |
| 'fontfamilyimperaviredactorpluginasset.php' => 7, | |
| 'plugin.yml' => 7, | |
| 'fontcolorimperaviredactorpluginasset.php' => 7, | |
| 'timepicker.php' => 7, | |
| 'fontsizeimperaviredactorpluginasset.php' => 7, | |
| 'fullscreenimperaviredactorpluginasset.php' => 7, | |
| 'latlng.php' => 7, | |
| 'configuration' => 7, | |
| 'info.php' => 7, | |
| 'mapasset.php' => 7, | |
| 'jquery.min.js' => 7, | |
| 'modulesserviceprovider.php' => 7, | |
| 'readme.git' => 7, | |
| 'package2.xml' => 7, | |
| 'clipsimperaviredactorpluginasset.php' => 7, | |
| 'changelog-3.0' => 7, | |
| 'mit.license' => 7, | |
| 'bfw_modules_info.php' => 7, | |
| 'phpdoc.sh' => 7, | |
| 'media.php' => 7, | |
| 'orchestra.json' => 7, | |
| 'startup.php' => 7, | |
| 'env.php' => 7, | |
| 'script.php' => 7, | |
| 'rest.php' => 7, | |
| 'status' => 7, | |
| 'fullcalendar.php' => 7, | |
| 'editablecolumn.php' => 7, | |
| 'gentry.json' => 7, | |
| 'filters.php' => 7, | |
| 'pluginmanager.php' => 7, | |
| 'barcodes.php' => 7, | |
| '.phpunit.xml' => 7, | |
| 'readme-id' => 7, | |
| 'db.sql' => 7, | |
| 'publish.sh' => 7, | |
| 'travis.ini' => 7, | |
| 'phpdoc.ini.dist' => 7, | |
| 'config.w32' => 7, | |
| 'foundationasset.php' => 7, | |
| 'string.php' => 7, | |
| 'moduleasset.php' => 7, | |
| 'services.yml' => 7, | |
| 'type.php' => 7, | |
| 'socket.php' => 7, | |
| 'install.html' => 7, | |
| 'copyng' => 7, | |
| 'mime.php' => 7, | |
| 'changelog.html' => 7, | |
| 'security' => 7, | |
| 'install-frameworkmissing.html' => 7, | |
| 'generate.php' => 7, | |
| 'chart.php' => 7, | |
| 'make-junctions.sh' => 7, | |
| 'resources.php' => 7, | |
| 'jquery.js' => 7, | |
| 'treeview.php' => 7, | |
| 'routecollection.php' => 7, | |
| 'package.xml.tpl' => 7, | |
| 'comment.php' => 7, | |
| 'widgetasset.php' => 7, | |
| 'doctrine-mongo-mapping.xsd' => 7, | |
| 'phpunit.cnf.ini' => 7, | |
| 'license-gpl' => 7, | |
| 'signer.php' => 7, | |
| 'googlebundle.php' => 7, | |
| 'rtl.css' => 7, | |
| 'mapsmanager.php' => 7, | |
| 'neo4jphpversiontask.php' => 7, | |
| 'notifier.php' => 7, | |
| 'phpunit_mysql.xml' => 7, | |
| '.travis.yaml' => 7, | |
| 'recaptcha.php' => 7, | |
| 'datetime.php' => 7, | |
| 'pbj-schemas.php' => 7, | |
| 'cas.php' => 7, | |
| 'interface.php' => 7, | |
| 'phpunit.cmd' => 7, | |
| '.npmignore' => 7, | |
| 'example-google.php' => 7, | |
| 'php-cs-fixer.phar' => 7, | |
| 'phpinfo.php' => 7, | |
| '.env.travis' => 7, | |
| 'gruntfile.js' => 7, | |
| 'elfinder.php' => 7, | |
| 'readme_old' => 7, | |
| '.csslintrc' => 7, | |
| 'upgrade.html' => 7, | |
| 'storageinterface.php' => 7, | |
| 'slimscrollasset.php' => 7, | |
| 'apple-touch-icon.png' => 7, | |
| 'flash.php' => 7, | |
| 'highcharts.php' => 7, | |
| 'factoryinterface.php' => 7, | |
| 'person.php' => 7, | |
| 'crud.php' => 7, | |
| 'codesniffer.php' => 7, | |
| 'config.neon' => 7, | |
| 'sql.php' => 7, | |
| 'load_font.php' => 7, | |
| 'bump-version.sh' => 7, | |
| 'dompdf_config.custom.inc.php' => 7, | |
| 'exceptions.php' => 7, | |
| 'errors.php' => 7, | |
| '.bzrignore' => 7, | |
| 'testsuite' => 7, | |
| '.vimrc' => 7, | |
| 'logo.svg' => 7, | |
| 'phpcs.ruleset.xml' => 7, | |
| 'hybridresult.php' => 7, | |
| 'check.php' => 7, | |
| 'build.properties.dist' => 7, | |
| '.apishka.php' => 7, | |
| 'config.inc.php' => 7, | |
| 'config.test.php' => 7, | |
| 'soapclient.php' => 7, | |
| 'summary' => 7, | |
| 'example' => 7, | |
| 'taxonomy.php' => 7, | |
| 'release.php' => 7, | |
| 'hooks.php' => 7, | |
| 'yiic.bat' => 7, | |
| 'docker-compose.yml.dist' => 7, | |
| 'notorm.php' => 7, | |
| 'pdf.php' => 7, | |
| 's3.php' => 7, | |
| 'managerconfigurator.php' => 6, | |
| 'soapresponse.php' => 6, | |
| 'soaprequest.php' => 6, | |
| 'running_behat' => 6, | |
| 'tableimperaviredactorpluginasset.php' => 6, | |
| 'package.boot.php' => 6, | |
| 'activeformasset.php' => 6, | |
| 'filemanagerimperaviredactorpluginasset.php' => 6, | |
| '__init__.php' => 6, | |
| 'definedlinksimperaviredactorpluginasset.php' => 6, | |
| 'counterimperaviredactorpluginasset.php' => 6, | |
| 'resolver.php' => 6, | |
| 'note.development.nov.2011' => 6, | |
| 'messageconfig.php' => 6, | |
| 'run-tests.php' => 6, | |
| 'limiterimperaviredactorpluginasset.php' => 6, | |
| 'textexpanderimperaviredactorpluginasset.php' => 6, | |
| 'meta.php' => 6, | |
| 'upgrade-1.3' => 6, | |
| 'videoimperaviredactorpluginasset.php' => 6, | |
| 'db.xml' => 6, | |
| 'framework.php' => 6, | |
| 'upgrade-1.0' => 6, | |
| 'soapkernel.php' => 6, | |
| 'basemodel.php' => 6, | |
| 'fosuserevents.php' => 6, | |
| 'fosuserbundle.php' => 6, | |
| 'note.thenetcircle' => 6, | |
| 'imagemanagerimperaviredactorpluginasset.php' => 6, | |
| 'doctrine-mapping.xsd' => 6, | |
| 'armadillofile.yml' => 6, | |
| 'writer.php' => 6, | |
| 'changelog-0.1' => 6, | |
| 'plugin.json' => 6, | |
| 'patents' => 6, | |
| 'matcher.php' => 6, | |
| 'extension.json' => 6, | |
| 'selector.php' => 6, | |
| 'imagldapbundle.php' => 6, | |
| 'phpunit.sample.xml' => 6, | |
| 'buildtools' => 6, | |
| 'calendar.php' => 6, | |
| 'lexer.php' => 6, | |
| 'ueditoraction.php' => 6, | |
| 'plugins' => 6, | |
| 'wordpress.php' => 6, | |
| 'build.phpunit.xml' => 6, | |
| 'coverage.xml' => 6, | |
| 'phonenumber.php' => 6, | |
| 'treeviewasset.php' => 6, | |
| 'herbert.config.php' => 6, | |
| 'test_build' => 6, | |
| '.acid.yml.dist' => 6, | |
| 'linkpager.php' => 6, | |
| 'transport.php' => 6, | |
| 'admingeneratorgeneratorbundle.php' => 6, | |
| 'definition.php' => 6, | |
| 'behavior.php' => 6, | |
| 'run-all.sh' => 6, | |
| 'htmlawed.php' => 6, | |
| 'development' => 6, | |
| 'dist.sh' => 6, | |
| 'rules.xml' => 6, | |
| 'armadillo_standin.sh' => 6, | |
| 'upgrade-2.8' => 6, | |
| 'themeasset.php' => 6, | |
| 'mapper.php' => 6, | |
| 'endpoint.php' => 6, | |
| 'spec' => 6, | |
| 'unittests.xml' => 6, | |
| 'howto' => 6, | |
| 'ocular.phar' => 6, | |
| 'realestatemssqlbundle.php' => 6, | |
| 'build-dev.xml' => 6, | |
| 'autocomplete.php' => 6, | |
| 'sortable.php' => 6, | |
| 'routingserviceprovider.php' => 6, | |
| 'imagemanager.php' => 6, | |
| 'routerinterface.php' => 6, | |
| 'htmlfacade.php' => 6, | |
| 'formfacade.php' => 6, | |
| 'readme.mkdn' => 6, | |
| 'carousel.php' => 6, | |
| 'acl.php' => 6, | |
| '.noninteractive' => 6, | |
| 'formatconverter.php' => 6, | |
| 'access.php' => 6, | |
| '2dbarcodes.php' => 6, | |
| 'config.yaml' => 6, | |
| 'opengraph.php' => 6, | |
| 'buildphar.php' => 6, | |
| 'transaction.php' => 6, | |
| 'cachemanager.php' => 6, | |
| 'materializeasset.php' => 6, | |
| 'attachment.php' => 6, | |
| 'make-junctions.bat' => 6, | |
| 'params.json' => 6, | |
| 'htmlcolors.php' => 6, | |
| 'webuploaderasset.php' => 6, | |
| 'validate.php' => 6, | |
| 'twitteroauth.php' => 6, | |
| 'win.composer.update.bat' => 6, | |
| 'content-none.php' => 6, | |
| 'changes-2.1.0' => 6, | |
| 'simpletest.php' => 6, | |
| 'navigation.php' => 6, | |
| 'users.php' => 6, | |
| 'rule.php' => 6, | |
| 'tcpdf.fdf' => 6, | |
| 'render.php' => 6, | |
| 'dataprovider.php' => 6, | |
| 'unicode_data.php' => 6, | |
| 'datatablesasset.php' => 6, | |
| 'help.php' => 6, | |
| 'dompdf.php' => 6, | |
| 'dompdf_config.inc.php' => 6, | |
| '.eproject' => 6, | |
| 'timer.php' => 6, | |
| 'webuploader.php' => 6, | |
| 'readme.debian' => 6, | |
| 'inputfile.php' => 6, | |
| 'sayhello.php' => 6, | |
| 'rebuild.sh' => 6, | |
| 'arguments.php' => 6, | |
| 'runphpunit' => 6, | |
| 'runcomposer' => 6, | |
| 'up.sh' => 6, | |
| 'fancybox.php' => 6, | |
| 'kahlan-config.travis.php' => 6, | |
| 'review-1.4' => 6, | |
| 'travis.phpunit.xml.dist' => 6, | |
| 'pugxmultiuserbundle.php' => 6, | |
| 'notification.php' => 6, | |
| 'common.inc.php' => 6, | |
| 'mit-licence' => 6, | |
| 'nelmioapidocbundle.php' => 6, | |
| 'reader.php' => 6, | |
| 'datatypes.php' => 6, | |
| 'review-1.2' => 6, | |
| 'pbj-schema-stores.php' => 6, | |
| 'responseinterface.php' => 6, | |
| 'seeder.php' => 6, | |
| '.travis-config.ini' => 6, | |
| 'eventdispatcher.php' => 6, | |
| 'element.php' => 6, | |
| 'license-agpl.html' => 6, | |
| 'license-commercial-saas.html' => 6, | |
| 'license-commercial-website.html' => 6, | |
| 'license-commercial-websites.html' => 6, | |
| 'home.php' => 6, | |
| 'filenotfoundexception.php' => 6, | |
| 'run-tests-hhvm' => 6, | |
| 'link.php' => 6, | |
| 'bootstrapper.php' => 6, | |
| 'singleton.php' => 6, | |
| 'cli-config.php.dist' => 6, | |
| 'role.php' => 6, | |
| 'pbjc.yml' => 6, | |
| '.sami' => 6, | |
| 'uploadimagebehavior.php' => 6, | |
| 'tcpdf.crt' => 6, | |
| 'account.php' => 6, | |
| 'topsdk.php' => 6, | |
| 'parameter.php' => 6, | |
| 'upgrade_guide' => 6, | |
| 'teste.php' => 6, | |
| 'readme_spanish' => 6, | |
| 'expression.php' => 6, | |
| 'screenshot-inner.png' => 6, | |
| 'smarty_3.1_notes' => 6, | |
| 'php.ini.dist' => 6, | |
| 'boris' => 6, | |
| 'config.dist.php' => 6, | |
| 'jmsjobqueuebundle.php' => 6, | |
| 'phpunit-coverage-html.xml' => 6, | |
| 'smarty_3.0_bc_notes' => 6, | |
| 'httpexception.php' => 6, | |
| 'parameters.php' => 6, | |
| 'config_cp.php' => 6, | |
| 'filesystemmap.php' => 6, | |
| '.phpmd.xml' => 6, | |
| 'readme.zh' => 6, | |
| 'smarty_2_bc_notes' => 6, | |
| 'repositoryinterface.php' => 6, | |
| 'simplehtmldom.php' => 6, | |
| 'extrasetup.php' => 6, | |
| 'np' => 6, | |
| 'myconfig.ini' => 6, | |
| 'php-semver-checker-git.yml.dist' => 6, | |
| 'vagrantfile.dist' => 6, | |
| '_ss_environment.php' => 6, | |
| 'mousewheelasset.php' => 6, | |
| 'codefile.php' => 6, | |
| 'editable.php' => 6, | |
| 'markdowneditor.php' => 6, | |
| 'demo.gif' => 6, | |
| 'detailview.php' => 6, | |
| 'aliases.php' => 6, | |
| 'twig.php' => 6, | |
| 'entry.php' => 5, | |
| 'pre-commit' => 5, | |
| 'validatorinterface.php' => 5, | |
| 'croncontroller.php' => 5, | |
| 'annotation.php' => 5, | |
| 'scrut.json' => 5, | |
| 'example3.php' => 5, | |
| 'paymentfactory.php' => 5, | |
| 'phpbench.json.dist' => 5, | |
| 'index.xsl' => 5, | |
| 'fastclickasset.php' => 5, | |
| 'relation.php' => 5, | |
| 'pipeline.php' => 5, | |
| 'sessioninterface.php' => 5, | |
| 'parserinterface.php' => 5, | |
| 'readme.adoc' => 5, | |
| 'creditos' => 5, | |
| 'modernizrasset.php' => 5, | |
| 'changelog-3.1' => 5, | |
| 'copying-mit' => 5, | |
| 'collectioninterface.php' => 5, | |
| 'upgrade_to_1_1' => 5, | |
| 'headers.php' => 5, | |
| 'iconbar.php' => 5, | |
| 'phpunit-integration.xml' => 5, | |
| 'stofdoctrineextensionsbundle.php' => 5, | |
| 'codeclimate.yml' => 5, | |
| 'sass-compiler.php' => 5, | |
| 'exemple.php' => 5, | |
| '.bldr.yml' => 5, | |
| 'userpath.php' => 5, | |
| 'documentation.html' => 5, | |
| 'release-notes.html' => 5, | |
| 'lena512color.jpg' => 5, | |
| 'detection.dat' => 5, | |
| 'facedetector.php' => 5, | |
| 'upgrade-1.5' => 5, | |
| 'fileinput.php' => 5, | |
| 'pathcontroller.php' => 5, | |
| 'ftp.php' => 5, | |
| 'api.json' => 5, | |
| 'test.bat' => 5, | |
| 'authorize.php' => 5, | |
| 'changelog-1.2' => 5, | |
| 'encrypter.php' => 5, | |
| 'gallerymanagerasset.php' => 5, | |
| 'problematicaclmanagerbundle.php' => 5, | |
| 'value.php' => 5, | |
| 'localpath.php' => 5, | |
| 'reporter.php' => 5, | |
| '.composer.json.swp' => 5, | |
| 'readme.fr' => 5, | |
| 'documentacao_moip-php.pdf' => 5, | |
| 'sdk.class.php' => 5, | |
| 'queryinterface.php' => 5, | |
| 'autorun.php' => 5, | |
| 'review-1.1' => 5, | |
| 'config.js' => 5, | |
| 'phpbench.json' => 5, | |
| 'assetscallback.php' => 5, | |
| 'language.php' => 5, | |
| 'license.lesser' => 5, | |
| 'xmlmimefilter.php' => 5, | |
| 'wssecurityfilter.php' => 5, | |
| 'number.php' => 5, | |
| 'basepath.php' => 5, | |
| 'ftppath.php' => 5, | |
| 'mimefilter.php' => 5, | |
| 'summernote.php' => 5, | |
| 'cheatsheet' => 5, | |
| 'package.yml' => 5, | |
| 'zipper.sh' => 5, | |
| 'cookies.php' => 5, | |
| 'handler.template.php' => 5, | |
| 'stringhelper.php' => 5, | |
| 'encoder.php' => 5, | |
| 'testsuite.php' => 5, | |
| 'pluploadasset.php' => 5, | |
| 'icon.jpg' => 5, | |
| 'pluploadaction.php' => 5, | |
| 'plupload.php' => 5, | |
| 'chunkuploader.php' => 5, | |
| 'phpunit-travis.xml' => 5, | |
| 'timezone.php' => 5, | |
| 'version.json' => 5, | |
| 'phpword.ini.dist' => 5, | |
| 'todos' => 5, | |
| 'datamatrix.php' => 5, | |
| 'readme.dist' => 5, | |
| 'makefile.am' => 5, | |
| 'cli-tests.php' => 5, | |
| 'channel.php' => 5, | |
| 'point.php' => 5, | |
| 'pdf417.php' => 5, | |
| 'changelog.php' => 5, | |
| 'sample_push.php' => 5, | |
| '.pre-commit' => 5, | |
| 'cropperasset.php' => 5, | |
| 'vendors.win.php' => 5, | |
| 'sample_push_custom.php' => 5, | |
| 'sample_push_many.php' => 5, | |
| 'sample_server.php' => 5, | |
| 'send.php' => 5, | |
| 'medoo.php' => 5, | |
| 'install-composer.sh' => 5, | |
| 'iotcpdfbundle.php' => 5, | |
| 'leiame' => 5, | |
| 'amazon-config.default.php' => 5, | |
| 'slender.yml' => 5, | |
| 'scientist.png' => 5, | |
| '.gitkeep' => 5, | |
| 'typeahead.php' => 5, | |
| 'global.php' => 5, | |
| 'structure.sql' => 5, | |
| 'sql.sql' => 5, | |
| 'run-travis' => 5, | |
| 'spinner.php' => 5, | |
| 'shtumiusefulbundle.php' => 5, | |
| 'spbowerbundle.php' => 5, | |
| 'managerinterface.php' => 5, | |
| 'datagridevents.php' => 5, | |
| '.gitattribute' => 5, | |
| 'phpunit_config.xml' => 5, | |
| 'version-check.json' => 5, | |
| 'theme.json' => 5, | |
| 'docs.sh' => 5, | |
| 'grid.php' => 5, | |
| '.hedron.yml' => 5, | |
| 'sample_feedback.php' => 5, | |
| 'build-phar' => 5, | |
| 'configurationinterface.php' => 5, | |
| 'fullcalendarasset.php' => 5, | |
| 'foscommentbundle.php' => 5, | |
| 'book.json' => 5, | |
| 'match.php' => 5, | |
| 'travis.sh' => 5, | |
| 'progressbar.php' => 5, | |
| 'select2bootstrapasset.php' => 5, | |
| 'box.php' => 5, | |
| 'select.php' => 5, | |
| 'defaults.php' => 5, | |
| 'order.php' => 5, | |
| 'phpunit.no_autoload.xml' => 5, | |
| 'searchform.php' => 5, | |
| 'sphinxapi.php' => 5, | |
| 'resque.php' => 5, | |
| 'csv.php' => 5, | |
| 'shell.php' => 5, | |
| 'license.pdf' => 5, | |
| 'cover.png' => 5, | |
| '.atoum.treemap.php' => 5, | |
| 'phpunit.mysql.xml' => 5, | |
| 'metronic.php' => 5, | |
| '.phpdoc.xml' => 5, | |
| 'counter.php' => 5, | |
| 'excel.php' => 5, | |
| 'bugs' => 5, | |
| 'gallerymanageraction.php' => 5, | |
| 'liesmich' => 5, | |
| 'geolocation.php' => 5, | |
| 'config_fonts-distr-without-otl.php' => 5, | |
| 'license_yaml' => 5, | |
| 'themes.php' => 5, | |
| 'protocol.php' => 5, | |
| 'doctrinebundle.php' => 5, | |
| 'service' => 5, | |
| 'news.php' => 5, | |
| 'article.php' => 5, | |
| 'printasset.php' => 5, | |
| 'fileinterface.php' => 5, | |
| 'hh_autoload.json' => 5, | |
| 'fpdi_bridge.php' => 5, | |
| 'aggregateserviceprovider.php' => 5, | |
| 'cs-fixer' => 5, | |
| 'player.php' => 5, | |
| 'sortablegridaction.php' => 5, | |
| 'eventmanager.php' => 5, | |
| '_changelog' => 5, | |
| 'basehtml.php' => 5, | |
| 'sortablegridasset.php' => 5, | |
| '.htaccess.dist' => 5, | |
| 'eventsubscriberinterface.php' => 5, | |
| 'js.php' => 5, | |
| 'download.php' => 5, | |
| 'classmap.php' => 5, | |
| 'zip.php' => 5, | |
| 'redisqueue.php' => 5, | |
| 'mod_form.php' => 5, | |
| 'phpunit.xml.travisci' => 5, | |
| '.dunitconfig-nightly' => 5, | |
| 'fr.php' => 5, | |
| 'ca-bundle.crt' => 5, | |
| 'change-log' => 5, | |
| 'locallib.php' => 5, | |
| 'reference.php' => 5, | |
| 'fpdf.php' => 5, | |
| 'jmsi18nroutingbundle.php' => 5, | |
| 'fpdf.css' => 5, | |
| 'ipn.php' => 5, | |
| 'encoding.php' => 5, | |
| 'gump.class.php' => 5, | |
| 'expressionlanguage.php' => 5, | |
| 'htmlawed_readme.htm' => 5, | |
| 'arrayhelper.php' => 5, | |
| 'htmlawed_readme' => 5, | |
| 'activedataprovider.php' => 5, | |
| 'preloader.php' => 5, | |
| 'inittestsuite.php' => 5, | |
| 'stats.php' => 5, | |
| 'testclass.tt' => 5, | |
| 'bootboxasset.php' => 5, | |
| 'sonatamediabundle.php' => 5, | |
| 'cron.sh' => 5, | |
| 'class.pop3.php' => 5, | |
| 'index.php.sample' => 5, | |
| 'sitemap.xml' => 5, | |
| 'mage' => 5, | |
| 'class.phpmailer.php' => 5, | |
| 'phpunit.xml.example' => 5, | |
| 'bootstrap.js' => 5, | |
| 'sessionmanager.php' => 5, | |
| 'sortablegridbehavior.php' => 5, | |
| 'infinitescrollasset.php' => 5, | |
| 'fosjsroutingbundle.php' => 5, | |
| 'garbagecollect.php' => 5, | |
| 'generate.sh' => 5, | |
| 'generate_api' => 5, | |
| 'tutorial' => 5, | |
| '.mime' => 5, | |
| 'jsonresponse.php' => 5, | |
| 'sessionserviceprovider.php' => 5, | |
| 'update-gh-pages.sh' => 5, | |
| 'class.smtp.php' => 5, | |
| 'autoload.dist.php' => 5, | |
| 'remote.php' => 5, | |
| 'modelmanager.php' => 5, | |
| 'viewtopic.php' => 5, | |
| 'lgpl' => 5, | |
| 'htmlawedtest.php' => 5, | |
| 'htmlawed_testcase' => 5, | |
| 'buttondropdown.php' => 5, | |
| 'enum.php' => 5, | |
| 'fontawesome.php' => 5, | |
| 'license-apache' => 5, | |
| 'routing.php' => 5, | |
| 'profiler.php' => 5, | |
| 'messages.php' => 5, | |
| 'cart.php' => 5, | |
| 'screen.png' => 5, | |
| 'yuicompressor.jar' => 5, | |
| 'makerelease.sh' => 5, | |
| 'animateasset.php' => 5, | |
| 'packager' => 5, | |
| 'screen-shot.png' => 5, | |
| 'kindeditorwidget.php' => 5, | |
| 'fluent.php' => 5, | |
| 'runmessage' => 5, | |
| 'license.textile' => 5, | |
| 'collapse.php' => 5, | |
| 'phpunit.functional.xml.dist' => 5, | |
| 'applicationinterface.php' => 5, | |
| 'phpspec-html.yml' => 5, | |
| 'phpspec-clover.yml' => 5, | |
| 'packager.php' => 5, | |
| 'thankyou' => 5, | |
| 'contributions' => 5, | |
| 'galleryimage.php' => 5, | |
| 'datatables.php' => 5, | |
| 'venne-phing.xml' => 5, | |
| 'codecept' => 5, | |
| 'show.php' => 5, | |
| 'system.php' => 5, | |
| 'assetsjqueryadapter.php' => 5, | |
| 'recorder.php' => 5, | |
| 'upgrade-1.2' => 5, | |
| 'fileupload.php' => 5, | |
| 'upgrade-1.4' => 5, | |
| 'httpclient.php' => 5, | |
| '.doxygen' => 5, | |
| 'minion' => 5, | |
| 'eventdispatcherinterface.php' => 5, | |
| 'package_compatible.xml' => 5, | |
| 'menus.php' => 5, | |
| 'dump.sql' => 5, | |
| 'formatterinterface.php' => 5, | |
| 'favicon.png' => 5, | |
| 'shoppingcart.php' => 5, | |
| 'default-disable' => 5, | |
| 'phpunit.xml.hhvm' => 5, | |
| 'datetimebehavior.php' => 5, | |
| 'clover.xml' => 5, | |
| 'paypal.php' => 5, | |
| 'migratecontroller.php' => 5, | |
| 'namespaceditemresolver.php' => 5, | |
| 'httpclientinterface.php' => 5, | |
| 'translationserviceprovider.php' => 5, | |
| 'coverage' => 5, | |
| '.env-sample' => 5, | |
| 'autoloader.class.php' => 5, | |
| 'gatewayinterface.php' => 5, | |
| 'sliderasset.php' => 5, | |
| 'timeline.php' => 5, | |
| 'dynamicmodel.php' => 5, | |
| 'porting_info' => 5, | |
| 'validationexception.php' => 5, | |
| 'install.bat' => 5, | |
| '_register_database.php' => 5, | |
| 'menuasset.php' => 5, | |
| 'branches' => 5, | |
| 'sync.php' => 5, | |
| 'emailinterface.php' => 5, | |
| 'password.php' => 5, | |
| 'silverstripe_version' => 5, | |
| 'commit.bat' => 5, | |
| 'sandbox.php' => 5, | |
| 'imagebehavior.php' => 5, | |
| 'migrationserviceprovider.php' => 5, | |
| 'sweetalertasset.php' => 5, | |
| 'allincl.php' => 5, | |
| 'nestedsetbehavior.php' => 4, | |
| 'phpcodesniffer.xml' => 4, | |
| 'phpdoc.ini' => 4, | |
| 'jstree.php' => 4, | |
| 'phpunit-integration-legacy.xml' => 4, | |
| 'grammar.php' => 4, | |
| 'bitly.php' => 4, | |
| 'alertasset.php' => 4, | |
| 'proxy.php' => 4, | |
| 'accordion.php' => 4, | |
| 'permissions.php' => 4, | |
| 'configinterface.php' => 4, | |
| 'codeofconduct' => 4, | |
| 'ref.js' => 4, | |
| 'usermanagementmodule.php' => 4, | |
| 'pull_request_template' => 4, | |
| 'i.sh' => 4, | |
| 'statement.php' => 4, | |
| 'chatasset.php' => 4, | |
| 'changelog.htm' => 4, | |
| 'faq.htm' => 4, | |
| 'db.class.php' => 4, | |
| '.phpunit' => 4, | |
| 'ref.php' => 4, | |
| 'listener.php' => 4, | |
| 'templateengine.php' => 4, | |
| 'ref.css' => 4, | |
| 'schema.sql' => 4, | |
| 'configexception.php' => 4, | |
| 'dispatch.php' => 4, | |
| 'menubuilder.php' => 4, | |
| 'bootstrap.inc.php' => 4, | |
| 'parameters.yml.dist' => 4, | |
| 'front-page.php' => 4, | |
| 'hello.php' => 4, | |
| 'indexer.php' => 4, | |
| 'fosfacebookbundle.php' => 4, | |
| 'searchbundle.php' => 4, | |
| 'tsmarty2c.php' => 4, | |
| 'mediawiki-extension.json' => 4, | |
| 'demo' => 4, | |
| 'compatibility-test.php' => 4, | |
| 'phpairbrakebundle.php' => 4, | |
| 'class.krumo.php' => 4, | |
| 'library.php' => 4, | |
| 'ivorygooglemapbundle.php' => 4, | |
| 'pear.php' => 4, | |
| 'obfuscator.php' => 4, | |
| 'containerawarejob.php' => 4, | |
| 'idiorm.php' => 4, | |
| '.dir-locals.el' => 4, | |
| 'readme.sublime-workspace' => 4, | |
| 'routerexception.php' => 4, | |
| 'money.php' => 4, | |
| 'mailchimp.php' => 4, | |
| 'codesniffer.conf' => 4, | |
| 'php.php' => 4, | |
| 'output.png' => 4, | |
| 'solr.php' => 4, | |
| 'fpdf_tpl.php' => 4, | |
| 'config-example.php' => 4, | |
| 'jwt.php' => 4, | |
| 'serializerinterface.php' => 4, | |
| 'pdostatement.php' => 4, | |
| 'data' => 4, | |
| 'phpdocumentor.phar' => 4, | |
| 'converter.php' => 4, | |
| 'dev' => 4, | |
| 'style.php' => 4, | |
| 'svggraphmultilinegraph.php' => 4, | |
| 'svggraphmultiradargraph.php' => 4, | |
| 'viewforum.php' => 4, | |
| 'viewerrorbag.php' => 4, | |
| 'instance.php' => 4, | |
| 'pluralizer.php' => 4, | |
| 'svggraphmultiscattergraph.php' => 4, | |
| 'svggraphmultigraph.php' => 4, | |
| 'svggraphpattern.php' => 4, | |
| 'svggraphpie3dgraph.php' => 4, | |
| 'title.php' => 4, | |
| 'svggraphpiegraph.php' => 4, | |
| 'gettext.php' => 4, | |
| 'svggraphpointgraph.php' => 4, | |
| 'dbmanager.php' => 4, | |
| 'example4.php' => 4, | |
| 'locallang_db.xml' => 4, | |
| 'thumbaction.php' => 4, | |
| 'svggraphhorizontalbargraph.php' => 4, | |
| 'redis.php' => 4, | |
| 'phpspec.no-coverage.yml' => 4, | |
| 'svggraphhorizontalfloatingbargraph.php' => 4, | |
| 'video.php' => 4, | |
| 'filebehavior.php' => 4, | |
| 'tips' => 4, | |
| 'svggraphlinegraph.php' => 4, | |
| 'build-phar.php' => 4, | |
| 'svggraphhorizontalgroupedbargraph.php' => 4, | |
| 'run-test.sh' => 4, | |
| 'svggraphhorizontalstackedbargraph.php' => 4, | |
| 'svggraphjavascript.php' => 4, | |
| 'routeinterface.php' => 4, | |
| 'svggraphpolarareagraph.php' => 4, | |
| 'svggraphpopulationpyramid.php' => 4, | |
| 'svggraphgroupedcylindergraph.php' => 4, | |
| 'address.php' => 4, | |
| 'svggraph.ini' => 4, | |
| 'uploadedfile.php' => 4, | |
| 'mailserviceprovider.php' => 4, | |
| 'presenter.php' => 4, | |
| 'controllerinterface.php' => 4, | |
| 'dispatcherinterface.php' => 4, | |
| 'etspaymentogonebundle.php' => 4, | |
| 'paginationserviceprovider.php' => 4, | |
| 'packagecreator.php' => 4, | |
| 'containerinterface.php' => 4, | |
| 'codesniffer.conf.dist' => 4, | |
| 'apiexception.php' => 4, | |
| 'requestinterface.php' => 4, | |
| 'datetimecomparevalidator.php' => 4, | |
| 'svggraphstructureddata.php' => 4, | |
| '.nitpick.json' => 4, | |
| 'renderer.php' => 4, | |
| 'workbenchserviceprovider.php' => 4, | |
| 'svggraphradargraph.php' => 4, | |
| 'travis.xml' => 4, | |
| 'svggraphscattergraph.php' => 4, | |
| 'liqpay.php' => 4, | |
| 'edit_form.php' => 4, | |
| 'post.php' => 4, | |
| 'htmlform.php' => 4, | |
| 'svggraphstackedlinegraph.php' => 4, | |
| 'svggraphstackedbar3dgraph.php' => 4, | |
| 'messagebag.php' => 4, | |
| 'svggraphstackedbargraph.php' => 4, | |
| 'svggraphstackedcylindergraph.php' => 4, | |
| 'ext_tables_static+adt.sql' => 4, | |
| 'htmlstring.php' => 4, | |
| 'regioncode.php' => 4, | |
| 'currencies.json' => 4, | |
| 'mailparser.php' => 4, | |
| 'nexmoaccount.php' => 4, | |
| 'phpdoc.xml-dist' => 4, | |
| '.build.props' => 4, | |
| 'phings' => 4, | |
| 'nexmoreceipt.php' => 4, | |
| 'nexmomessage.php' => 4, | |
| 'settingsaction.php' => 4, | |
| 'foselasticabundle.php' => 4, | |
| 'delete.php' => 4, | |
| 'properties.php' => 4, | |
| 'utilities.php' => 4, | |
| 'manual.html' => 4, | |
| 'travis-config.ini' => 4, | |
| 'module.ini' => 4, | |
| 'deployment.properties' => 4, | |
| 'doc.sh' => 4, | |
| 'doc.php' => 4, | |
| 'redirector.php' => 4, | |
| 'treeasset.php' => 4, | |
| 'config.php-development' => 4, | |
| 'guid.php' => 4, | |
| 'readme.dcy' => 4, | |
| 'codecept.bat' => 4, | |
| 'jobinterface.php' => 4, | |
| 'mysql.sql' => 4, | |
| 'timeago.php' => 4, | |
| 'product.php' => 4, | |
| 'liscense' => 4, | |
| 'kcfinderasset.php' => 4, | |
| 'default.php' => 4, | |
| 'changelog.mkd' => 4, | |
| 'testlistener.php' => 4, | |
| 'test-config.yml.dist' => 4, | |
| 'abstractcontroller.php' => 4, | |
| 'config.php.example' => 4, | |
| 'phonenumberutil.php' => 4, | |
| 'svggraphdata.php' => 4, | |
| 'dialogasset.php' => 4, | |
| 'notify.php' => 4, | |
| 'svggraphbargraph.php' => 4, | |
| 'svggraphboxandwhiskergraph.php' => 4, | |
| 'svggraphbubblegraph.php' => 4, | |
| 'svggraphcylindergraph.php' => 4, | |
| 'svggraphdonutgraph.php' => 4, | |
| 'svggraphaxislog.php' => 4, | |
| 'merchant.php' => 4, | |
| 'svggraphexplodedpiegraph.php' => 4, | |
| 'svggraphfloatingbargraph.php' => 4, | |
| 'svggraphgridgraph.php' => 4, | |
| 'svggraphgroupedbar3dgraph.php' => 4, | |
| 'svggraphgroupedbargraph.php' => 4, | |
| 'svggraphbar3dgraph.php' => 4, | |
| 'svggraphaxisfixeddoubleended.php' => 4, | |
| 'invoker.php' => 4, | |
| 'countrycodetoregioncodemap.php' => 4, | |
| 'services.php' => 4, | |
| 'ewzrecaptchabundle.php' => 4, | |
| 'filterinterface.php' => 4, | |
| 'schemamanager.php' => 4, | |
| 'platform.php' => 4, | |
| 'growl.php' => 4, | |
| 'svggraph.php' => 4, | |
| 'svggraphaxisfixed.php' => 4, | |
| 'svggraph3dgraph.php' => 4, | |
| 'svggraphaxis.php' => 4, | |
| '_license' => 4, | |
| 'numberparseexception.php' => 4, | |
| 'transformer.php' => 4, | |
| 'phonemetadata.php' => 4, | |
| 'svggraphaxisdoubleended.php' => 4, | |
| '.php_cs-fixers.php' => 4, | |
| 'google.php' => 4, | |
| 'webtestcase.php' => 4, | |
| 'columnschema.php' => 4, | |
| 'readme.rdoc' => 4, | |
| 'build.vagrant.properties' => 4, | |
| 'server_status.php' => 4, | |
| 'licenses' => 4, | |
| 'server_sql.php' => 4, | |
| '.drone.sec' => 4, | |
| 'server_replication.php' => 4, | |
| 'server_privileges.php' => 4, | |
| 'server_plugins.php' => 4, | |
| 'filtermanager.php' => 4, | |
| 'server_import.php' => 4, | |
| 'server_export.php' => 4, | |
| 'server_status_monitor.php' => 4, | |
| 'server_engines.php' => 4, | |
| '.description.php' => 4, | |
| 'watchr.rb' => 4, | |
| 'server_databases.php' => 4, | |
| 'lint.php' => 4, | |
| 'server_collations.php' => 4, | |
| 'server_binlog.php' => 4, | |
| 'phpunit.teamcity.mssql.xml' => 4, | |
| 's3path.php' => 4, | |
| 'loggerinterface.php' => 4, | |
| 'schema_export.php' => 4, | |
| 'server_status_advisor.php' => 4, | |
| 'server_status_processes.php' => 4, | |
| 'prefs_forms.php' => 4, | |
| 'settings.ini' => 4, | |
| 'sanitizer.php' => 4, | |
| 'htmlcompressor.php' => 4, | |
| 'tbl_replace.php' => 4, | |
| 'tbl_relation.php' => 4, | |
| 'experimental' => 4, | |
| 'tbl_recent_favorite.php' => 4, | |
| 'phppackage.png' => 4, | |
| 'oil' => 4, | |
| 'tbl_operations.php' => 4, | |
| 'tbl_indexes.php' => 4, | |
| 'tbl_import.php' => 4, | |
| 'tbl_gis_visualization.php' => 4, | |
| 'server_status_queries.php' => 4, | |
| 'tbl_get_field.php' => 4, | |
| 'tbl_find_replace.php' => 4, | |
| 'tbl_export.php' => 4, | |
| 'tbl_create.php' => 4, | |
| 'tbl_chart.php' => 4, | |
| 'tbl_change.php' => 4, | |
| 'tbl_addfield.php' => 4, | |
| 'show_config_errors.php' => 4, | |
| 'server_variables.php' => 4, | |
| 'server_user_groups.php' => 4, | |
| 'server_status_variables.php' => 4, | |
| 'prefs_manage.php' => 4, | |
| 'develop' => 4, | |
| 'tbl_select.php' => 4, | |
| 'phpunit-dist.xml' => 4, | |
| 'db_events.php' => 4, | |
| 'db_designer.php' => 4, | |
| 'db_datadict.php' => 4, | |
| 'db_central_columns.php' => 4, | |
| 'contributor_license_agreement.html' => 4, | |
| 'config-sample.inc.php' => 4, | |
| 'config.sample.inc.php' => 4, | |
| 'math.php' => 4, | |
| 'chk_rel.php' => 4, | |
| 'posting.php' => 4, | |
| 'composite.php' => 4, | |
| 'soapclientbuilder.php' => 4, | |
| 'db_import.php' => 4, | |
| 'wsaddressingfilter.php' => 4, | |
| 'wsdldownloader.php' => 4, | |
| 'adapterinterface.php' => 4, | |
| 'processmanager.php' => 4, | |
| 'phpunit-html-coverage.xml' => 4, | |
| 'cubex' => 4, | |
| 'package.jpg' => 4, | |
| 'summernoteasset.php' => 4, | |
| 'contributors.html' => 4, | |
| 'set.php' => 4, | |
| 'contact.php' => 4, | |
| 'db_export.php' => 4, | |
| 'db_operations.php' => 4, | |
| '.travis_install_dependencies.sh' => 4, | |
| 'gis_data_editor.php' => 4, | |
| 'phpguard.yml.dist' => 4, | |
| 'buttonwidget.php' => 4, | |
| 'license.bsd' => 4, | |
| 'lexikmailerbundle.php' => 4, | |
| 'layout.html' => 4, | |
| 'phpunit.coverage.xml.dist' => 4, | |
| 'phpmyadmin.css.php' => 4, | |
| 'normalization.php' => 4, | |
| 'markup.php' => 4, | |
| 'license.php' => 4, | |
| 'import_status.php' => 4, | |
| 'file_echo.php' => 4, | |
| 'copying3' => 4, | |
| 'error_report.php' => 4, | |
| 'db_triggers.php' => 4, | |
| 'applicationfactory.php' => 4, | |
| 'db_tracking.php' => 4, | |
| 'compiler.jar' => 4, | |
| 'db_structure.php' => 4, | |
| 'db_sql_format.php' => 4, | |
| 'db_sql_autocomplete.php' => 4, | |
| 'db_sql.php' => 4, | |
| 'db_search.php' => 4, | |
| 'db_routines.php' => 4, | |
| 'tbl_row_action.php' => 4, | |
| 'tbl_sql.php' => 4, | |
| 'turbosms.php' => 4, | |
| 'bootstrapthemeasset.php' => 4, | |
| 'boxfile.install' => 4, | |
| 'bootstrap.css' => 4, | |
| 'grammar.pp' => 4, | |
| 'phpmailerautoload.php' => 4, | |
| 'alipay.php' => 4, | |
| 'ccdnusersecuritybundle.php' => 4, | |
| 'public.php' => 4, | |
| 'status.php' => 4, | |
| 'profile.php' => 4, | |
| 'formgenerator.php' => 4, | |
| '.travis_publish_doc.sh' => 4, | |
| 'bootstrappluginasset.php' => 4, | |
| 'example-wrapper.php' => 4, | |
| 'licanse' => 4, | |
| 'laravel' => 4, | |
| 'rb.php' => 4, | |
| 'column.php' => 4, | |
| 'checkboxcolumn.php' => 4, | |
| 'momentjsasset.php' => 4, | |
| 'twigextension.php' => 4, | |
| 'assetmanager.php' => 4, | |
| 'smarty.php' => 4, | |
| '.php-cs-fixer.php' => 4, | |
| 'uploadifyasset.php' => 4, | |
| 'random.php' => 4, | |
| 'example-form.php' => 4, | |
| 'card.php' => 4, | |
| 'watch.sh' => 4, | |
| 'php_parser.php' => 4, | |
| 'gallery.php' => 4, | |
| 'bench.php' => 4, | |
| 'infinitescrollpager.php' => 4, | |
| 'announce' => 4, | |
| 'structure.php' => 4, | |
| 'parameterbag.php' => 4, | |
| 'browse.php' => 4, | |
| 'slug.php' => 4, | |
| 'middlewareinterface.php' => 4, | |
| 'middleware.php' => 4, | |
| 'apigen' => 4, | |
| 'example-cloudfront.php' => 4, | |
| 'writeme' => 4, | |
| '.preflight' => 4, | |
| 'materializepluginasset.php' => 4, | |
| 'datatablesbootstrapasset.php' => 4, | |
| 'debugpanel.php' => 4, | |
| 'ide_helper.php' => 4, | |
| 'buttonfixedaction.php' => 4, | |
| '.cfignore' => 4, | |
| 'splfileinfo.php' => 4, | |
| 'bootstrapswitchasset.php' => 4, | |
| 'travisci-phpunit.xml' => 4, | |
| 'fastimage.php' => 4, | |
| 'easyimage.php' => 4, | |
| 'tbl_structure.php' => 4, | |
| 'arrayutils.php' => 4, | |
| 'containerawaretrait.php' => 4, | |
| 'alias.php' => 4, | |
| 'phpserver.php' => 4, | |
| 'directive.php' => 4, | |
| '.snippets' => 4, | |
| 'maskmoneyasset.php' => 4, | |
| 'directory.php' => 4, | |
| 'yii2-setting-preview.png' => 4, | |
| 'webapp.php' => 4, | |
| 'view_operations.php' => 4, | |
| 'view_create.php' => 4, | |
| 'version_check.php' => 4, | |
| 'dal.php' => 4, | |
| 'schedule.php' => 4, | |
| 'user_password.php' => 4, | |
| 'cropasset.php' => 4, | |
| 'transformation_wrapper.php' => 4, | |
| 'transformation_overview.php' => 4, | |
| 'tbl_zoom_select.php' => 4, | |
| 'phpdoc.yml' => 4, | |
| 'deprecated' => 4, | |
| 'tbl_triggers.php' => 4, | |
| 'readme.creole' => 4, | |
| 'tbl_tracking.php' => 4, | |
| 'documentinterface.php' => 4, | |
| 'plivo.php' => 4, | |
| 'utilsbundle.php' => 4, | |
| 'config.ru' => 4, | |
| 'languageasset.php' => 4, | |
| 'thumbs.db' => 4, | |
| 'lessc.inc.php' => 4, | |
| 'apiclient.php' => 4, | |
| '.user.ini' => 4, | |
| 'sensiogeneratorbundle.php' => 4, | |
| 'catalog.php' => 4, | |
| 'serialcolumn.php' => 4, | |
| 'spreadsheetreader.php' => 4, | |
| 'captchaaction.php' => 4, | |
| 'spreadsheetreader_csv.php' => 4, | |
| 'acf.php' => 4, | |
| 'teste' => 4, | |
| 'spreadsheetreader_ods.php' => 4, | |
| 'dev.php' => 4, | |
| 'spreadsheetreader_xls.php' => 4, | |
| 'spreadsheetreader_xlsx.php' => 4, | |
| 'option.php' => 4, | |
| 'extractor.php' => 4, | |
| 'orm.php' => 4, | |
| 'datamapper.php' => 4, | |
| 'phpmig.php' => 4, | |
| 'block.php' => 4, | |
| 'property.php' => 4, | |
| 'specificationinterface.php' => 4, | |
| 'db_qbe.php' => 4, | |
| 'hipmandrillbundle.php' => 4, | |
| 'encodings_maps.php' => 4, | |
| 'config.inc.php.dist' => 4, | |
| 'dist.php' => 4, | |
| 'oauthrequest.php' => 4, | |
| 'cropper.php' => 4, | |
| 'oauthexception.php' => 4, | |
| 'oauthdatastore.php' => 4, | |
| 'togglecolumn.php' => 4, | |
| 'gridviewasset.php' => 4, | |
| 'oauthsignaturemethod.php' => 4, | |
| 'unitstype.php' => 4, | |
| 'size.php' => 4, | |
| 'pluginabstract.php' => 4, | |
| 'overlaytrait.php' => 4, | |
| 'optionstrait.php' => 4, | |
| 'objectabstract.php' => 4, | |
| 'maptypeid.php' => 4, | |
| 'oauthserver.php' => 4, | |
| 'oauthutil.php' => 4, | |
| 'latlngbounds.php' => 4, | |
| 'env.example' => 4, | |
| 'checker.php' => 4, | |
| 'icingaexchange.yml' => 4, | |
| 'uikitasset.php' => 4, | |
| 'example.htaccess' => 4, | |
| 'migrations.json' => 4, | |
| 'accounts.json' => 4, | |
| 'highchartsasset.php' => 4, | |
| 'visualpaginator.php' => 4, | |
| 'migrate.php' => 4, | |
| 'example.css' => 4, | |
| 'formserviceprovider.php' => 4, | |
| 'connector.php' => 4, | |
| 'protoc-gen-php.php' => 4, | |
| 'protoc-gen-php.bat' => 4, | |
| 'gofile' => 4, | |
| 'release-0.1.0' => 4, | |
| 'braincraftedbootstrapbundle.php' => 4, | |
| 'latlngliteral.php' => 4, | |
| 'eventtype.php' => 4, | |
| 'output.php' => 4, | |
| 'config.template.php' => 4, | |
| 'build.linux.properties' => 4, | |
| 'build.mac.properties' => 4, | |
| 'oxygen' => 4, | |
| 'processorinterface.php' => 4, | |
| '.codeclimate' => 4, | |
| 'changes 5.7.3' => 4, | |
| 'txt.license' => 4, | |
| 'txt.version' => 4, | |
| 'scheduler.php' => 4, | |
| 'app' => 4, | |
| 'configure.php' => 4, | |
| 'maintainers' => 4, | |
| 'botdetector.php' => 4, | |
| 'a' => 4, | |
| 'ext-all.js' => 4, | |
| 'locallang.xml' => 4, | |
| 'filemanager.php' => 4, | |
| 'user.sql' => 4, | |
| 'clientabstract.php' => 4, | |
| 'sonatadoctrinemongodbadminbundle.php' => 4, | |
| 'srgb.icc' => 4, | |
| 'relationbehavior.php' => 4, | |
| 'spotcolors.php' => 4, | |
| 'tcpdf.p12' => 4, | |
| 'tcpdf_filters.php' => 4, | |
| 'browse_foreigners.php' => 4, | |
| '.travis' => 4, | |
| 'sami_configuration.php' => 4, | |
| 'local-config-sample.php' => 4, | |
| 'buildapi.sh' => 4, | |
| 'bootstrap-vagrant.sh' => 4, | |
| 'readme_exportafacil' => 4, | |
| 'embed.php' => 4, | |
| 'meta.yml' => 4, | |
| 'upgrade-1.9' => 4, | |
| 'consoleserviceprovider.php' => 4, | |
| 'avalancheimaginebundle.php' => 4, | |
| 'display.php' => 4, | |
| 'oauthconsumer.php' => 4, | |
| 'dropzone.php' => 4, | |
| 'database.png' => 4, | |
| 'topbarsection.php' => 4, | |
| 'grammar.y' => 4, | |
| 'topbar.php' => 4, | |
| 'modules.php' => 4, | |
| 'readme-en' => 4, | |
| 'dropzoneasset.php' => 4, | |
| 'navigationwidget.php' => 4, | |
| 'breadcrumb.php' => 4, | |
| 'class.php' => 4, | |
| 'sessionhandler.php' => 4, | |
| 'unitofwork.php' => 4, | |
| 'foundationiconasset.php' => 4, | |
| 'function.php' => 4, | |
| 'behat.yml-dist' => 4, | |
| 'webserver.php' => 4, | |
| 'formmetadata.php' => 4, | |
| 'generate-docs.sh' => 4, | |
| 'baseimage.php' => 4, | |
| 'classes.png' => 4, | |
| 'recaptchavalidator.php' => 4, | |
| 'config.json.dist' => 4, | |
| 'dropdownbutton.php' => 4, | |
| 'formmapper.php' => 4, | |
| 'lessify.inc.php' => 3, | |
| '.scrutinzer.yml' => 3, | |
| 'detached.php' => 3, | |
| 'httpresource.php' => 3, | |
| 'web_tester.php' => 3, | |
| 'upgrade-3.2' => 3, | |
| 'plessc' => 3, | |
| 'help_my_tests_dont_work_anymore' => 3, | |
| 'target.php' => 3, | |
| 'run-test-hhvm' => 3, | |
| 'default_reporter.php' => 3, | |
| 'apple-touch-icon-114x114-precomposed.png' => 3, | |
| 'releases' => 3, | |
| 'upgrade-3.1' => 3, | |
| 'taskinterface.php' => 3, | |
| 'encryptor.php' => 3, | |
| 'scss.php' => 3, | |
| 'nginx_app.conf' => 3, | |
| 'makefile.pl' => 3, | |
| 'xmlparser.php' => 3, | |
| 'readme-dev' => 3, | |
| 'touchspin.php' => 3, | |
| 'travisconfig.ini' => 3, | |
| 'phpspec.yml.hhvm' => 3, | |
| 'yiidebugviewrenderer.php' => 3, | |
| 'phpunit.watcher.json' => 3, | |
| 'basestorage.php' => 3, | |
| 'changelog-4.0' => 3, | |
| 'nelmiosecuritybundle.php' => 3, | |
| 'storeinterface.php' => 3, | |
| 'netterobots' => 3, | |
| 'aliasloader.php' => 3, | |
| 'objectresolver.php' => 3, | |
| 'lessify' => 3, | |
| 'welcome.php' => 3, | |
| 'file-header.phps' => 3, | |
| 'publish' => 3, | |
| 'sypexgeo.php' => 3, | |
| 'macaw.php' => 3, | |
| 'code-coverage.xml' => 3, | |
| '.travis.before-install' => 3, | |
| 'passwordinterface.php' => 3, | |
| 'authenticator.php' => 3, | |
| 'expectation.php' => 3, | |
| 'eclipse.php' => 3, | |
| 'knpzendcachebundle.php' => 3, | |
| 'connectoraction.php' => 3, | |
| 'partner.php' => 3, | |
| 'userevents.php' => 3, | |
| 'update.bat' => 3, | |
| 'debugaction.php' => 3, | |
| 'conventions' => 3, | |
| 'hearsayrequirejsbundle.php' => 3, | |
| 'install.mysql' => 3, | |
| 'install.pgsql' => 3, | |
| 'geo.php' => 3, | |
| 'install.sqlite' => 3, | |
| 'auth-schema-mysql.sql' => 3, | |
| 'auth-schema-postgresql.sql' => 3, | |
| 'summernotelanguageasset.php' => 3, | |
| 'collector.php' => 3, | |
| 'ccdnforumforumbundle.php' => 3, | |
| 'dbug.php' => 3, | |
| 'phpcs_ruleset.xml' => 3, | |
| 'apple-touch-icon-precomposed.png' => 3, | |
| 'demo.sql' => 3, | |
| 'doctrine_annotations.php' => 3, | |
| 'whiteoctobertcpdfbundle.php' => 3, | |
| 'license_osl' => 3, | |
| 'front.php' => 3, | |
| 'gallerycontroller.php' => 3, | |
| 'tmp' => 3, | |
| 'nestedsortableasset.php' => 3, | |
| 'nestedsortable.php' => 3, | |
| 'envoy.blade.php' => 3, | |
| 'environaut.xml' => 3, | |
| 'apple-touch-icon-72x72-precomposed.png' => 3, | |
| 'private.php' => 3, | |
| 'operator.php' => 3, | |
| 'syliusorderevents.php' => 3, | |
| 'ecommerce.php' => 3, | |
| 'groovey' => 3, | |
| 'sxgeo.php' => 3, | |
| 'gen.php' => 3, | |
| '_lgpl' => 3, | |
| 'apple-touch-icon-144x144-precomposed.png' => 3, | |
| 'knpgaufrettebundle.php' => 3, | |
| 'npm-debug.log' => 3, | |
| 'notice.php' => 3, | |
| 'lisezmoi' => 3, | |
| 'app.json.dist' => 3, | |
| 'comparatorinterface.php' => 3, | |
| '.git-push-everywhere' => 3, | |
| 'dropdownx.php' => 3, | |
| 'lecense' => 3, | |
| 'datetimeattribute.php' => 3, | |
| 'navx.php' => 3, | |
| 'sortablelistview.php' => 3, | |
| 'phpdoctor.ini' => 3, | |
| 'phpunit-lts.phar' => 3, | |
| 'treeviewinput.php' => 3, | |
| 'apple-touch-icon-57x57-precomposed.png' => 3, | |
| 'serviceregistry.php' => 3, | |
| 'screenshot-1.jpg' => 3, | |
| 'entitymanager.php' => 3, | |
| '.travis-php.ini' => 3, | |
| 'readme_rus' => 3, | |
| 'pdepend.xml.dist' => 3, | |
| 'filehandlerinterface.php' => 3, | |
| 'poll.php' => 3, | |
| 'yiidebugtoolbar.php' => 3, | |
| 'htaccess.example' => 3, | |
| 'license_tr' => 3, | |
| 'sismo.config.php.dist' => 3, | |
| 'unit_tester.php' => 3, | |
| 'validationserviceprovider.php' => 3, | |
| 'tpl.php' => 3, | |
| 'thelia' => 3, | |
| 'yiidebugcontroller.php' => 3, | |
| 'luascriptbuilder.php' => 3, | |
| 'cmsbundle.php' => 3, | |
| 'yiidebugtoolbarpanel.php' => 3, | |
| 'datetimecomparevalidationasset.php' => 3, | |
| 'symfony' => 3, | |
| 'stamp.yml' => 3, | |
| 'yiidebugcomponentproxy.php' => 3, | |
| 'googlemaps.php' => 3, | |
| 'svggraphstackedgroupedbargraph.php' => 3, | |
| 'before_script.sh' => 3, | |
| 'yiidebug.php' => 3, | |
| 'yiidebugtoolbarroute.php' => 3, | |
| 'symfony license' => 3, | |
| 'structure' => 3, | |
| 'trace.php' => 3, | |
| '.phpunit.bootstrap.php' => 3, | |
| 'phpcodesniffer' => 3, | |
| 'doxygen_input_filter.php' => 3, | |
| 'ajaxbutton.php' => 3, | |
| 'infobox.php' => 3, | |
| 'funk.yml.dist' => 3, | |
| 'annotations' => 3, | |
| 'facebook.php' => 3, | |
| 'uikitalmostflatasset.php' => 3, | |
| 'simple.php' => 3, | |
| 'uikitgradientasset.php' => 3, | |
| 'git.php' => 3, | |
| 'uikitpluginasset.php' => 3, | |
| 'oauth2serverbundle.php' => 3, | |
| 'apccache.php' => 3, | |
| 'ole.php' => 3, | |
| 'serve' => 3, | |
| 'require.php' => 3, | |
| 'fileinputasset.php' => 3, | |
| 'config.php.template' => 3, | |
| 'exemplo.php' => 3, | |
| 'licencse' => 3, | |
| 'test.css' => 3, | |
| 'compile-apache.php' => 3, | |
| 'xhprof.php' => 3, | |
| 'minify.php' => 3, | |
| 'template.latte' => 3, | |
| 'twitterapiexchange.php' => 3, | |
| 'changelog.textile' => 3, | |
| 'screenshot1.png' => 3, | |
| 'module.conf.local.yaml' => 3, | |
| 'leeme' => 3, | |
| 'selectable.php' => 3, | |
| 'routes' => 3, | |
| 'extensionbuilder.json' => 3, | |
| 'frames.php' => 3, | |
| 'r.php' => 3, | |
| 'githubmarkdown.php' => 3, | |
| 'pear.sh' => 3, | |
| 'http-console.php' => 3, | |
| 'sessionstorage.php' => 3, | |
| 'creds-dist.php' => 3, | |
| 'history.php' => 3, | |
| '.zfproject.xml' => 3, | |
| 'spyc.php' => 3, | |
| 'exceptionhandler.php' => 3, | |
| 'dashboard.json' => 3, | |
| 'yiidebugviewhelper.php' => 3, | |
| 'youtube.php' => 3, | |
| 'filesystemserviceprovider.php' => 3, | |
| 'cookiejar.php' => 3, | |
| 'jmsserializerbundle.php' => 3, | |
| 'blog.php' => 3, | |
| 'phpqrcode.php' => 3, | |
| 'slidermodule.php' => 3, | |
| 'menumodule.php' => 3, | |
| 'pheanstalk_init.php' => 3, | |
| 'spyc.yaml' => 3, | |
| 'conf.php' => 3, | |
| 'queuemanager.php' => 3, | |
| 'tidy_parser.php' => 3, | |
| 'scss.inc.php' => 3, | |
| 'typeinterface.php' => 3, | |
| '.atoum.php.dist' => 3, | |
| '.gitmessage' => 3, | |
| 'sqsqueue.php' => 3, | |
| 'changelog-2.x' => 3, | |
| 'test_case.php' => 3, | |
| 'shell_tester.php' => 3, | |
| '.styleci' => 3, | |
| 'todo.xml' => 3, | |
| 'scorer.php' => 3, | |
| 'istorage.php' => 3, | |
| 'calendar.png' => 3, | |
| 'swiftmailerbundle.php' => 3, | |
| 'toast.php' => 3, | |
| '.test.php' => 3, | |
| 'filemaker.php' => 3, | |
| 'abstracttype.php' => 3, | |
| 'changelog-1.x' => 3, | |
| 'reflection_php5.php' => 3, | |
| 'mock_objects.php' => 3, | |
| 'fmsteamcondenserbundle.php' => 3, | |
| 'pakefile' => 3, | |
| 'monitor.php' => 3, | |
| 'treeviewinputasset.php' => 3, | |
| 'puppetfile' => 3, | |
| 'authmanager.php' => 3, | |
| 'whois.gtld.fastdomain.php' => 3, | |
| 'whois.gtld.corporatedomains.php' => 3, | |
| 'whois.gtld.directnic.php' => 3, | |
| 'whois.gtld.domaindiscover.php' => 3, | |
| 'whois.gtld.domainpeople.php' => 3, | |
| 'whois.gtld.dotster.php' => 3, | |
| 'whois.gtld.dreamhost.php' => 3, | |
| 'whois.gtld.enom.php' => 3, | |
| 'whois.gtld.fabulous.php' => 3, | |
| 'whois.gtld.gandi.php' => 3, | |
| 'whois.gtld.ascio.php' => 3, | |
| 'whois.gtld.genericb.php' => 3, | |
| 'whois.gtld.godaddy.php' => 3, | |
| 'avocodeformextensionsbundle.php' => 3, | |
| 'whois.gtld.iana.php' => 3, | |
| 'whois.gtld.interdomain.php' => 3, | |
| 'whois.gtld.itsyourdomain.php' => 3, | |
| 'run' => 3, | |
| 'whois.gtld.joker.php' => 3, | |
| 'whois.gtld.assorted.php' => 3, | |
| 'whois.gtld.alldomains.php' => 3, | |
| 'whois.gtld.melbourneit.php' => 3, | |
| 'whois.de.php' => 3, | |
| 'whois.client.php' => 3, | |
| 'whois.cn.php' => 3, | |
| 'whois.co.php' => 3, | |
| 'geocoder.php' => 3, | |
| 'whois.co.za.php' => 3, | |
| 'whois.coop.php' => 3, | |
| 'jobworkload.php' => 3, | |
| 'whois.cz.php' => 3, | |
| 'whois.edu.php' => 3, | |
| 'whois.gtld.afternic.php' => 3, | |
| 'jobbase.php' => 3, | |
| 'whois.eu.php' => 3, | |
| 'whois.fi.php' => 3, | |
| 'gearmancontroller.php' => 3, | |
| 'whois.fj.php' => 3, | |
| 'gearmancomponent.php' => 3, | |
| 'bootstrap.min.css' => 3, | |
| 'whois.fr.php' => 3, | |
| 'composer_install_github_key.sh' => 3, | |
| 'whois.gtld.markmonitor.php' => 3, | |
| 'whois.gtld.moniker.php' => 3, | |
| 'phpunit-integration-legacy-solr.xml' => 3, | |
| 'whois.ie.php' => 3, | |
| 'whois.gtld.schlund.php' => 3, | |
| 'whois.gtld.srsplus.php' => 3, | |
| 'whois.gtld.tmagnic.php' => 3, | |
| 'whois.gtld.tvcorp.php' => 3, | |
| 'whois.gtld.wildwestdomains.php' => 3, | |
| 'whois.hu.php' => 3, | |
| 'whois.icon.png' => 3, | |
| 'whois.idna.php' => 3, | |
| 'whois.il.php' => 3, | |
| 'whois.gtld.register.php' => 3, | |
| 'whois.in.php' => 3, | |
| 'whois.info.php' => 3, | |
| 'whois.int.php' => 3, | |
| 'whois.ip.afrinic.php' => 3, | |
| 'whois.ip.apnic.php' => 3, | |
| 'whois.ip.arin.php' => 3, | |
| 'whois.ip.krnic.php' => 3, | |
| 'whois.ip.lacnic.php' => 3, | |
| 'whois.gtld.rrpproxy.php' => 3, | |
| 'whois.gtld.publicdomainregistry.php' => 3, | |
| 'whois.gtld.name.php' => 3, | |
| 'whois.gtld.nicco.php' => 3, | |
| 'whois.gtld.nameintel.php' => 3, | |
| 'whois.gtld.namejuice.php' => 3, | |
| 'apcclassloader.php' => 3, | |
| 'classcollectionloader.php' => 3, | |
| 'whois.gtld.nameking.php' => 3, | |
| 'whois.gtld.names4ever.php' => 3, | |
| 'whois.gtld.namevault.php' => 3, | |
| 'whois.gtld.networksolutions.php' => 3, | |
| 'whois.gtld.nicline.php' => 3, | |
| 'whois.gtld.psiusa.php' => 3, | |
| 'classmapgenerator.php' => 3, | |
| 'debugclassloader.php' => 3, | |
| 'starrating.php' => 3, | |
| 'mapclassloader.php' => 3, | |
| 'growlasset.php' => 3, | |
| 'whois.gtld.onlinenic.php' => 3, | |
| 'whois.gtld.opensrs.php' => 3, | |
| 'whois.gtld.ovh.php' => 3, | |
| 'whois.gtld.php' => 3, | |
| 'whois.cl.php' => 3, | |
| 'whois.ch.php' => 3, | |
| 'scrollup.php' => 3, | |
| 'boleto_banestes.php' => 3, | |
| 'boleto_cef_sigcb.php' => 3, | |
| 'boleto_cef.php' => 3, | |
| 'boleto_bradesco.php' => 3, | |
| 'boleto_besc.php' => 3, | |
| 'scdatetimepickerbundle.php' => 3, | |
| 'regex.php' => 3, | |
| 'notificationevents.php' => 3, | |
| 'boleto_bb.php' => 3, | |
| 'boleto_banespa.php' => 3, | |
| 'boleto_hsbc.php' => 3, | |
| 'boleto_bancoob.php' => 3, | |
| 'boleto cef - contra apresentacao.zip' => 3, | |
| 'functions' => 3, | |
| 'ftpexception.php' => 3, | |
| 'rresque.php' => 3, | |
| 'smarty.class.php' => 3, | |
| 'entitytrait.php' => 3, | |
| 'qrbitstream.php' => 3, | |
| 'boleto_cef_sinco.php' => 3, | |
| 'run_test.sh' => 3, | |
| 'qrconst.php' => 3, | |
| 'tsmarty2c.1' => 3, | |
| 'awssdk.php' => 3, | |
| 'dynamicindex.php' => 3, | |
| 'changelog-3.2' => 3, | |
| 'tables.sql' => 3, | |
| 'bootstraptrait.php' => 3, | |
| 'boleto_unibanco.php' => 3, | |
| 'block.t.php' => 3, | |
| 'function.locale.php' => 3, | |
| 'boleto_sudameris.php' => 3, | |
| 'boleto_itau.php' => 3, | |
| 'boleto_sofisa.php' => 3, | |
| 'readme2' => 3, | |
| 'boleto_sicredi.php' => 3, | |
| 'controllerlistener.php' => 3, | |
| 'boleto_santander_banespa.php' => 3, | |
| 'boleto_real.php' => 3, | |
| 'travis-php-config.ini' => 3, | |
| 'package-container.yml' => 3, | |
| 'boleto_nossacaixa.php' => 3, | |
| 'qrconfig.php' => 3, | |
| 'qrencode.php' => 3, | |
| 'whois.cat.php' => 3, | |
| 'whois.at.php' => 3, | |
| 'whois.ae.php' => 3, | |
| 'sqldatabase.php' => 3, | |
| 'whois.aero.php' => 3, | |
| 'sqlstatement.php' => 3, | |
| 'whois.ag.php' => 3, | |
| 'module_creation' => 3, | |
| 'whois.am.php' => 3, | |
| 'whois.asia.php' => 3, | |
| 'whois.au.php' => 3, | |
| 'example.cli.php' => 3, | |
| 'whois.be.php' => 3, | |
| 'whois.bh.php' => 3, | |
| 'endpoint-cors.php' => 3, | |
| 'install_archive' => 3, | |
| 'whois.biz.php' => 3, | |
| 'timepickerasset.php' => 3, | |
| 'puppet.php' => 3, | |
| 'whois.br.php' => 3, | |
| 'whois.ca.php' => 3, | |
| 'npdata.ser' => 3, | |
| 'release_process' => 3, | |
| 'qrimage.php' => 3, | |
| 'stash.php' => 3, | |
| 'qrinput.php' => 3, | |
| 'qrlib.php' => 3, | |
| 'roles.php' => 3, | |
| 'qrmask.php' => 3, | |
| '_manifest_exclude' => 3, | |
| 'ext_typoscript_constants' => 3, | |
| 'settings.yml' => 3, | |
| 'queueinterface.php' => 3, | |
| 'mobiledetect.php' => 3, | |
| 'handlers' => 3, | |
| 'qrrscode.php' => 3, | |
| 'qrspec.php' => 3, | |
| 'assertion.php' => 3, | |
| 'qrsplit.php' => 3, | |
| 'qrtools.php' => 3, | |
| 'soap.php' => 3, | |
| 'qrvect.php' => 3, | |
| 'ci_instance.php' => 3, | |
| 'adminmanager.php' => 3, | |
| 'whois.ip.lib.php' => 3, | |
| 'whois.ip.php' => 3, | |
| 'concepts' => 3, | |
| 'bootstrap-for-theme.php' => 3, | |
| 'simpleimage.php' => 3, | |
| 'migrate' => 3, | |
| 'header.jpg' => 3, | |
| 'fab.png' => 3, | |
| 'blank.html' => 3, | |
| 'fancyboxhelpersasset.php' => 3, | |
| 'yiit.php' => 3, | |
| 'baserepository.php' => 3, | |
| '.svnignore' => 3, | |
| 'find.php' => 3, | |
| 'signature.php' => 3, | |
| 'readme_zh_cn' => 3, | |
| 'ckeditorwidgetasset.php' => 3, | |
| 'fosoauthserverbundle.php' => 3, | |
| 'ckeditortrait.php' => 3, | |
| 'modelbehavior.php' => 3, | |
| 'bolt' => 3, | |
| 'fssolrbundle.php' => 3, | |
| 'elements.html' => 3, | |
| 'validationasset.php' => 3, | |
| 'apigen.sh' => 3, | |
| 'dbtestcase.php' => 3, | |
| 'loggablebehavior.php' => 3, | |
| 'sso.php' => 3, | |
| 'memcachesasl.php' => 3, | |
| 'jstreeasset.php' => 3, | |
| 'not-gettexted.php' => 3, | |
| 'head.php' => 3, | |
| 'logtarget.php' => 3, | |
| 'debugasset.php' => 3, | |
| 'hackunit.php' => 3, | |
| 'es.php' => 3, | |
| 'imagecolor.php' => 3, | |
| 'notifyjsasset.php' => 3, | |
| 'pot-ext-meta.php' => 3, | |
| 'animatecssasset.php' => 3, | |
| 'highcharts.src.js' => 3, | |
| 'highcharts.js' => 3, | |
| 'highcharts-more.src.js' => 3, | |
| 'highcharts-more.js' => 3, | |
| 'nav.tpl' => 3, | |
| 'uploadify.php' => 3, | |
| 'fullcalendarwidget.php' => 3, | |
| 'notrixmailerloopbundle.php' => 3, | |
| 'datatablestabletoolsasset.php' => 3, | |
| 'trends.php' => 3, | |
| 'write.php' => 3, | |
| 'watcher.php' => 3, | |
| 'readwrite.php' => 3, | |
| 'datetimehelper.php' => 3, | |
| 'indexaction.php' => 3, | |
| 'spam.php' => 3, | |
| 'backup.php' => 3, | |
| 'folder.php' => 3, | |
| 'build.js' => 3, | |
| 'read.php' => 3, | |
| 'generic.php' => 3, | |
| 'bucket.php' => 3, | |
| 'insert.php' => 3, | |
| 'ticket.php' => 3, | |
| 'serve.php' => 3, | |
| 'tile.png' => 3, | |
| 'phpunit.xml.sample' => 3, | |
| 'herzultforumbundle.php' => 3, | |
| 'phpunit_sqlite.xml' => 3, | |
| 404 => 3, | |
| 'variable.php' => 3, | |
| 'htmlhelper.php' => 3, | |
| 'docker-entrypoint.sh' => 3, | |
| 'run_phpcs.sh' => 3, | |
| 'composer-install.sh' => 3, | |
| '.gitsplit.yml' => 3, | |
| 'raindroproutingbundle.php' => 3, | |
| 'phrozn.png' => 3, | |
| 'scheme.php' => 3, | |
| 'instagramwidget.php' => 3, | |
| 'notyasset.php' => 3, | |
| 'languages.php' => 3, | |
| 'composer.dev.json' => 3, | |
| 'dir.php' => 3, | |
| 'textcat.php' => 3, | |
| 'docker-compose.yml.sample' => 3, | |
| 'vk.php' => 3, | |
| 'mime.types' => 3, | |
| 'install_phalcon.sh' => 3, | |
| 'debug.tpl' => 3, | |
| 'phpunit-integration.xml.dist' => 3, | |
| 'makepot.php' => 3, | |
| 'sort.php' => 3, | |
| 'whois.ip.ripe.php' => 3, | |
| 'whois.servers.php' => 3, | |
| 'whois.pro.php' => 3, | |
| 'whois.pt.php' => 3, | |
| 'whois.re.php' => 3, | |
| 'whois.ro.php' => 3, | |
| 'whois.ru.php' => 3, | |
| 'whois.rwhois.php' => 3, | |
| 'whois.sc.php' => 3, | |
| 'whois.se.php' => 3, | |
| 'whois.si.php' => 3, | |
| 'whois.pl.php' => 3, | |
| 'whois.su.php' => 3, | |
| 'whois.tel.php' => 3, | |
| 'whois.travel.php' => 3, | |
| 'whois.uk.php' => 3, | |
| 'whois.us.php' => 3, | |
| 'whois.utils.php' => 3, | |
| 'whois.ve.php' => 3, | |
| 'whois.wf.php' => 3, | |
| 'whois.pm.php' => 3, | |
| 'whois.parser.php' => 3, | |
| 'whois.xxx.php' => 3, | |
| 'whois.main.php' => 3, | |
| 'scrollupasset.php' => 3, | |
| 'whois.ir.php' => 3, | |
| 'whois.is.php' => 3, | |
| 'whois.it.php' => 3, | |
| 'whois.jp.php' => 3, | |
| 'whois.lt.php' => 3, | |
| 'whois.lu.php' => 3, | |
| 'whois.ly.php' => 3, | |
| 'whois.me.php' => 3, | |
| 'whois.org.za.php' => 3, | |
| 'whois.mobi.php' => 3, | |
| 'whois.museum.php' => 3, | |
| 'whois.mx.php' => 3, | |
| 'whois.name.php' => 3, | |
| 'whois.nl.php' => 3, | |
| 'whois.nu.php' => 3, | |
| 'whois.nz.php' => 3, | |
| 'whois.org.php' => 3, | |
| 'imdb.class.php' => 3, | |
| 'whois.ws.php' => 3, | |
| 'maskmoney.php' => 3, | |
| 'redactormodule.php' => 3, | |
| 'macros.twig' => 3, | |
| 'pdf_parser.php' => 3, | |
| 'sandbox' => 3, | |
| 'themedefaultasset.php' => 3, | |
| 'colorbox.php' => 3, | |
| 'themeclassicasset.php' => 3, | |
| 'themebootstrapasset.php' => 3, | |
| 'emongoclient.php' => 3, | |
| 'emongocriteria.php' => 3, | |
| 'emongodataprovider.php' => 3, | |
| 'fpdi_pdf_parser.php' => 3, | |
| 'emongodocument.php' => 3, | |
| 'emongoexception.php' => 3, | |
| 'emongofile.php' => 3, | |
| 'emongologroute.php' => 3, | |
| 'metatags.php' => 3, | |
| 'emongomodel.php' => 3, | |
| 'emongosort.php' => 3, | |
| 'codeigniter' => 3, | |
| 'stats' => 3, | |
| 'pdf_context.php' => 3, | |
| 'fpdi.php' => 3, | |
| 'whois.yt.php' => 3, | |
| 'bowerassets.php' => 3, | |
| 'whois.zanet.php' => 3, | |
| 'markdowneditorasset.php' => 3, | |
| 'coverage.php' => 3, | |
| 'team' => 3, | |
| 'foqelasticabundle.php' => 3, | |
| 'phar-manifest.php' => 3, | |
| 'juiasset.php' => 3, | |
| 'arraycollection.php' => 3, | |
| 'domain.php' => 3, | |
| 'scope.php' => 3, | |
| 'phpunit.xml.nocoverage' => 3, | |
| 'unit_tests.php' => 3, | |
| 'forms.php' => 3, | |
| 'loader.gif' => 3, | |
| '.ethna' => 3, | |
| 'test.sql' => 3, | |
| 'notfoundexception.php' => 3, | |
| 'wishlist.php' => 3, | |
| 'restclient.php' => 3, | |
| 'css.php' => 3, | |
| 'whois.fm.php' => 3, | |
| 'jcropasset.php' => 3, | |
| 'connectionresolverinterface.php' => 3, | |
| 'desktop.ini' => 3, | |
| 'masonryasset.php' => 3, | |
| 'cssmin.php' => 3, | |
| 'compare.php' => 3, | |
| 'exampleconfig.xml' => 3, | |
| 'connectionresolver.php' => 3, | |
| 'databasemanager.php' => 3, | |
| 'datepickerlanguageasset.php' => 3, | |
| 'go.php' => 3, | |
| 'phpunit.integration.xml' => 3, | |
| 'mysqlconnection.php' => 3, | |
| 'postgresconnection.php' => 3, | |
| 'queryexception.php' => 3, | |
| 'sqliteconnection.php' => 3, | |
| 'appasset.php' => 3, | |
| 'strings.php' => 3, | |
| 'sqlserverconnection.php' => 3, | |
| 'build-phar.sh' => 3, | |
| 'test_nbbc.php' => 3, | |
| 'jsonview.php' => 3, | |
| 'deployment.sample.ini' => 3, | |
| 'upgrade 2.2' => 3, | |
| 'upgrade 2.1' => 3, | |
| 'dbconnectioninterface.php' => 3, | |
| 'dbquery.php' => 3, | |
| 'magnificpopupasset.php' => 3, | |
| 'genemuformbundle.php' => 3, | |
| 'oldsoundrabbitmqbundle.php' => 3, | |
| 'dbqueryinterface.php' => 3, | |
| 'changelog 2.2' => 3, | |
| 'changelog 2.1' => 3, | |
| 'sonatablockbundle.php' => 3, | |
| 'curler.php' => 3, | |
| 'seedserviceprovider.php' => 3, | |
| 'sharedhostinstall' => 3, | |
| 'powered_by_nbbc_small.png' => 3, | |
| 'sample_distributed.php' => 3, | |
| 'sample_asn-v6.php' => 3, | |
| 'gameq.php' => 3, | |
| 'row.php' => 3, | |
| 'sample_city-v6.php' => 3, | |
| 'sample_city.php' => 3, | |
| 'class.xsl' => 3, | |
| '.php.ini' => 3, | |
| 'sample-v6.php' => 3, | |
| 'importbundle.php' => 3, | |
| 'routes.yml' => 3, | |
| 'gearmanbundle.php' => 3, | |
| 'multi.php' => 3, | |
| 'sample_netspeed.php' => 3, | |
| 'index.html.twig' => 3, | |
| 'sidebar.xsl' => 3, | |
| 'geoipregionvars.php' => 3, | |
| 'aliyunoss.php' => 3, | |
| 'koowa-component.xml' => 3, | |
| 'introjsasset.php' => 3, | |
| 'ohinstagrambundle.php' => 3, | |
| 'mellatbank.php' => 3, | |
| 'module.js' => 3, | |
| 'config.ini.dist' => 3, | |
| 'config-dist.php' => 3, | |
| 'apydatagridbundle.php' => 3, | |
| 'geoipcity.inc' => 3, | |
| 'lexiktranslationbundle.php' => 3, | |
| 'project.php' => 3, | |
| 'datatable.php' => 3, | |
| 'bcrypt.php' => 3, | |
| 'whiteoctoberswiftmailerdbbundle.php' => 3, | |
| 'license-gpl3' => 3, | |
| 'geoip.inc' => 3, | |
| 'resourceevents.php' => 3, | |
| 'powered_by_nbbc.png' => 3, | |
| 'sample_org.php' => 3, | |
| 'codemirror.php' => 3, | |
| 'serviceproviderinterface.php' => 3, | |
| 'resultaction.php' => 3, | |
| 'sonatadoctrineormadminbundle.php' => 3, | |
| 'entityexception.php' => 3, | |
| 'eventmanagertrait.php' => 3, | |
| 'successaction.php' => 3, | |
| 'phpunit-coverage.xml.dist' => 3, | |
| 'failaction.php' => 3, | |
| 'odnoklassniki.php' => 3, | |
| 'apache-license-2.0' => 3, | |
| 'init.deployment.php' => 3, | |
| 'besimplessoauthbundle.php' => 3, | |
| 'promise.php' => 3, | |
| 'sample.db' => 3, | |
| 'ivorylucenesearchbundle.php' => 3, | |
| 'example.jpg' => 3, | |
| 'servicemanager.php' => 3, | |
| 'bundle-skel' => 3, | |
| 'nestedsetquery.php' => 3, | |
| 'toastrasset.php' => 3, | |
| 'create.bat' => 3, | |
| 'spark' => 3, | |
| 'select2action.php' => 3, | |
| 'playbook.yml' => 3, | |
| 'jsonld.php' => 3, | |
| 'delegate.php' => 3, | |
| 'notifierinterface.php' => 3, | |
| 'ip.php' => 3, | |
| 'install_vendors.sh' => 3, | |
| 'robo' => 3, | |
| 'annotations.php' => 3, | |
| 'baseaction.php' => 3, | |
| 'cacheexception.php' => 3, | |
| 'io.php' => 3, | |
| 'elfinderconnectoraction.php' => 3, | |
| 'mpdfexception.php' => 3, | |
| 'nestedset.php' => 3, | |
| 'pnotify.php' => 3, | |
| 'dotenv.php' => 3, | |
| 'phpdoc' => 3, | |
| 'sami-config.inc.php' => 3, | |
| 'mediainterface.php' => 3, | |
| 'subnav.php' => 3, | |
| 'help.sh' => 3, | |
| '.readme.md.swp' => 3, | |
| 'how' => 3, | |
| 'padam87attributebundle.php' => 3, | |
| 'seo.php' => 3, | |
| 'ipgeobase.php' => 3, | |
| 'wheel' => 3, | |
| 'sgdatatablesbundle.php' => 3, | |
| 'cite.bib' => 3, | |
| 'crontab.php' => 3, | |
| 'tinymcecompressoraction.php' => 3, | |
| 'phpunitbootstrap.php' => 3, | |
| 'maintenancemode.php' => 3, | |
| 'meetup.php' => 3, | |
| 'cleantalk.class.php' => 3, | |
| 'paceasset.php' => 3, | |
| '.env.sample' => 3, | |
| 'widgetinterface.php' => 3, | |
| 'duallistbox.php' => 3, | |
| 'binary.php' => 3, | |
| 'cartactionevent.php' => 3, | |
| 'cartpositioninterface.php' => 3, | |
| 'cartpositionproviderinterface.php' => 3, | |
| 'cartpositiontrait.php' => 3, | |
| 'costcalculationevent.php' => 3, | |
| 'serverfileinput.php' => 3, | |
| 'discountbehavior.php' => 3, | |
| 'sample_netspeedcell.php' => 3, | |
| 'underscore.php' => 3, | |
| 'cooptilleulsckeditorsonatamediabundle.php' => 3, | |
| 'cutterasset.php' => 3, | |
| 'ext.js' => 3, | |
| 'leaf.php' => 3, | |
| 'timeagoasset.php' => 3, | |
| 'test-dist.ini' => 3, | |
| 'changelog-1.3' => 3, | |
| '.htneatindex' => 3, | |
| 'sonus.sublime-workspace' => 3, | |
| 'addcommands.php' => 3, | |
| 'pest.php' => 3, | |
| 'adapter.php' => 3, | |
| 'cutter.php' => 3, | |
| 'deploy.ini' => 3, | |
| 'redirectresponse.php' => 3, | |
| 'input.php' => 3, | |
| 'ext-dev.js' => 3, | |
| 'autotest_watchr.rb' => 3, | |
| 'package.pear' => 3, | |
| '.htrouter.php' => 3, | |
| 'test.xml' => 3, | |
| 'tinymceelfinder.php' => 3, | |
| 'entrypoint.sh' => 3, | |
| 'stripe.php' => 3, | |
| 'controllerdispatcher.php' => 3, | |
| 'krumo.sample.ini' => 3, | |
| 'gerrit.json' => 3, | |
| 'ext-debug.js' => 3, | |
| 'composer.laravel.json' => 3, | |
| 'ext-all-debug-w-comments.js' => 3, | |
| 'ext-all-debug.js' => 3, | |
| '.rspec' => 3, | |
| 'firewall.php' => 3, | |
| 'ext-all-dev.js' => 3, | |
| 'ext-debug-w-comments.js' => 3, | |
| 'quickbase.php' => 3, | |
| 'pestjson.php' => 3, | |
| 'altorouter.php' => 3, | |
| 'abstractextension.php' => 3, | |
| 'changlog' => 3, | |
| 'web.php' => 3, | |
| 'runtests.php' => 3, | |
| 'generatepackage.php' => 3, | |
| 'evn.sh' => 3, | |
| 'config.dist.json' => 3, | |
| 'twilio.php' => 3, | |
| 'img.php' => 3, | |
| 'ru2ftwofactorbundle.php' => 3, | |
| 'phpunit.idea.xml' => 3, | |
| 'print.php' => 3, | |
| 'windowsazuredistributionbundle.php' => 3, | |
| 'data.json' => 3, | |
| 'soundcloud.php' => 3, | |
| 'classes.php' => 3, | |
| 'configs.php' => 3, | |
| 'pestxml.php' => 3, | |
| 'eventlistener.php' => 3, | |
| 'sonus.sublime-project' => 3, | |
| 'resumable_example.php' => 3, | |
| 'multiprocessing_example.php' => 3, | |
| 'readme.zh-cn' => 3, | |
| 'coveralls.json' => 3, | |
| 'authorizenet.php' => 3, | |
| 'chartasset.php' => 3, | |
| 'instagram.php' => 3, | |
| 'akismet.php' => 3, | |
| 'example_form.php' => 3, | |
| 'serializerawareinterface.php' => 3, | |
| 'bootstraprtlasset.php' => 3, | |
| 'readme_zh' => 3, | |
| 'phpunit-ms.xml.dist' => 3, | |
| 'cacheserviceprovider.php' => 3, | |
| 'elfinderwidget.php' => 3, | |
| 'mock.php' => 3, | |
| 'sample_region.php' => 3, | |
| 'review-1.3' => 3, | |
| 'sonatapagebundle.php' => 3, | |
| 'hooker.json' => 3, | |
| 'jqueryasset.php' => 3, | |
| 'readme.mediawiki' => 3, | |
| 'tests.html' => 3, | |
| 'review-1.5' => 3, | |
| 'php.html' => 3, | |
| 'memberlist.php' => 3, | |
| 'errorhandlertrait.php' => 3, | |
| 'instructions.html' => 3, | |
| 'smartyengine.php' => 3, | |
| 'apache.html' => 3, | |
| 'pharbuilder.php' => 3, | |
| 'donate' => 3, | |
| 'release notes' => 3, | |
| 'casperjs.php' => 3, | |
| 'options_user_settings_set.php' => 3, | |
| 'pre-commit.sample' => 3, | |
| 'requirements_check.php' => 3, | |
| 'fontawesomeassets.php' => 3, | |
| 'oembedserviceprovider.php' => 3, | |
| 'codeception.travis.yml' => 3, | |
| 'oembed.php' => 3, | |
| 'ioniconassets.php' => 3, | |
| 'thumblib.inc.php' => 3, | |
| 'jqwidgetsasset.php' => 3, | |
| '.agignore' => 3, | |
| 'thumbbase.inc.php' => 3, | |
| 'tmplasset.php' => 3, | |
| 'phpthumb.inc.php' => 3, | |
| 'exampleusage.php' => 3, | |
| 'gdthumb.inc.php' => 3, | |
| 'consolebundle.php' => 3, | |
| 'htmltag.php' => 3, | |
| 'cookbook' => 3, | |
| '.howiattributes' => 3, | |
| 'test1.php' => 3, | |
| 'systeminfo.php' => 3, | |
| 'catalog.xml' => 3, | |
| 'alidatatablebundle.php' => 3, | |
| 'swiftmailsystem.php' => 3, | |
| 'master.twig' => 3, | |
| 'matcherinterface.php' => 3, | |
| 'fileuploadasset.php' => 3, | |
| 'composer.json.bak' => 3, | |
| 'readme.upgrading' => 3, | |
| 'readme.providers' => 3, | |
| 'readme.provider-guide' => 3, | |
| 'sonatadatagridbundle.php' => 3, | |
| 'httprequest.php' => 3, | |
| 'vagrant-provision.sh' => 3, | |
| 'read.me' => 3, | |
| 'passwordgenerator.php' => 3, | |
| 'providers.php' => 3, | |
| 'dateintervalbundle.php' => 3, | |
| 'tables.php' => 3, | |
| 'test,json' => 3, | |
| 'coding_standards' => 3, | |
| 'create.php' => 3, | |
| 'bootstrap-root.sh' => 3, | |
| 'dao.php' => 3, | |
| 'ivoryckeditorbundle.php' => 3, | |
| 'docmd.json' => 3, | |
| 'appkernel.php' => 3, | |
| 'manifest.in' => 3, | |
| 'doxygen.config' => 3, | |
| 'gssdk.php' => 3, | |
| 'cell.php' => 3, | |
| 'holamon.php' => 3, | |
| 'web_package.info' => 3, | |
| '.parameters.php' => 3, | |
| 'kint.class.php' => 3, | |
| 'normalizer.php' => 3, | |
| 'webtools.php' => 3, | |
| 'common.xml' => 3, | |
| 'nestable.php' => 3, | |
| 'sniff.php' => 3, | |
| 'haanga-cli.php' => 3, | |
| 'baseasset.php' => 3, | |
| 'authmodule.php' => 3, | |
| 'miniond' => 3, | |
| 'samiconfig.php' => 3, | |
| 'bootstrap_all_modules.php' => 3, | |
| 'example.phpunit.xml' => 3, | |
| 'index.php.example' => 3, | |
| 'composer_release_notes' => 3, | |
| 'bootstrapinterface.php' => 3, | |
| 'inheritance_release_notes' => 3, | |
| 'new_features' => 3, | |
| 'datasource.php' => 3, | |
| 'asseticbundle.php' => 3, | |
| 'phalcon.sh' => 3, | |
| 'doctrine' => 3, | |
| 'ajaxfilter.php' => 3, | |
| 'a.php' => 3, | |
| 'upgrade-1.8' => 3, | |
| '.exrc' => 3, | |
| 'arc2_getpreferredformat.php' => 3, | |
| 'apikey-dist.php' => 3, | |
| 'arc2_getformat.php' => 3, | |
| 'arc2_resource.php' => 3, | |
| 'arc2_reader.php' => 3, | |
| 'amazonwebservicesfactory.php' => 3, | |
| 'amazonwebservices.php' => 3, | |
| 'trsteelckeditorbundle.php' => 3, | |
| 'fabfile.py' => 3, | |
| 'phpunit.oauth1.xml' => 3, | |
| 'arc2.php' => 3, | |
| 'extract.php' => 3, | |
| 'rss2.php' => 3, | |
| 'rss1.php' => 3, | |
| 'atom.php' => 3, | |
| 'packagist.php' => 3, | |
| 'events' => 3, | |
| 'example.config.php' => 3, | |
| 'phpunit.ci.xml' => 3, | |
| 'multiselectasset.php' => 3, | |
| '_tests_boostrap.php' => 3, | |
| 'pmdrules.xml' => 3, | |
| 'hello_world.php' => 3, | |
| 'php-git-hooks.yml.sample' => 3, | |
| 'registrationinterface.php' => 3, | |
| 'userinterface.php' => 3, | |
| 'tinymcelangasset.php' => 3, | |
| 'coresphereconsolebundle.php' => 3, | |
| 'widophttpadapterbundle.php' => 3, | |
| 'datagrid.php' => 3, | |
| 'defaultvaluesupplier.php' => 3, | |
| 'resourceregistrar.php' => 3, | |
| 'doctrinemigrationsbundle.php' => 3, | |
| 'upgrade-4.0' => 3, | |
| 'twittercard.php' => 3, | |
| 'install.json' => 3, | |
| 'abstractlogger.php' => 3, | |
| 'braintree.php' => 3, | |
| 'generatorinterface.php' => 3, | |
| 'countrycodetoregioncodemapfortesting.php' => 3, | |
| 'di.php' => 3, | |
| 'cleanup.sh' => 3, | |
| 'containerawareinterface.php' => 3, | |
| 'arc2_class.php' => 3, | |
| 'failedjob.php' => 3, | |
| 'querybuilderinterface.php' => 3, | |
| 'nbt' => 3, | |
| 'autounit' => 3, | |
| 'zend-license' => 3, | |
| 'angularanimateasset.php' => 3, | |
| 'placeholder.php' => 3, | |
| 'agpl' => 3, | |
| '.htaccess.example' => 3, | |
| 'whiteoctoberpagerfantabundle.php' => 3, | |
| 'phpunit.autoload.php.dist' => 3, | |
| 'datamapperinterface.php' => 3, | |
| 'qywechat.php' => 3, | |
| 'uploadevents.php' => 3, | |
| 'mpwechat.php' => 3, | |
| 'content-link.php' => 3, | |
| 'tracker.php' => 3, | |
| 'hash.php' => 3, | |
| 'sample.html' => 3, | |
| 'requireasset.php' => 3, | |
| 'httpkernel.php' => 3, | |
| 'forminterface.php' => 3, | |
| 'formexception.php' => 3, | |
| 'liuggioexcelbundle.php' => 3, | |
| 'check.sh' => 3, | |
| 'js_localize.php' => 3, | |
| 'global.js' => 3, | |
| 'lock.php' => 3, | |
| 'bag.php' => 3, | |
| 'selection.json' => 3, | |
| 'cronbundle.php' => 3, | |
| 'filegetcontentsloader.php' => 3, | |
| 'maintenance.php' => 3, | |
| 'example.sh' => 3, | |
| 'search.html' => 3, | |
| 'phar.php' => 3, | |
| 'readme-pt_br' => 3, | |
| 'expressionfunction.php' => 3, | |
| 'tasks.xml' => 3, | |
| 'expressionfunctionproviderinterface.php' => 3, | |
| 'parsedexpression.php' => 3, | |
| 'menusserviceprovider.php' => 3, | |
| 'menuitem.php' => 3, | |
| 'serializedparsedexpression.php' => 3, | |
| 'syntaxerror.php' => 3, | |
| '.todo' => 3, | |
| 'tokenstream.php' => 3, | |
| 'menufacade.php' => 3, | |
| 'widgets.php' => 3, | |
| 'rmspushnotificationsbundle.php' => 3, | |
| 'punkavefileuploaderbundle.php' => 3, | |
| 'control_registry.inc.php' => 3, | |
| 'angularrouteasset.php' => 3, | |
| 'toggle.php' => 3, | |
| 'chatlibasset.php' => 3, | |
| 'chatwidget.php' => 3, | |
| 'tpgextjsbundle.php' => 3, | |
| 'amchartasset.php' => 3, | |
| 'commands.php' => 3, | |
| 'stringutils.php' => 3, | |
| ' changelog' => 3, | |
| 'detect.php' => 3, | |
| 'fxpassetplugin.php' => 3, | |
| 'assetevents.php' => 3, | |
| 'abstractclient.php' => 3, | |
| 'phpunit.xml.dev' => 3, | |
| '.classpath' => 3, | |
| 'createphar.php' => 3, | |
| 'wp-cli.php' => 3, | |
| 'modalasset.php' => 3, | |
| 'modelinterface.php' => 3, | |
| 'abstractpaginator.php' => 3, | |
| 'raw.sql' => 3, | |
| 'formtest.php' => 3, | |
| 'lengthawarepaginator.php' => 3, | |
| 'bootstrapthreepresenter.php' => 3, | |
| 'config.sample' => 3, | |
| 'urlinterface.php' => 3, | |
| 'migration' => 3, | |
| 'bootstrapthreenextpreviousbuttonrenderertrait.php' => 3, | |
| 'cachetrait.php' => 3, | |
| 'kindeditorcontroller.php' => 3, | |
| 'travis-init.sh' => 3, | |
| 'urlwindow.php' => 3, | |
| 'migrationgenerator.php' => 3, | |
| 'memcachedconnector.php' => 3, | |
| '.php-cs' => 3, | |
| 'generate-doc' => 3, | |
| 'omnipaybundle.php' => 3, | |
| 'phpmd_rules.xml' => 3, | |
| 'inspectations.xml' => 3, | |
| 'invalidargumentexception.php' => 3, | |
| 'mdruleset.xml' => 3, | |
| 'phpfastcache.php' => 3, | |
| 'cmd.php' => 3, | |
| 'imageinterface.php' => 3, | |
| 'jmstranslationbundle.php' => 3, | |
| 'phalcon.bat' => 3, | |
| '.env.local.php' => 3, | |
| 'phalcon.php' => 3, | |
| 'prove.php' => 3, | |
| 'test2.php' => 3, | |
| 'phalcon.pear' => 3, | |
| 'memcache.php' => 3, | |
| 'translatorinterface.php' => 3, | |
| 'abstractdriver.php' => 3, | |
| 'returnurl.php' => 3, | |
| 'dbexception.php' => 3, | |
| 'phalcon-completion.bash' => 3, | |
| 'apidoc.json' => 3, | |
| 'thrift_protocol.ini' => 3, | |
| 'readme.apache' => 3, | |
| 'plugins.php' => 3, | |
| 'yuicompressor-2.4.8.jar' => 3, | |
| 'generate-package.php' => 3, | |
| 'pom.xml.dist' => 3, | |
| 'regexp.php' => 3, | |
| 'makefile-neam' => 3, | |
| 'gplv3' => 3, | |
| 'urlwindowpresentertrait.php' => 3, | |
| '.gtignore' => 3, | |
| 'useragent.php' => 3, | |
| 'simplebootstrapthreepresenter.php' => 3, | |
| 'makepackage.php' => 3, | |
| 'scanner.php' => 3, | |
| 'serverinterface.php' => 3, | |
| 'oss.php' => 3, | |
| 'yiiwheels.php' => 3, | |
| 'filesysteminterface.php' => 3, | |
| 'content-page.php' => 3, | |
| 'standard' => 3, | |
| 'example.composer.json' => 3, | |
| 'elfinder.html' => 3, | |
| 'prestacmssandboxbundle.php' => 2, | |
| 'twocheckoutadapter.php' => 2, | |
| 'twocheckout.php' => 2, | |
| 'lincense' => 2, | |
| 'kcfinderwidgetasset.php' => 2, | |
| 'config.codekit' => 2, | |
| 'sami.phar' => 2, | |
| 'kcfinderinputwidget.php' => 2, | |
| 'benchmark' => 2, | |
| 'kcfinder.php' => 2, | |
| 'phpbu.xml.sample' => 2, | |
| 'example.json' => 2, | |
| 'ccdncomponentcrumbtrailbundle.php' => 2, | |
| 'twocheckoutcharge.php' => 2, | |
| 'install-apigen.sh' => 2, | |
| 'flag.php' => 2, | |
| 'tinymce.gzip.php' => 2, | |
| 'screenshot.gif' => 2, | |
| 'twocheckoutmessage.php' => 2, | |
| 'twocheckoutnotification.php' => 2, | |
| 'install-apigen.sh.bat' => 2, | |
| 'push-docs-to-gh-pages.sh' => 2, | |
| 'yuccaprerenderbundle.php' => 2, | |
| 'adminltepluginasset.php' => 2, | |
| 'errors.json' => 2, | |
| 'twocheckoutreturn.php' => 2, | |
| 'entitymanagerinterface.php' => 2, | |
| 'push.sh' => 2, | |
| 'fkrcssurlrewritebundle.php' => 2, | |
| 'newscoopfacebookmetabundle.php' => 2, | |
| 'mailqueue.php' => 2, | |
| 'migrationmodule.php' => 2, | |
| 'functions.sh' => 2, | |
| 'bc-mapi.php' => 2, | |
| 'remoteserviceprovider.php' => 2, | |
| 'remotemanager.php' => 2, | |
| 'multiconnection.php' => 2, | |
| 'elfindervolumeflysystem.php' => 2, | |
| 'config.dist.ini' => 2, | |
| 'run_phpcs_experiment.php' => 2, | |
| 'resourcecontroller.php' => 2, | |
| 'colorboxasset.php' => 2, | |
| 'bc-mapi-cache.php' => 2, | |
| 'multipleselectasset.php' => 2, | |
| 'filemodel.php' => 2, | |
| '.labname' => 2, | |
| 'cloner.php' => 2, | |
| 'seclibgateway.php' => 2, | |
| 'commentsmodule.php' => 2, | |
| 'trustyserviceprovider.php' => 2, | |
| 'addtrustexternalcaroot.crt' => 2, | |
| 'command_classes.php' => 2, | |
| 'anvil.php' => 2, | |
| 'yaml_translation_patterns.yml' => 2, | |
| 'cps_api.php' => 2, | |
| 'cps_simple.php' => 2, | |
| 'trusty.php' => 2, | |
| '.atoum.coverage.php' => 2, | |
| 'validatorserviceprovider.php' => 2, | |
| '.lgtm' => 2, | |
| 'lgpl-license' => 2, | |
| '_autoload.php' => 2, | |
| 'tagsinput.php' => 2, | |
| 'tagsinputasset.php' => 2, | |
| 'coveralls.yml' => 2, | |
| 'documentation.config.xml' => 2, | |
| 'daemoncontroller.php' => 2, | |
| 'keys.php' => 2, | |
| 'event.js' => 2, | |
| 'multipleselect.php' => 2, | |
| 'baseyii.php' => 2, | |
| 'intltelinputasset.php' => 2, | |
| 'matrix.php' => 2, | |
| 'uploadcare.php' => 2, | |
| 'datacolumn.php' => 2, | |
| 'vreshtwiliobundle.php' => 2, | |
| 'filesbehavior.php' => 2, | |
| 'set_guzzle5.sh' => 2, | |
| 'template.js' => 2, | |
| 'config.inc.php.sample' => 2, | |
| 'screenshot1.jpg' => 2, | |
| 'ueditorcontroller.php' => 2, | |
| 'fatalerrorexception.php' => 2, | |
| 'magic.php' => 2, | |
| 'game.php' => 2, | |
| 'colorpickerwidget.php' => 2, | |
| 'xlsview.php' => 2, | |
| 'easyimageasset.php' => 2, | |
| 'phpzone.yml' => 2, | |
| 'ueditorwidget.php' => 2, | |
| 'uploadifyaction.php' => 2, | |
| 'uploadcropasset.php' => 2, | |
| 'uploadcrop.php' => 2, | |
| 'inarrayvalidator.php' => 2, | |
| '.hound.yml' => 2, | |
| 'documentfactoryinterface.php' => 2, | |
| 'preview.php' => 2, | |
| 'defaultdocumentfactory.php' => 2, | |
| 'statistics.php' => 2, | |
| 'widgetmanager.php' => 2, | |
| 'prompts.json' => 2, | |
| 'dsl_config.dist' => 2, | |
| 'tikaapp.php' => 2, | |
| 'readmegen' => 2, | |
| 'soqratehtml2pdfbundle.php' => 2, | |
| 'openpayu.php' => 2, | |
| 'unitpay.php' => 2, | |
| 'readmegen.yml' => 2, | |
| 'phpbu' => 2, | |
| 'b2_api.php' => 2, | |
| 'iso4217test.php' => 2, | |
| 'newscoopeditorbundle.php' => 2, | |
| 'coverage.sh' => 2, | |
| 'ajax.js' => 2, | |
| 'validatorexception.php' => 2, | |
| 'fnactivefield.php' => 2, | |
| 'curlchannel.php' => 2, | |
| 'note.json' => 2, | |
| 'checklicense.php' => 2, | |
| 'frequencewebcalendrbundle.php' => 2, | |
| 'cjson.php' => 2, | |
| 'stfalcontinymcebundle.php' => 2, | |
| 'liipimaginebundle.php' => 2, | |
| 'annotationreader.php' => 2, | |
| 'phinx.dist.yml' => 2, | |
| 'recaptchalib.php' => 2, | |
| 'containerloader.php' => 2, | |
| 'rcserviredbundle.php' => 2, | |
| 'iso4217.php' => 2, | |
| 'httpkernelinterface.php' => 2, | |
| 'coverage.yml' => 2, | |
| 'migrationmanager.php' => 2, | |
| 'weixin.php' => 2, | |
| 'peridot.coverage.php' => 2, | |
| 'nginx.sample.conf' => 2, | |
| 'send24.php' => 2, | |
| 'config.php.sample' => 2, | |
| 'clientjson.php' => 2, | |
| 'angular-resource.min.js' => 2, | |
| 'upyun.class.php' => 2, | |
| 'qrcode.class.php' => 2, | |
| 'stageinterface.php' => 2, | |
| 'exceptionserviceprovider.php' => 2, | |
| '.phptidy-config.php' => 2, | |
| 'composerextension.php' => 2, | |
| 'jorobo.dist.ini' => 2, | |
| 'jorobo.ini' => 2, | |
| 'config.yaml.dist' => 2, | |
| 'backbee' => 2, | |
| 'angular-resource.js' => 2, | |
| 'yo.php' => 2, | |
| 'jquery-ui.min.js' => 2, | |
| 'php' => 2, | |
| 'emigratecommand.php' => 2, | |
| 'docker-compose-example.yml' => 2, | |
| 'pear5.php' => 2, | |
| 'serializeattributeexception.php' => 2, | |
| 'deserializeattributeexception.php' => 2, | |
| 'payubundle.php' => 2, | |
| 'ccdncomponentbbcodebundle.php' => 2, | |
| 'readme.wiki' => 2, | |
| 'memberserviceprovider.php' => 2, | |
| '.docgen' => 2, | |
| 'emailaddressvalidator.php' => 2, | |
| 'gatewayfactory.php' => 2, | |
| 'readme-laravel' => 2, | |
| 'webmoney.php' => 2, | |
| 'angular-route.js' => 2, | |
| 'ext-theme-classic-sandbox.js' => 2, | |
| 'membertab.php' => 2, | |
| 'upgrade-2.0.0' => 2, | |
| 'listview.php' => 2, | |
| 'options_user_settings.php' => 2, | |
| 'ckeditorwidget.php' => 2, | |
| 'slyrelationbundle.php' => 2, | |
| 'extdirectbundle.php' => 2, | |
| 'makefile.docker' => 2, | |
| 'class.phpmaileroauthgoogle.php' => 2, | |
| 'deploy.example.php' => 2, | |
| 'runtime.php' => 2, | |
| 'class.phpmaileroauth.php' => 2, | |
| 'editableaction.php' => 2, | |
| 'csvview.php' => 2, | |
| 'languarasymfonybundle.php' => 2, | |
| 'sendgrid_loader.php' => 2, | |
| 'gateway.php' => 2, | |
| 'stat.php' => 2, | |
| 'ccdnforumadminbundle.php' => 2, | |
| 'sendgrid.php' => 2, | |
| 'readonly.php' => 2, | |
| 'sake' => 2, | |
| 'colorpickerasset.php' => 2, | |
| 'fpjsformvalidatorbundle.php' => 2, | |
| 'ccdncomponentcommonbundle.php' => 2, | |
| 'main.php5' => 2, | |
| 'cli-script.php' => 2, | |
| 'readme_composerinstall' => 2, | |
| '.htaccess.original' => 2, | |
| 'extender.php' => 2, | |
| 'zayassborisbundle.php' => 2, | |
| 'solrinterface.php' => 2, | |
| 'autogitpull.sublime-project' => 2, | |
| 'get_oauth_token.php' => 2, | |
| 'pagesize.php' => 2, | |
| 'lisezmoi.mkd' => 2, | |
| 'externallib.php' => 2, | |
| 'serializedattributes.php' => 2, | |
| '_read_me' => 2, | |
| 'channelinterface.php' => 2, | |
| 'shortcode.php' => 2, | |
| 'phpbu.xsd' => 2, | |
| 'tokenizer.php' => 2, | |
| 'baseform.php' => 2, | |
| 'bootstrapevents.php' => 2, | |
| 'restbundle.php' => 2, | |
| 'multilanguagebehavior.php' => 2, | |
| 'apiquery.php' => 2, | |
| 'ajaxform.php' => 2, | |
| 'deploy_cfg.sh.init' => 2, | |
| 'singleasset.php' => 2, | |
| 'multipleasset.php' => 2, | |
| 'countries.php' => 2, | |
| 'multilanguagehelper.php' => 2, | |
| 'confighelper.php' => 2, | |
| '.module.php' => 2, | |
| 'docs.ini' => 2, | |
| 'deploy_cfg.sh.travis' => 2, | |
| 'command' => 2, | |
| 'super-cpt.php' => 2, | |
| 'ccdncomponentdashboardbundle.php' => 2, | |
| 'devicedetector.php' => 2, | |
| 'conf.json' => 2, | |
| '.scrutiizer.yml' => 2, | |
| 'extend_doc' => 2, | |
| 'caxyelasticsearchbundle.php' => 2, | |
| 'readme-pt-br' => 2, | |
| 'example_debug.png' => 2, | |
| 'developer' => 2, | |
| 'phpsigepfpdf.php' => 2, | |
| 'servicecontainer.php' => 2, | |
| 'tableview.php' => 2, | |
| 'abstractfixture.php' => 2, | |
| 'exporterview.php' => 2, | |
| 'multilanguagetrait.php' => 2, | |
| '_lisez_moi' => 2, | |
| 'phploy.bat' => 2, | |
| 'bootswatchasset.php' => 2, | |
| 'staffimrollbarbundle.php' => 2, | |
| 'phpunit-mysql.xml' => 2, | |
| 't3jquery' => 2, | |
| 'rollbarreporter.php' => 2, | |
| 'phploy.php' => 2, | |
| 'schebtwofactorbundle.php' => 2, | |
| 'tests' => 2, | |
| 'assetmanagerinterface.php' => 2, | |
| 'reportdecisionmanager.php' => 2, | |
| 'jquerycookieasset.php' => 2, | |
| 'runphpunittests.sh' => 2, | |
| 'angular-route.min.js' => 2, | |
| 'html2pdf.php' => 2, | |
| 'admin_tools.php' => 2, | |
| 'fnactiveform.php' => 2, | |
| 'excelformatter.php' => 2, | |
| 'subscriber.php' => 2, | |
| 'adminer.css' => 2, | |
| 'multilanguageurlmanager.php' => 2, | |
| 'kwattromarkdownbundle.php' => 2, | |
| 'kernelevents.php' => 2, | |
| 'database_mysql.sql' => 2, | |
| '.travis-build.sh' => 2, | |
| 'dates.php' => 2, | |
| 1 => 2, | |
| 'json_io.php' => 2, | |
| 'magnificpopup.php' => 2, | |
| 'head' => 2, | |
| 'ccdncomponentattachmentbundle.php' => 2, | |
| 'easyuiasset.php' => 2, | |
| 'credentials.json' => 2, | |
| 'bindinginterface.php' => 2, | |
| 'index.php.bak' => 2, | |
| 'reflected_runner.php' => 2, | |
| 'observer.php' => 2, | |
| 'svggraphdatalabels.php' => 2, | |
| 'svggraphcolours.php' => 2, | |
| 'svggraphbarandlinegraph.php' => 2, | |
| 'importinterface.php' => 2, | |
| 'dynamicformbundle.php' => 2, | |
| 'phpunit_pgsql.xml' => 2, | |
| 'bootstrapbundle.php' => 2, | |
| 'drupal-ti' => 2, | |
| 'pdfresponseformatter.php' => 2, | |
| 'ansible.cfg' => 2, | |
| 'baseconverter.php' => 2, | |
| 'makefile.in' => 2, | |
| 'glorpenpropelbundle.php' => 2, | |
| 'grunt-menu.sh' => 2, | |
| 'locationpickerasset.php' => 2, | |
| 'multiselectwidget.php' => 2, | |
| 'readme_zh-cn' => 2, | |
| '.vagrant' => 2, | |
| 'portlet.php' => 2, | |
| 'sparklineasset.php' => 2, | |
| 'wsdlgenerator.php' => 2, | |
| 'webservice.php' => 2, | |
| 'select2widget.php' => 2, | |
| 'knobasset.php' => 2, | |
| 'class-plugin.php' => 2, | |
| 'jcropwidget.php' => 2, | |
| 'grunt-installer.sh' => 2, | |
| 'waveform.php' => 2, | |
| 'consulta' => 2, | |
| 'ohformerrorlogbundle.php' => 2, | |
| 'readme_1' => 2, | |
| 'filecontroller.php' => 2, | |
| 'menubundle.php' => 2, | |
| 'watcher' => 2, | |
| 'nestableasset.php' => 2, | |
| 'config.json.sample' => 2, | |
| 'phar-cli-stub.php' => 2, | |
| 'phphelper.php' => 2, | |
| 'slickwidget.php' => 2, | |
| 'generate_package_xml.php' => 2, | |
| '.pharcc.yml' => 2, | |
| 'convention.php' => 2, | |
| 'ci.sh' => 2, | |
| 'added info fonts' => 2, | |
| 'container.xml' => 2, | |
| 'simplecache.php' => 2, | |
| 'readme_fr' => 2, | |
| 'tadckatreeevents.php' => 2, | |
| 'autoload.php-dist' => 2, | |
| 'ldap.php' => 2, | |
| 'filename.sql' => 2, | |
| 'apex' => 2, | |
| 'pusher.php' => 2, | |
| 'readme.pdf' => 2, | |
| 'flintlabsformmetadatabundle.php' => 2, | |
| 'release-1.0.0' => 2, | |
| 'highlightjsasset.php' => 2, | |
| 'notificacao' => 2, | |
| 'package.png' => 2, | |
| 'syntaxhighlighter.php' => 2, | |
| 'emailer.php' => 2, | |
| 'amqplibconnector.php' => 2, | |
| 'amqp.php' => 2, | |
| '.nojekyll' => 2, | |
| 'how-to' => 2, | |
| 'constraintvalidatorfactory.php' => 2, | |
| 'apimodule.php' => 2, | |
| 'twigengine.php' => 2, | |
| 'yiinewrelic.php' => 2, | |
| 'yiinewrelicclientscript.php' => 2, | |
| 'picture.png' => 2, | |
| 'fieldinterface.php' => 2, | |
| 'init.sql' => 2, | |
| '.vimproject' => 2, | |
| '.phpspec.yml' => 2, | |
| 'plugin.png' => 2, | |
| 'clean' => 2, | |
| 'region.php' => 2, | |
| 'swiper.php' => 2, | |
| 'hierarchy.php' => 2, | |
| 'imgur.php' => 2, | |
| 'smsserviceinterface.php' => 2, | |
| '.travis.yml.old' => 2, | |
| 'curlwrapper.php' => 2, | |
| 'bmatznerfoundationbundle.php' => 2, | |
| 'invalidconfigexception.php' => 2, | |
| 'travis.yaml' => 2, | |
| 'amqplibconnectorssl.php' => 2, | |
| 'requisicao_pagamento' => 2, | |
| 'param' => 2, | |
| 'flotasset.php' => 2, | |
| 'excanvasasset.php' => 2, | |
| 'gitmanager.sh' => 2, | |
| 'codemirrorwidget.php' => 2, | |
| 'restexception.php' => 2, | |
| 'admingeneratoruserbundle.php' => 2, | |
| 'ifilter.php' => 2, | |
| 'redisconnector.php' => 2, | |
| 'install_amqp.sh' => 2, | |
| 'bootstrap-media-lightbox.min.js' => 2, | |
| 'bootstrap-media-lightbox.less' => 2, | |
| 'forms' => 2, | |
| 'bootstrap-media-lightbox.js' => 2, | |
| 'array.php' => 2, | |
| 'bootstrap-media-lightbox.css' => 2, | |
| 'gauges.yml' => 2, | |
| 'ooyalaapi.php' => 2, | |
| 'tpredactorbundle.php' => 2, | |
| 'celery.php' => 2, | |
| 'sample-data.sql' => 2, | |
| 'plex.php' => 2, | |
| 'getid3core.php' => 2, | |
| 'routeproviderinterface.php' => 2, | |
| 'routecompilerinterface.php' => 2, | |
| 'routecompiler.php' => 2, | |
| 'amqppeclconnector.php' => 2, | |
| 'apns.php' => 2, | |
| 'apnsgcm.php' => 2, | |
| 'phpmqtt.php' => 2, | |
| 'knppiwikbundle.php' => 2, | |
| 'roller_xhprof.php' => 2, | |
| 'knpdisqusbundle.php' => 2, | |
| 'mcapi.class.php' => 2, | |
| 'sample.htaccess' => 2, | |
| 'propel.yaml' => 2, | |
| 'now.php' => 2, | |
| 'doxygen' => 2, | |
| 'knpmarkdownbundle.php' => 2, | |
| 'markdownparserinterface.php' => 2, | |
| 'phpunit-cov.xml' => 2, | |
| 'presentableinterface.php' => 2, | |
| 'knpmenubundle.php' => 2, | |
| 'bootstrapconfirmationasset.php' => 2, | |
| 'update.readme' => 2, | |
| 'abstractdocument.php' => 2, | |
| 'knpradbundle.php' => 2, | |
| 'knpsnappybundle.php' => 2, | |
| 'datetimeformatter.php' => 2, | |
| 'pagesbundle.php' => 2, | |
| 'composer.json.save' => 2, | |
| 'escaper.php' => 2, | |
| 'expr.php' => 2, | |
| 'record.php' => 2, | |
| 'updating' => 2, | |
| 'h2o.php' => 2, | |
| 'agent.php' => 2, | |
| 'support.readme' => 2, | |
| 'kitanoconnectionbundle.php' => 2, | |
| 'doctrine-extensions-mapping.xsd' => 2, | |
| 'bootstrapselectasset.php' => 2, | |
| 'owners' => 2, | |
| 'b' => 2, | |
| 'connectionmanager.php' => 2, | |
| 'panel.phtml' => 2, | |
| 'google-analytics-readme' => 2, | |
| 'ruleschecker.php' => 2, | |
| 'statementinterface.php' => 2, | |
| 'travis-ci-apache' => 2, | |
| 'association.php' => 2, | |
| 'associationcollection.php' => 2, | |
| 'tags.php' => 2, | |
| 'assetconverter.php' => 2, | |
| 'resultset.php' => 2, | |
| 'cacheevents.php' => 2, | |
| 'how-to-install' => 2, | |
| 'how-to-use' => 2, | |
| 'travisphp.ini' => 2, | |
| 'sync_data.py' => 2, | |
| 'tableregistry.php' => 2, | |
| 'db' => 2, | |
| 'imageuploadbehavior.php' => 2, | |
| 'main.css' => 2, | |
| 'phpdir.h' => 2, | |
| 'phpdir.c' => 2, | |
| 'path.h' => 2, | |
| 'path.c' => 2, | |
| 'kptivepaymentsipsbundle.php' => 2, | |
| 'fsidoctrineextensionsbundle.php' => 2, | |
| 'model.class.php' => 2, | |
| 'upgrade_from_ratchet' => 2, | |
| 'cmakelists' => 2, | |
| '_aerospike_ide_helper.php' => 2, | |
| 'phpcs_rules.xml' => 2, | |
| 'videojsasset.php' => 2, | |
| 'apicontroller.php' => 2, | |
| 'modelhelper.php' => 2, | |
| 'bulutyazilimlocationbundle.php' => 2, | |
| 'kgstaticbundle.php' => 2, | |
| 'bulutyazilimfeedbackbundle.php' => 2, | |
| 'opcache.php' => 2, | |
| 'usersasset.php' => 2, | |
| 'routemanager.php' => 2, | |
| 'rollbar.php' => 2, | |
| 'curlhttp.php' => 2, | |
| 'wpcept' => 2, | |
| 'wpcept.bat' => 2, | |
| 'ext_icon.svg' => 2, | |
| '.env.php' => 2, | |
| 'lswapicallerbundle.php' => 2, | |
| 'prestasonatagedmodoctrineextensionsbundle.php' => 2, | |
| 'refactor' => 2, | |
| 'twillio.php' => 2, | |
| 'lswmemcachebundle.php' => 2, | |
| 'offsitepaymentfactory.php' => 2, | |
| 'gcm.php' => 2, | |
| 'filehandler.php' => 2, | |
| 'zray.php' => 2, | |
| 'releasing' => 2, | |
| 'sami_config.php' => 2, | |
| 'googlecalendarasset.php' => 2, | |
| 'test.log' => 2, | |
| 'getstorage.php' => 2, | |
| 'upgrade-3.3' => 2, | |
| 'source' => 2, | |
| 'upgrade-3.4' => 2, | |
| 'lock.png' => 2, | |
| 'dns.php' => 2, | |
| 'kunstmaansentrybundle.php' => 2, | |
| 'datastore.php' => 2, | |
| 'domains.php' => 2, | |
| 'aceeditorasset.php' => 2, | |
| 'mailgun.php' => 2, | |
| 'twitter_client.json' => 2, | |
| 'whiteoctoberbreadcrumbsbundle.php' => 2, | |
| 'adjacencylistbehavior.php' => 2, | |
| 'materializedpathbehavior.php' => 2, | |
| 'builddocs.sh' => 2, | |
| 'upgrade-1.7' => 2, | |
| 'example_config.yml' => 2, | |
| 'whats_new' => 2, | |
| 'upgrade-1.6' => 2, | |
| 'geoip.php' => 2, | |
| 'passwordbehavior.php' => 2, | |
| '.lin3s_cs.yml.dist' => 2, | |
| 'loginform.php' => 2, | |
| 'usermanager.php' => 2, | |
| 'dump.rdb' => 2, | |
| 'filereader.php' => 2, | |
| 'fieldset.php' => 2, | |
| 'cacheclientinterface.php' => 2, | |
| 'configurator.php' => 2, | |
| 'easythumbnail.php' => 2, | |
| 'easythumbnailimage.php' => 2, | |
| 'extendabletrait.php' => 2, | |
| 'errorstack.php' => 2, | |
| 'formevent.php' => 2, | |
| 'opencall.php' => 2, | |
| 'neklandfeedbundle.php' => 2, | |
| 'setterbuilder.php' => 2, | |
| 'imageservice.php' => 2, | |
| 'ss_upgrade_log' => 2, | |
| 'abstractevent.php' => 2, | |
| 'berylliumcachebundle.php' => 2, | |
| 'containerbuilder.php' => 2, | |
| 'filewriter.php' => 2, | |
| 'streamresponse.php' => 2, | |
| 'streamwriterinterface.php' => 2, | |
| 'streamwriterwrapper.php' => 2, | |
| 'readme-cn' => 2, | |
| 'accessor.php' => 2, | |
| 'util.js' => 2, | |
| 'processing.js' => 2, | |
| 'jquery.cookie.js' => 2, | |
| 'extendable.php' => 2, | |
| 'excanvas.min.js' => 2, | |
| 'theme.yaml' => 2, | |
| 'install_fr' => 2, | |
| 'extensionbase.php' => 2, | |
| 'confirm.js' => 2, | |
| 'phpspec-with-coverage.yml' => 2, | |
| 'networkserviceprovider.php' => 2, | |
| 'file-header.js' => 2, | |
| 'ext-theme-neptune.js' => 2, | |
| 'urlserviceprovider.php' => 2, | |
| 'ext-theme-gray.js' => 2, | |
| 'ext-theme-classic.js' => 2, | |
| 'graphinterface.php' => 2, | |
| 'ext-theme-access.js' => 2, | |
| 'ext-all-rtl.js' => 2, | |
| 'ext-all-rtl-dev.js' => 2, | |
| 'ext-all-rtl-debug.js' => 2, | |
| 'ext-all-rtl-debug-w-comments.js' => 2, | |
| 'mangopayevents.php' => 2, | |
| 'facebookstrategy.php' => 2, | |
| 'blockbuilder.php' => 2, | |
| 'vincetbootstrapformbundle.php' => 2, | |
| 'extensiontrait.php' => 2, | |
| 'divider.php' => 2, | |
| 'stfalconblogbundle.php' => 2, | |
| 'supported_apis' => 2, | |
| 'php-ups-api-logo.svg' => 2, | |
| 'replica2.php' => 2, | |
| 'replica2-win.php' => 2, | |
| 'p533patch.php' => 2, | |
| 'deepfreeze.php' => 2, | |
| 'googlestrategy.php' => 2, | |
| 'excanvas.js' => 2, | |
| 'url.js' => 2, | |
| 'tfoxmpdfportbundle.php' => 2, | |
| 'tasks.php' => 2, | |
| 'propelbundle.php' => 2, | |
| 'task' => 2, | |
| 'apitest.php' => 2, | |
| 'ext.store_rabobank.php' => 2, | |
| 'clarolinesurveybundle.php' => 2, | |
| 'distelli-manifest.yml' => 2, | |
| 'curltransport.php' => 2, | |
| 'autoload_proto.php' => 2, | |
| 'directbundle.php' => 2, | |
| 'simple-php-captcha.php' => 2, | |
| 'gpl-2.0' => 2, | |
| '.env.example.php' => 2, | |
| 'jsonformatter.php' => 2, | |
| 'mediaevents.php' => 2, | |
| 'jsonparser.php' => 2, | |
| 'heroku' => 2, | |
| 'proxyclient.php' => 2, | |
| 'releasenotes-2.22' => 2, | |
| 'icalcreator.php' => 2, | |
| 'upgrade.php' => 2, | |
| 'wizardevent.php' => 2, | |
| 'streamtransport.php' => 2, | |
| 'urlencodedformatter.php' => 2, | |
| 'urlencodedparser.php' => 2, | |
| 'wizardbehavior.php' => 2, | |
| 'xmlformatter.php' => 2, | |
| 'clarolinescormbundle.php' => 2, | |
| 'kos4liveacldoctrinequerybundle.php' => 2, | |
| 'date.js' => 2, | |
| 'node.jpeg' => 2, | |
| 'emailtemplatebundle.php' => 2, | |
| 'updater.php' => 2, | |
| 'knptranslatorbundle.php' => 2, | |
| 'constraintviolation.php' => 2, | |
| 'treecollection.php' => 2, | |
| 'pivot.php' => 2, | |
| 'markdownextra.php' => 2, | |
| 'nestedtreescope.php' => 2, | |
| 'modelexception.php' => 2, | |
| 'dongle.php' => 2, | |
| 'datafeed.php' => 2, | |
| 'configserviceprovider.php' => 2, | |
| 'crouter.php' => 2, | |
| 'scrollpager.php' => 2, | |
| 'authexception.php' => 2, | |
| 'microtpl.php' => 2, | |
| 'phpimageoptim.iml' => 2, | |
| 'maesboxvideobundle.php' => 2, | |
| 'extensions.php' => 2, | |
| 'jshrink.php' => 2, | |
| 'sdk_config.ini' => 2, | |
| 'ftrrtfrollbarbundle.php' => 2, | |
| 'class.magic-min.php' => 2, | |
| 'gettoken.php' => 2, | |
| 'plugin_classmap.php' => 2, | |
| 'deployment.ini' => 2, | |
| 'version.properties' => 2, | |
| 'markdowndata.php' => 2, | |
| 'ion.php' => 2, | |
| 'videowidget.php' => 2, | |
| 'phpunit.config.xml' => 2, | |
| 'lazyloadasset.php' => 2, | |
| '.hgsubstate' => 2, | |
| '.hgsub' => 2, | |
| 'apikey.php.dist' => 2, | |
| 'clientconfiguration.php' => 2, | |
| 'tmdbsymfonybundle.php' => 2, | |
| 'statementrepository.php' => 2, | |
| 'chrome.xsl' => 2, | |
| 'content.xsl' => 2, | |
| 'harvest_api_config.json.dist' => 2, | |
| 'contenttools.php' => 2, | |
| 'filevalidator.php' => 2, | |
| 'datetimefilewriter.php' => 2, | |
| 'fileuploadaction.php' => 2, | |
| 'class.html.twig' => 2, | |
| 'htaccess.dist' => 2, | |
| 'bitpay_callback.php' => 2, | |
| 'layout.html.twig' => 2, | |
| 'namespace.html.twig' => 2, | |
| 'rootzone.php' => 2, | |
| 'bitgooglebundle.php' => 2, | |
| 'bitecodesfactrinebundle.php' => 2, | |
| 'showthread.php' => 2, | |
| 'showpost.php' => 2, | |
| 'container.html' => 2, | |
| 'xmlhelper.php' => 2, | |
| 'character.php' => 2, | |
| 'phpunit-xhprof.xml' => 2, | |
| 'example.yml' => 2, | |
| 'luneticszodiacbundle.php' => 2, | |
| 'ja_jp.csv' => 2, | |
| 'de_de.csv' => 2, | |
| 'es_ar.csv' => 2, | |
| 'jsonrpc.php' => 2, | |
| 'fr_fr.csv' => 2, | |
| 'pakefile_bootstrap.php' => 2, | |
| 'pl_pl.csv' => 2, | |
| 'ru_ru.csv' => 2, | |
| 'examples-static.php' => 2, | |
| 'baseactiverecord.php' => 2, | |
| 'datetimerangebehaviorfinder.php' => 2, | |
| 'datetimerangebehavior.php' => 2, | |
| 'apifactory.php' => 2, | |
| 'datetimeattributefinder.php' => 2, | |
| 'blueprint.yml' => 2, | |
| 'fr3dldapbundle.php' => 2, | |
| 'testbundle.php' => 2, | |
| 'cacheitem.php' => 2, | |
| 'daterangeconfig.php' => 2, | |
| 'dbup.phar' => 2, | |
| 'jquery.form.js' => 2, | |
| 'abstracttypeextension.php' => 2, | |
| 'jquery.metadata.js' => 2, | |
| 'team.php' => 2, | |
| 'datepickerconfig.php' => 2, | |
| 'pull-tests' => 2, | |
| 'graph.html' => 2, | |
| 'shellcontroller.php' => 2, | |
| 'articles.php' => 2, | |
| 'toastrajaxfeedasset.php' => 2, | |
| 'toastrajaxfeed.php' => 2, | |
| 'toastr.php' => 2, | |
| 'fmt.phar' => 2, | |
| 'fmt.phar.sha1' => 2, | |
| 'fmt.php' => 2, | |
| 'phpstorm-configuration.png' => 2, | |
| 'phpforcesalesforcebundle.php' => 2, | |
| 'imagescontroller.php' => 2, | |
| 'class-autoload.php' => 2, | |
| 'schema.sqlite.sql' => 2, | |
| 'videoembed.php' => 2, | |
| 'fileuploadbehavior.php' => 2, | |
| 'toastrflash.php' => 2, | |
| 'bash_completion' => 2, | |
| 'foursquare.php' => 2, | |
| 'relationship.php' => 2, | |
| 'blade.php' => 2, | |
| 'known-broken-words' => 2, | |
| 'runtest.sh' => 2, | |
| 'phpunit.autoload.php' => 2, | |
| 'start' => 2, | |
| 'test1' => 2, | |
| 'moduleserviceprovider.php' => 2, | |
| 'xacml-core-v3-schema-wd-17.xsd' => 2, | |
| 'parseserviceprovider.php' => 2, | |
| 'toastrcustomasset.php' => 2, | |
| 'aphpfmt' => 2, | |
| 'layout.xsl' => 2, | |
| 'testloader.php' => 2, | |
| 'namespaces.xsl' => 2, | |
| 'signals.yml' => 2, | |
| 'packages.xsl' => 2, | |
| 'search.json.xsl' => 2, | |
| '.travic.yml' => 2, | |
| 'jpush.php' => 2, | |
| 'xoops_version.php' => 2, | |
| 'annotationparser.php' => 2, | |
| 'faq.php' => 2, | |
| 'mcp.php' => 2, | |
| 'operation.php' => 2, | |
| 'ucp.php' => 2, | |
| 'viewonline.php' => 2, | |
| 'my_model.php' => 2, | |
| 'tinypng.php' => 2, | |
| 'json_response.php' => 2, | |
| 'errors' => 2, | |
| 'build-config.js' => 2, | |
| 'ckeditor.js' => 2, | |
| 'smartybundle.php' => 2, | |
| 'contents.css' => 2, | |
| 'styles.js' => 2, | |
| 'license-en' => 2, | |
| 'apigen.neon.dist' => 2, | |
| 'apigen-dev.neon.dist' => 2, | |
| 'spy.php' => 2, | |
| 'autoload.php.dist.php' => 2, | |
| 'wmusedrootcas.cer' => 2, | |
| 'silex' => 2, | |
| 'ornicarakismetbundle.php' => 2, | |
| 'highcharts-3d.src.js' => 2, | |
| 'resque' => 2, | |
| 'inspector.php' => 2, | |
| 'curlresponse.php' => 2, | |
| 'jquery.min.map' => 2, | |
| 'setup_locale' => 2, | |
| 'jquery-ui.js' => 2, | |
| 'solrdataprovider.php' => 2, | |
| 'solrdocumentinterface.php' => 2, | |
| 'slimscroll.php' => 2, | |
| 'src' => 2, | |
| 'highcharts-all.js' => 2, | |
| 'deployment.sample.php' => 2, | |
| '.ohloh' => 2, | |
| 'highcharts-3d.js' => 2, | |
| 'database.db' => 2, | |
| 'example-atom.php' => 2, | |
| 'userasset.php' => 2, | |
| 'user_agent.php' => 2, | |
| 'elfinderasset.php' => 2, | |
| 'example-rss.php' => 2, | |
| 'template.html' => 2, | |
| 'sassparser.php' => 2, | |
| 'basewechat.php' => 2, | |
| 'hps.php' => 2, | |
| 'sassfile.php' => 2, | |
| 'app.js' => 2, | |
| 'audittrail.php' => 2, | |
| 'sassexception.php' => 2, | |
| 'highlightjs.php' => 2, | |
| 'nomad_mimemail.inc.php' => 2, | |
| 'nomad_mimemail.test.php' => 2, | |
| 'abstractconnection.php' => 2, | |
| 'css.js' => 2, | |
| 'drag.js' => 2, | |
| 'phpspec-test.yml' => 2, | |
| 'looptribeformspatialbundle.php' => 2, | |
| 'composer.xml' => 2, | |
| 'dic.info' => 2, | |
| 'dic.install' => 2, | |
| 'dic.module' => 2, | |
| 'add-textdomain.php' => 2, | |
| '.scruitinizer.yml' => 2, | |
| 'mongocursor.php' => 2, | |
| 'emongocursor.php' => 2, | |
| 'mapinput.php' => 2, | |
| 'phpunit.xml.dist.xml' => 2, | |
| 'dataflow.php' => 2, | |
| 'copyright.inc.php' => 2, | |
| 'podioapi.php' => 2, | |
| 'cursor.php' => 2, | |
| 'cron-svn-pots.php' => 2, | |
| 'importers-i18n.php' => 2, | |
| 'composer.json.hhvm' => 2, | |
| 'masonry.php' => 2, | |
| 'softdeletebehavior.php' => 2, | |
| 'privacy' => 2, | |
| 'phpstd' => 2, | |
| 'senchalogo.png' => 2, | |
| 'fullcalendarevent.php' => 2, | |
| 'vvv-init.sh' => 2, | |
| 'vvv-nginx.conf' => 2, | |
| 'singletontrait.php' => 2, | |
| 'notywidget.php' => 2, | |
| 'syliustranslationbundle.php' => 2, | |
| 'ui.js' => 2, | |
| '.platform.app.yaml' => 2, | |
| 'networkinginitcmsbundle.php' => 2, | |
| 'gearmanevents.php' => 2, | |
| 'gearmanmethods.php' => 2, | |
| 'componenttrait.php' => 2, | |
| 'tinymcepluginsasset.php' => 2, | |
| 'vvv-hosts' => 2, | |
| 'memcached.php' => 2, | |
| 'simplepdo.php' => 2, | |
| 'securityexception.php' => 2, | |
| 'securityevent.php' => 2, | |
| 'phpunit-skelgen' => 2, | |
| 'settings.json' => 2, | |
| 'logo-icon-64.png' => 2, | |
| 'newscoopingestpluginbundle.php' => 2, | |
| 'newscoopsolrsearchpluginbundle.php' => 2, | |
| 'onioninit.php' => 2, | |
| 'mongo.php' => 2, | |
| 'makephar.php' => 2, | |
| 'templateengineinterface.php' => 2, | |
| 'twitteroauthexception.php' => 2, | |
| 'ruckus.php' => 2, | |
| 'scabbia' => 2, | |
| 'loggable.php' => 2, | |
| 'bcccronmanagerbundle.php' => 2, | |
| 'tabularinput.php' => 2, | |
| 'config.xml.dist' => 2, | |
| 'text' => 2, | |
| 'paymentsaferpaybundle.php' => 2, | |
| 'ckeditorinline.php' => 2, | |
| 'varspoolpygmentsbundle.php' => 2, | |
| 'services.xml' => 2, | |
| 'skeleton.php' => 2, | |
| 'license-flask' => 2, | |
| 'buzzclient.php' => 2, | |
| 'nullclient.php' => 2, | |
| 'cpanel.php' => 2, | |
| 'pagelink.php' => 2, | |
| 'nullresponse.php' => 2, | |
| 'index-example.php' => 2, | |
| 'coding_standard' => 2, | |
| 'skud.php' => 2, | |
| 'phpspec.yml.coverage' => 2, | |
| 'configboilerplate.php' => 2, | |
| 'jarvis.php' => 2, | |
| 'helper.class.php' => 2, | |
| 'emt.php' => 2, | |
| 'breadcrumblist.php' => 2, | |
| 'sweetalert.php' => 2, | |
| 'setup.html' => 2, | |
| 'nomad_mimemail.es.doc.html' => 2, | |
| 'loggerexception.php' => 2, | |
| 'grid-shortcodes.php' => 2, | |
| 'documentproperties.php' => 2, | |
| 'calculation.php' => 2, | |
| 'cachedobjectstoragefactory.php' => 2, | |
| 'sluggablebehavior.php' => 2, | |
| 'company.php' => 2, | |
| 'minkbundle.php' => 2, | |
| 'timerasset.php' => 2, | |
| 'sursecuritybundle.php' => 2, | |
| 'dockerfile.sh' => 2, | |
| 'generate' => 2, | |
| 'migrant-cfg.php' => 2, | |
| 'config.ini.example' => 2, | |
| 'hashtable.php' => 2, | |
| 't.php' => 2, | |
| 'micro.php' => 2, | |
| 'configure' => 2, | |
| 'bugsnagbundle.php' => 2, | |
| 'olixadminbundle.php' => 2, | |
| 'thumbnail.png' => 2, | |
| 'filetypeguesser.php' => 2, | |
| 'syntax' => 2, | |
| 'weberrorhandler.php' => 2, | |
| 'seoviewbehavior.php' => 2, | |
| 'filetypeguesserinterface.php' => 2, | |
| 'sitemapcontroller.php' => 2, | |
| 'documentsecurity.php' => 2, | |
| 'icomparable.php' => 2, | |
| 'panelasset.php' => 2, | |
| 'sieve.php' => 2, | |
| '_project.properties' => 2, | |
| 'default.htaccess' => 2, | |
| 'php_functions.php' => 2, | |
| 'root.htaccess' => 2, | |
| 'fw.php' => 2, | |
| 'fileutil.php' => 2, | |
| 'stringutil.php' => 2, | |
| 'jsapipay.php' => 2, | |
| 'sandbox_setup.sh' => 2, | |
| 'sandbox_destroy.sh' => 2, | |
| 'instagramcomponent.php' => 2, | |
| 'embedjs.php' => 2, | |
| 'header' => 2, | |
| 'iofactory.php' => 2, | |
| 'angularresourceasset.php' => 2, | |
| 'expander.php' => 2, | |
| 'handsontable.php' => 2, | |
| 'handsontableasset.php' => 2, | |
| 'jaxlctl' => 2, | |
| 'jaxl.php' => 2, | |
| 'sitemapgenerator.php' => 2, | |
| 'worksheetiterator.php' => 2, | |
| 'worksheet.php' => 2, | |
| 'richtext.php' => 2, | |
| 'referencehelper.php' => 2, | |
| 'namedrange.php' => 2, | |
| 'liuggiorackspacecloudfilesbundle.php' => 2, | |
| 'backstretch.php' => 2, | |
| 'sismo.sh' => 2, | |
| 'sencha-touch-debug.js' => 2, | |
| 'chosenasset.php' => 2, | |
| 'graylogtarget.php' => 2, | |
| 'arrayobject.php' => 2, | |
| 'settings-example.php' => 2, | |
| 'rtxlabsdatatransformationbundle.php' => 2, | |
| 'ethna.php' => 2, | |
| 'redactorasset.php' => 2, | |
| 'nepalidatepickerasset.php' => 2, | |
| 'nepalidatepicker.php' => 2, | |
| 'index.consist.php' => 2, | |
| 'invoice.php' => 2, | |
| 'sencha-touch.js' => 2, | |
| 'sencha-touch-all.js' => 2, | |
| 'subsplit.sh' => 2, | |
| 'sencha-touch-all-debug.js' => 2, | |
| 'file-header' => 2, | |
| 'dd.sql' => 2, | |
| 'nprogressasset.php' => 2, | |
| 'rezzzabitterbundle.php' => 2, | |
| 'copying-lesser' => 2, | |
| 'plugin-update-checker.php' => 2, | |
| 'debug-bar-plugin.php' => 2, | |
| 'debug-bar-panel.php' => 2, | |
| 'database.sql' => 2, | |
| 'emutex.php' => 2, | |
| 'nomad_mimemail.en.doc.html' => 2, | |
| 'chosen.php' => 2, | |
| 'scrutinizr.yml' => 2, | |
| 'backstretchasset.php' => 2, | |
| 'fkrnominatimbundle.php' => 2, | |
| 'theme-my-login.css' => 2, | |
| 'sortableasset.php' => 2, | |
| 'oauthsignaturemethod_hmac_sha1.php' => 2, | |
| 'oauthsignaturemethod_plaintext.php' => 2, | |
| 'oauthsignaturemethod_rsa_sha1.php' => 2, | |
| 'seomodule.php' => 2, | |
| 'fsm.php' => 2, | |
| 'runtest.php' => 2, | |
| 'baffordpasswordstrengthbundle.php' => 2, | |
| 'jquerybundle.php' => 2, | |
| 'tagcachefactory.php' => 2, | |
| 'generate-website.sh' => 2, | |
| 'riperactivedirectorybundle.php' => 2, | |
| 'ewzuploaderbundle.php' => 2, | |
| 'do-source-release.sh' => 2, | |
| 'aria2.php' => 2, | |
| 'filesize.php' => 2, | |
| 'whmcs.php' => 2, | |
| 'cacheelement.php' => 2, | |
| 'zfdeploy.phar' => 2, | |
| 'sockettransport.class.php' => 2, | |
| 'smppclient.class.php' => 2, | |
| 'gsmencoder.class.php' => 2, | |
| 'jhgnexmobundle.php' => 2, | |
| 'jqwidgets.php' => 2, | |
| 'imagesloadedasset.php' => 2, | |
| 'seopresentation.php' => 2, | |
| 'seopresentationinterface.php' => 2, | |
| 'classutil.php' => 2, | |
| 'bazingapropeleventdispatcherbundle.php' => 2, | |
| 'smtpd.sublime-project' => 2, | |
| 'default.info' => 2, | |
| 'g' => 2, | |
| 'backup-restore.png' => 2, | |
| 'default.module' => 2, | |
| 'env.dist' => 2, | |
| 'masonry.yaml' => 2, | |
| 'dtcqueuebundle.php' => 2, | |
| 'iloader.php' => 2, | |
| 'froalaeditorasset.php' => 2, | |
| 'froalaeditorwidget.php' => 2, | |
| 'processcommunicationtrait.php' => 2, | |
| 'index.example.php' => 2, | |
| 'logentries.php' => 2, | |
| 'lelogger.php' => 2, | |
| 'processslave.php' => 2, | |
| 'authinterface.php' => 2, | |
| 'sonatadashboardbundle.php' => 2, | |
| 'uninstall' => 2, | |
| 'apcstore.php' => 2, | |
| 'arraystore.php' => 2, | |
| 'filestore.php' => 2, | |
| 'memcachedstore.php' => 2, | |
| 'nullstore.php' => 2, | |
| 'define.php' => 2, | |
| ' .travis.yml' => 2, | |
| 'behat.d8.drush.inc' => 2, | |
| 'mkdocs.php' => 2, | |
| 'onsitepaymentfactory.php' => 2, | |
| '.mondrian.yml' => 2, | |
| '.example.env' => 2, | |
| 'ganon.php' => 2, | |
| 'layout.tpl' => 2, | |
| 'coreutils.php' => 2, | |
| 'cypresstranslationbundle.php' => 2, | |
| 'install_libsmbclient.sh' => 2, | |
| 'petrovich.php' => 2, | |
| 'tinyrouter.php' => 2, | |
| 'sessions.php' => 2, | |
| 'showloadingasset.php' => 2, | |
| 'ekofeedbundle.php' => 2, | |
| 'chat.php' => 2, | |
| 'behat.d7.drush.inc' => 2, | |
| 'croncommand.php' => 2, | |
| 'xhprofcomponent.php' => 2, | |
| 'xhprofpanel.php' => 2, | |
| 'push-tags' => 2, | |
| 'subtree-split' => 2, | |
| 'datetimevalidator.php' => 2, | |
| 'concrete.json' => 2, | |
| 'bootstrap.test.php' => 2, | |
| 'cli.bat' => 2, | |
| 'behat-drush-common.inc' => 2, | |
| 'mailsender.php' => 2, | |
| 'theapicctvbundle.php' => 2, | |
| 'phpagi-fastagi.php' => 2, | |
| 'filelocator.php' => 2, | |
| 'index.js' => 2, | |
| 'resourcebundleinterface.php' => 2, | |
| 'querycountclient.php' => 2, | |
| 'syliuscontentbundle.php' => 2, | |
| 'syliusinventorybundle.php' => 2, | |
| 'liipfunctionaltestbundle.php' => 2, | |
| 'shortcuts.php' => 2, | |
| 'hydrator.php' => 2, | |
| 'require.js' => 2, | |
| 'run.ini' => 2, | |
| 'run.bat' => 2, | |
| 'html5-quick-template.html.php' => 2, | |
| 'syliusproductbundle.php' => 2, | |
| 'abstractresourcebundle.php' => 2, | |
| 'screen-copy.jpg' => 2, | |
| 'tmsolutiondatagridbundle.php' => 2, | |
| 'syliusresourcebundle.php' => 2, | |
| 'basetestcase.php' => 2, | |
| 'sidebar-footer.php' => 2, | |
| 'syliusthemebundle.php' => 2, | |
| 'decorator.php' => 2, | |
| 'voting.php' => 2, | |
| 'cybernoxamazonwebservicesbundle.php' => 2, | |
| 'phone.php' => 2, | |
| 'emadsdisplaywidget.php' => 2, | |
| 'emclientaction.php' => 2, | |
| 'integration' => 2, | |
| 'sftp-config.json' => 2, | |
| 'querycounter.php' => 2, | |
| 'savvyfilternatorbundle.php' => 2, | |
| 'pdodriver.php' => 2, | |
| 'config.tpl' => 2, | |
| 'exchangemanager.php' => 2, | |
| 'exchangerate.php' => 2, | |
| 'detectslostconnections.php' => 2, | |
| 'unknowncurrencyexception.php' => 2, | |
| 'php-cs-fixer.sh' => 2, | |
| 'host.php' => 2, | |
| 'supercluster.ini' => 2, | |
| 'ibrowssonatatranslationbundle.php' => 2, | |
| 'bitcoindbundle.php' => 2, | |
| 'monitoring.php' => 2, | |
| 'apc.php' => 2, | |
| 'phparray.php' => 2, | |
| 'plugin_update.php' => 2, | |
| 'syliuspromotionevents.php' => 2, | |
| 'plugin_info.php' => 2, | |
| 'sgkbarcodebundle.php' => 2, | |
| 'kalturaclient.php' => 2, | |
| 'kalturaclientbase.php' => 2, | |
| 'vagrant-bootstrap.sh' => 2, | |
| 'vagrantfile.example' => 2, | |
| 'kalturaenums.php' => 2, | |
| 'readerexception.php' => 2, | |
| 'kalturatypes.php' => 2, | |
| 'configurableinterface.php' => 2, | |
| 'codeclimate.json' => 2, | |
| 'splunk.php' => 2, | |
| 'posnetgercektest.php' => 2, | |
| 'demo.sh' => 2, | |
| 'ztreeasset.php' => 2, | |
| 'imageaction.php' => 2, | |
| 'copyscripts.sh' => 2, | |
| '.environment' => 2, | |
| 'javascriptunpacker.php' => 2, | |
| 'amorestapi.php' => 2, | |
| 'daemon' => 2, | |
| 'wampyasset.php' => 2, | |
| 'ragenotificationbundle.php' => 2, | |
| 'slikdompdfbundle.php' => 2, | |
| 'emailfactory.php' => 2, | |
| 'dompdf_config.custom.inc.php.dist' => 2, | |
| 'dompdf_config.inc.php.dist' => 2, | |
| 'config.sample.ini' => 2, | |
| 'pixsortablebehaviorbundle.php' => 2, | |
| 'matmtypeaheadbundle.php' => 2, | |
| 'selectizeasset.php' => 2, | |
| 'raulfraileladybugbundle.php' => 2, | |
| 'bccresquebundle.php' => 2, | |
| '.tm_properties' => 2, | |
| 'example-simple.php' => 2, | |
| 'commandbus.php' => 2, | |
| 'nginx.conf.sample' => 2, | |
| 'master' => 2, | |
| 'contextualbindingbuilder.php' => 2, | |
| 'class.javascriptpacker.php' => 2, | |
| 'ddeboerguzzlebundle.php' => 2, | |
| 'vxjsuploadbundle.php' => 2, | |
| 'vagrant' => 2, | |
| 'vagrant_bootstrap.sh' => 2, | |
| 'stop.php' => 2, | |
| 'ztree.php' => 2, | |
| 'vagrant.sh' => 2, | |
| 'configcache.php' => 2, | |
| 'cadvancedarbehavior.php' => 2, | |
| 'pasinteradmanagerbundle.php' => 2, | |
| 'gps.php' => 2, | |
| 'api.sh' => 2, | |
| 'tile-wide.png' => 2, | |
| 'dizdacloudbackupbundle.php' => 2, | |
| 'contributing_ru' => 2, | |
| 'gnugatwizardbundle.php' => 2, | |
| 'server' => 2, | |
| 'templateguesser.php' => 2, | |
| 'mailjetbundle.php' => 2, | |
| 'plancakeemailparser.php' => 2, | |
| 'escapewsseauthenticationbundle.php' => 2, | |
| 'travisphpconfig.ini' => 2, | |
| 'example.pdf' => 2, | |
| 'misdguzzlebundle.php' => 2, | |
| 'quality-report.sh' => 2, | |
| 'create-c.bat' => 2, | |
| 'anchor.php' => 2, | |
| 'global.inc.php.tpl' => 2, | |
| 'br.php' => 2, | |
| 'correios.php' => 2, | |
| 'en.php' => 2, | |
| 'xmppclient.php' => 2, | |
| 'room.php' => 2, | |
| 'schema.json' => 2, | |
| 'matchtype.php' => 2, | |
| 'classconvertor.php' => 2, | |
| 'inventory.php' => 2, | |
| 'universiboshibbolethbundle.php' => 2, | |
| 'ordering.php' => 2, | |
| 'regulation.php' => 2, | |
| 'lexikmaintenancebundle.php' => 2, | |
| 'validationresult.php' => 2, | |
| 'phonenumbertype.php' => 2, | |
| 'phonenumberformat.php' => 2, | |
| 'phonenumberdesc.php' => 2, | |
| 'numberformat.php' => 2, | |
| 'license_ru' => 2, | |
| 'phpunit.int.xml' => 2, | |
| 'dummy.php' => 2, | |
| 'countrycodesource.php' => 2, | |
| 'id.php' => 2, | |
| 'sparkcentralpsredisbundle.php' => 2, | |
| 'filemanagerasset.php' => 2, | |
| 'config.example.yml' => 2, | |
| 'widopgoogleanalyticsbundle.php' => 2, | |
| '.travis_after_script.sh' => 2, | |
| 'mailerevents.php' => 2, | |
| 'import.html' => 2, | |
| 'xsl.ini' => 2, | |
| 'editor.html' => 2, | |
| 'abstractbundle.php' => 2, | |
| 'ddrgitkibundle.php' => 2, | |
| 'cdrs.php' => 2, | |
| 'jid.php' => 2, | |
| 'aaa' => 2, | |
| 'result' => 2, | |
| 'doctrineoxmbundle.php' => 2, | |
| 'tests_bootstrap.php' => 2, | |
| 'phpunit-all.xml' => 2, | |
| 'corebundle.php' => 2, | |
| 'copyright & license' => 2, | |
| 'columns.php' => 2, | |
| 'propertyaccessor.php' => 2, | |
| 'openstack_queues.services.yml' => 2, | |
| 'configservice.php' => 2, | |
| 'openstack_queues.routing.yml' => 2, | |
| 'openstack_queues.links.menu.yml' => 2, | |
| 'vagrant.yml' => 2, | |
| 'example-admin.php' => 2, | |
| 'ban.php' => 2, | |
| 'opensearch.php' => 2, | |
| 'databaseservice.php' => 2, | |
| 'games.php' => 2, | |
| 'smoketest.php' => 2, | |
| 'vlabsmediabundle.php' => 2, | |
| 'relationtrait.php' => 2, | |
| 'baseevent.php' => 2, | |
| 'extendedbehavior.php' => 2, | |
| 'submit.php' => 2, | |
| 'tablebuilder.php' => 2, | |
| 'wordpress-plugin.php' => 2, | |
| 'rudrax.php' => 2, | |
| 'xcacheclassloader.php' => 2, | |
| 'jsonldserializable.php' => 2, | |
| 'geonamesimportevents.php' => 2, | |
| 'pacewidget.php' => 2, | |
| 'sequencejs.php' => 2, | |
| 'nivoslider.php' => 2, | |
| 'server.sh' => 2, | |
| 'mongodb.php' => 2, | |
| 'redisclass.php' => 2, | |
| 'image_driver.php' => 2, | |
| 'cimagecomponent.php' => 2, | |
| 'imageattachmentwidget.php' => 2, | |
| 'imageattachmentbehavior.php' => 2, | |
| 'imageattachmentaction.php' => 2, | |
| 'giosh94mhzgeonamesbundle.php' => 2, | |
| 'websocket.php' => 2, | |
| 'b.php' => 2, | |
| 'ros.jpg' => 2, | |
| 'webshop-shopping-basket.iml' => 2, | |
| 'bridge.php' => 2, | |
| 'authserver.php' => 2, | |
| 'phpmailer.php' => 2, | |
| 'sessionhandlerinterface.php' => 2, | |
| 'consolemodule.php' => 2, | |
| 'upgrade from 1.1.x rc3' => 2, | |
| 'mit' => 2, | |
| 'logging.php' => 2, | |
| 'phpunit.build.xml' => 2, | |
| 'ayuco' => 2, | |
| 'criteria.php' => 2, | |
| 'phpmetrics.js' => 2, | |
| 'strategy.php' => 2, | |
| 'qiniu.php' => 2, | |
| 'readme 2' => 2, | |
| 'mustachejsasset.php' => 2, | |
| 'twitterbootstrapbundle.php' => 2, | |
| 'etcpasswdoauthbundle.php' => 2, | |
| 'jquerypaymentasset.php' => 2, | |
| 'db_create.php' => 2, | |
| 'spec.yml' => 2, | |
| 'todo.fr' => 2, | |
| 'homeslide.php' => 2, | |
| 'ajax_homeslider.php' => 2, | |
| 'html5sortableasset.php' => 2, | |
| 'loggerawareinterface.php' => 2, | |
| 'mandangobundle.php' => 2, | |
| 'wp-stage-switcher.php' => 2, | |
| 'htmldiff.php' => 2, | |
| 'chartjs.php' => 2, | |
| 'chartjsasset.php' => 2, | |
| 'commithook.xml' => 2, | |
| 'users.sql' => 2, | |
| 'test.sqlite' => 2, | |
| 'comparator.php' => 2, | |
| 'custom.php' => 2, | |
| 'count.php' => 2, | |
| 'commander.php' => 2, | |
| 'callbackcommand.php' => 2, | |
| 'googlecodeprettifyasset.php' => 2, | |
| '.phpmetrics.yml' => 2, | |
| 'subscriberinterface.php' => 2, | |
| '.travis-behat.yml' => 2, | |
| 'googleanalytics.php' => 2, | |
| '.floo' => 2, | |
| 'common-words-cs_cz.php' => 2, | |
| 'common-words-de_de.php' => 2, | |
| 'common-words-en_gb.php' => 2, | |
| 'templates.php' => 2, | |
| 'builderinterface.php' => 2, | |
| 'pages.json' => 2, | |
| 'plans' => 2, | |
| 'index.html.php' => 2, | |
| 'swagger.php' => 2, | |
| 'dbcommand.php' => 2, | |
| 'mcapi.php' => 2, | |
| '.travis-phpspec.yml' => 2, | |
| 'simditor.php' => 2, | |
| 'simditorasset.php' => 2, | |
| 'indexschema.php' => 2, | |
| 'taggablebehavior.php' => 2, | |
| 'smxsimplemeetings.php' => 2, | |
| 'directivegroup.php' => 2, | |
| 'serviceinterface.php' => 2, | |
| 'i.php' => 2, | |
| 'sample.gif' => 2, | |
| 'directivecollection.php' => 2, | |
| 'backlog' => 2, | |
| 'blueprint.php' => 2, | |
| 'readme_ja' => 2, | |
| 'twitter_result.data' => 2, | |
| 'eclientscript.php' => 2, | |
| 'example.gitignore' => 2, | |
| 'license.gpl' => 2, | |
| 'sbbcodeparser.php' => 2, | |
| 'nbbc.php' => 2, | |
| 'psr4classloader.php' => 2, | |
| 'diff.php' => 2, | |
| 'phpunit.fixtures.xml' => 2, | |
| 'loader.class.php' => 2, | |
| 'colourstreamcronbundle.php' => 2, | |
| 'ieasset.php' => 2, | |
| 'algoliaalgoliasearchbundle.php' => 2, | |
| 'jsminplus.php' => 2, | |
| 'firephptarget.php' => 2, | |
| 'dailymotion.php' => 2, | |
| 'license_german' => 2, | |
| 'sbkcronbundle.php' => 2, | |
| 'postmanbundle.php' => 2, | |
| 'picture.jpg' => 2, | |
| 'phpredisbundle.php' => 2, | |
| 'composer.json.update' => 2, | |
| 'wishlist' => 2, | |
| 'slides.pdf' => 2, | |
| 'upload.js' => 2, | |
| 'hybridxmlparser.php' => 2, | |
| 'sample_domain.php' => 2, | |
| 'sphpdox.php' => 2, | |
| 'activejob.php' => 2, | |
| '_version' => 2, | |
| 'nucleus.json' => 2, | |
| 'fileutils.php' => 2, | |
| 'fixturecontroller.php' => 2, | |
| 'lyracontentbundle.php' => 2, | |
| 'jbconfigknpmenubundle.php' => 2, | |
| 'mrafalkocommandrunnerbundle.php' => 2, | |
| 'delete.gif' => 2, | |
| 'add.png' => 2, | |
| 'neutronformbundle.php' => 2, | |
| 'neutrondatagridbundle.php' => 2, | |
| 'rendererinterface.php' => 2, | |
| '.insight.yml' => 2, | |
| 'shopware.php' => 2, | |
| 'phpspec.build.yml' => 2, | |
| 'basepage.php' => 2, | |
| 'multiinput.php' => 2, | |
| 'qandidatetogglebundle.php' => 2, | |
| 'qcubed.inc.php' => 2, | |
| 'idna_convert.class.php' => 2, | |
| 'verification.php' => 2, | |
| 'transcode_wrapper.php' => 2, | |
| 'uctc.php' => 2, | |
| 'limitations' => 2, | |
| '.pharpiler.yml' => 2, | |
| 'berriartsitemapbundle.php' => 2, | |
| 'bootstrap-config.json' => 2, | |
| 'installer.sh' => 2, | |
| 'doctrine.php' => 2, | |
| 'autounit.rb' => 2, | |
| 'class.contextioresponse.php' => 2, | |
| 'quad.php' => 2, | |
| 'intl.php' => 2, | |
| 'languagetaggedstring.php' => 2, | |
| 'nquads.php' => 2, | |
| 'de.php' => 2, | |
| 'nodeinterface.php' => 2, | |
| 'wizard.php' => 2, | |
| 'snowcapmailjetbundle.php' => 2, | |
| 'category-tree-branch.tpl' => 2, | |
| 'sort_alphabet.png' => 2, | |
| 'sort_number.png' => 2, | |
| 'compass.inc.php' => 2, | |
| 'phpunithelper.php' => 2, | |
| 'sortablebehavior.php' => 2, | |
| 'doap.rdf' => 2, | |
| 'schema.class.php' => 2, | |
| 'quadparserinterface.php' => 2, | |
| 'makedatadefs.php' => 2, | |
| 'quadserializerinterface.php' => 2, | |
| 'rdfconstants.php' => 2, | |
| 'remotedocument.php' => 2, | |
| 'apidoc' => 2, | |
| 'iauth.php' => 2, | |
| 'typedvalue.php' => 2, | |
| 'apidoc.bat' => 2, | |
| 'fixtures.php' => 2, | |
| 'baidu.php' => 2, | |
| 'class.contextio.php' => 2, | |
| 'messentesms.php' => 2, | |
| 'requestcontext.php' => 2, | |
| 'eguliasquizbundle.php' => 2, | |
| '.composer.json' => 2, | |
| 'draggable.php' => 2, | |
| 'dumpermanager.php' => 2, | |
| 'droppable.php' => 2, | |
| 'bazingageocoderbundle.php' => 2, | |
| 'provisioning.sh' => 2, | |
| 'craueformflowbundle.php' => 2, | |
| 'resizable.php' => 2, | |
| 'crauetwigextensionsbundle.php' => 2, | |
| 'neo4jogmbundle.php' => 2, | |
| 'sliderinput.php' => 2, | |
| 'cheque.php' => 2, | |
| 'cronjobs.php' => 2, | |
| 'catus.php' => 2, | |
| 'rukbatbitlybundle.php' => 2, | |
| 'upgrade-1.0.1' => 2, | |
| 'calculate.php' => 2, | |
| 'resources' => 2, | |
| 'nelmiosolariumbundle.php' => 2, | |
| 'clientregistry.php' => 2, | |
| 'yiiphealng.php' => 2, | |
| 'testsuite.phar' => 2, | |
| 'emformwidget.php' => 2, | |
| 'ekinonewrelicbundle.php' => 2, | |
| 'ghangelog' => 2, | |
| 'pinocchio.json' => 2, | |
| 'usersbundle.php' => 2, | |
| 'felis.php' => 2, | |
| 'mediamanager.php' => 2, | |
| 'common.default.properties' => 2, | |
| 'oauthsimple-license' => 2, | |
| 'arc2_graph.php' => 2, | |
| 'description.php' => 2, | |
| 'settingsmodel.php' => 2, | |
| 'baikalrestbundle.php' => 2, | |
| 'passwordhash.php' => 2, | |
| 'extendeddatetimeformattingbehavior.php' => 2, | |
| 'whois.servers.json' => 2, | |
| 'whois.php' => 2, | |
| 'readme.old' => 2, | |
| '.env-dist' => 2, | |
| 'config.example' => 2, | |
| 'leiame.json' => 2, | |
| 'lm2php.php' => 2, | |
| 'dropdownasset.php' => 2, | |
| 'core_routes.php' => 2, | |
| '_.htaccess.example' => 2, | |
| 'lktwigstringbundle.php' => 2, | |
| 'security-checker' => 2, | |
| 'menutoplinks.class.php' => 2, | |
| 'jqgridwidget.php' => 2, | |
| 'jqgridasset.php' => 2, | |
| 'swoole.php' => 2, | |
| 'engineinterface.php' => 2, | |
| 'n98-magerun.phar' => 2, | |
| 'twigbundle.php' => 2, | |
| 'clienttest.php' => 2, | |
| 'render_public_folders.php' => 2, | |
| 'universalclassloader.php' => 2, | |
| 'index_treemenu.php' => 2, | |
| 'release_notes-1.0' => 2, | |
| 'webprofilerserviceprovider.php' => 2, | |
| 'serializerserviceprovider.php' => 2, | |
| 'webdav.php' => 2, | |
| 'release_notes-0.9' => 2, | |
| 'release_notes-0.11' => 2, | |
| 'release_notes-0.10' => 2, | |
| 'license-unicode_cldr' => 2, | |
| 'license-schematron' => 2, | |
| 'runcronjobs.php' => 2, | |
| 'kickstart.ini-dist' => 2, | |
| 'index_rest.php' => 2, | |
| 'opengraphtest.php' => 2, | |
| 'index_cluster.php' => 2, | |
| 'ezpublish.cron' => 2, | |
| 'ezpm.php' => 2, | |
| 'config.php-recommended' => 2, | |
| '.htaccess_root' => 2, | |
| 'phpunit-integration-rest-xml.xml' => 2, | |
| 'license-icu' => 2, | |
| 'license-agavi' => 2, | |
| 'changelog-0.9' => 2, | |
| 'dcsformselectcityformfieldbundle.php' => 2, | |
| 'changelog-0.11' => 2, | |
| 'phpunit-integration-rest-json.xml' => 2, | |
| 'verify.php' => 2, | |
| 'agitcommonbundle.php' => 2, | |
| 'phpunit-functional-rest.xml' => 2, | |
| 'agitvalidationbundle.php' => 2, | |
| 'slideshow.php' => 2, | |
| 'screenshot-6.png' => 2, | |
| 'screenshot-5.png' => 2, | |
| 'example.xls' => 2, | |
| 'webclient_example.php' => 2, | |
| 'sendmessage_example.php' => 2, | |
| 'cli_longrun_example_bosh.php' => 2, | |
| 'migration_guide' => 2, | |
| 'cli_longrun_example.php' => 2, | |
| 'unicode.php' => 2, | |
| 'scan.php' => 2, | |
| 'internals' => 2, | |
| 'moduleadmin.php' => 2, | |
| 'solutioncodemirrorbundle.php' => 2, | |
| 'agitutilbundle.php' => 2, | |
| 'agituserbundle.php' => 2, | |
| 'staticfile' => 2, | |
| 'agituibundle.php' => 2, | |
| 'agitsettingbundle.php' => 2, | |
| 'agitpluggablebundle.php' => 2, | |
| 'agitlocaledatabundle.php' => 2, | |
| 'definition.json' => 2, | |
| 'build.properties.sample' => 2, | |
| 'agitintlbundle.php' => 2, | |
| 'agitcontactformbundle.php' => 2, | |
| 'config.yml.example' => 2, | |
| 'docgen.sh' => 2, | |
| 'changelog-0.10' => 2, | |
| 'aliconfig.php' => 2, | |
| 'pay.php' => 2, | |
| 'textconsole' => 2, | |
| 'responseformatter.php' => 2, | |
| 'fancytreewidget.php' => 2, | |
| 'liloconwechatbundle.php' => 2, | |
| 'fancytreeasset.php' => 2, | |
| 'progress' => 2, | |
| 'docblox.xml' => 2, | |
| 'uml.png' => 2, | |
| 'uml.mdj' => 2, | |
| '.magnum.yml' => 2, | |
| 'ewzsearchbundle.php' => 2, | |
| 'subscription.php' => 2, | |
| 'apcuniversalclassloader.php' => 2, | |
| 'jphp.json' => 2, | |
| 'composer-travis-ci.json' => 2, | |
| 'unicode-license' => 2, | |
| 'mailbuilder.php' => 2, | |
| 'menu.xml' => 2, | |
| 'httpresponse.php' => 2, | |
| 'test.class.php' => 2, | |
| 'typeresolver.php' => 2, | |
| 'debuguniversalclassloader.php' => 2, | |
| 'plainfilehandler.php' => 2, | |
| 'fetchdatafile.php' => 2, | |
| 'excelfilehandler.php' => 2, | |
| 'errorexception.php' => 2, | |
| 'zf.php' => 2, | |
| 'creator.php' => 2, | |
| 'api_changelog' => 2, | |
| 'license-gplv3' => 2, | |
| 'bisect_phpunit.sh' => 2, | |
| 'processevent.php' => 2, | |
| 'logevent.php' => 2, | |
| 'urlizer.php' => 2, | |
| 'paradigmaimagebundle.php' => 2, | |
| 'ferrandinitwigextensionbundle.php' => 2, | |
| 'test-coverage.sh' => 2, | |
| 'behat_suites.yml' => 2, | |
| 'respondasset.php' => 2, | |
| 'html5shivasset.php' => 2, | |
| 'googletagmanager.php' => 2, | |
| 'broker.php' => 2, | |
| 'line.php' => 2, | |
| 'wufooapiexamples.php' => 2, | |
| 'adesignscalendarbundle.php' => 2, | |
| 'social' => 2, | |
| 'sfkemailtemplatebundle.php' => 2, | |
| 'jenkins.yaml' => 2, | |
| 'liipmagentobundle.php' => 2, | |
| 'magento-autoloader.patch' => 2, | |
| 'skonsoftcveditorbundle.php' => 2, | |
| 'sender.php' => 2, | |
| 'streamable.php' => 2, | |
| 'serverrequest.php' => 2, | |
| 'metric.php' => 2, | |
| 'test.json' => 2, | |
| 'textsmser.php' => 2, | |
| 'r' => 2, | |
| 'javascript.js' => 2, | |
| 'sonatanewsbundle.php' => 2, | |
| 'subscribe.php' => 2, | |
| 'subscribe.mail.tpl' => 2, | |
| 'subscribe.layer.json' => 2, | |
| 'sonatacachebundle.php' => 2, | |
| 'sonataclassificationbundle.php' => 2, | |
| 'simplecomment.php' => 2, | |
| 'seo.ext.php' => 2, | |
| 'sonatacommentbundle.php' => 2, | |
| '.fix_stability.php' => 2, | |
| 'sonatadoctrinephpcradminbundle.php' => 2, | |
| 'left.php' => 2, | |
| 'list.php' => 2, | |
| 'basket_delete.png' => 2, | |
| 'sonatanotificationbundle.php' => 2, | |
| 'sonataseobundle.php' => 2, | |
| 'sonatatimelinebundle.php' => 2, | |
| 'spytimelinebundle.php' => 2, | |
| 'sources.mk' => 2, | |
| 'make-phar.php' => 2, | |
| 'make-loader.php' => 2, | |
| 'mopabootstrapsandboxbundle.php' => 2, | |
| 'seojson.php' => 2, | |
| 'config.mk' => 2, | |
| 'parsecsv.lib.php' => 2, | |
| 'readme3' => 2, | |
| 'page_edit.png' => 2, | |
| 'application_home.png' => 2, | |
| 'readme5' => 2, | |
| 'grade.php' => 2, | |
| 'phpunit-no-cc.xml.dist' => 2, | |
| 'liquibase.jar' => 2, | |
| 'liquibase' => 2, | |
| 'decisions.php' => 2, | |
| 'interval.php' => 2, | |
| 'signed' => 2, | |
| 'picofeed' => 2, | |
| 'config.html' => 2, | |
| 'module.xml' => 2, | |
| 'dump.php' => 2, | |
| 'yiilite.php' => 2, | |
| 'yii-powered.png' => 2, | |
| 'yiibase.php' => 2, | |
| 'googleadsense.php' => 2, | |
| 'commit.php' => 2, | |
| 'frequencewebcontactbundle.php' => 2, | |
| 'readme.de' => 2, | |
| 'reset.php' => 2, | |
| 'filebag.php' => 2, | |
| 'yml.tpl' => 2, | |
| 'yml.php' => 2, | |
| 'rzcontactbundle.php' => 2, | |
| 'contenttypes.php' => 2, | |
| 'smartybc.class.php' => 2, | |
| 'timezone.js' => 2, | |
| 'subscribe.tpl' => 2, | |
| 'readme4' => 2, | |
| '.providence' => 2, | |
| 'entities_generator.php' => 2, | |
| 'datepickerredblackthemeasset.php' => 2, | |
| 'evariojanrainbundle.php' => 2, | |
| 'readme-kr' => 2, | |
| 'bootstrap_test.php' => 2, | |
| 'phpspec.yaml' => 2, | |
| 'personaltranslationswidgetbundle.php' => 2, | |
| 'raindropsonatathemebundle.php' => 2, | |
| 'wavfile.php' => 2, | |
| 'db.sh' => 2, | |
| 'filemakervalidationexception.php' => 2, | |
| 'filemakerexception.php' => 2, | |
| 'piechart.php' => 2, | |
| 'nestedsetsbehavior.php' => 2, | |
| 'datepickerdarkthemeasset.php' => 2, | |
| 'resource.php' => 2, | |
| 'barchart.php' => 2, | |
| 'datepickercheerupthemeasset.php' => 2, | |
| 'datepickerbluethemeasset.php' => 2, | |
| 'dateasset.php' => 2, | |
| 'vkphpsdk.jpg' => 2, | |
| 'resqueautoloader.php' => 2, | |
| 'mongodatebehavior.php' => 2, | |
| 'initialize.php' => 2, | |
| 'tinymceassets.php' => 2, | |
| 'configuration.json.example' => 2, | |
| 'activerecordtrait.php' => 2, | |
| 'visitor.php' => 2, | |
| 'phpmanager.php' => 2, | |
| 'pipelineexception.php' => 2, | |
| 'robertotrutoinlinestyleemailbundle.php' => 2, | |
| 'localehttprequest.php' => 2, | |
| 'formfieldregistry.php' => 2, | |
| 'genericevent.php' => 2, | |
| 'license.gpl2' => 2, | |
| 'docx.php' => 2, | |
| 'mail.tpl' => 2, | |
| 'authorization.php' => 2, | |
| 'test.jpg' => 2, | |
| 'vipxbotdetectbundle.php' => 2, | |
| 'methodinvoker.php' => 2, | |
| 'gridsterasset.php' => 2, | |
| 'gridster.php' => 2, | |
| 'localeurlmanager.php' => 2, | |
| 'changelog-1.5' => 2, | |
| 'ormexception.php' => 2, | |
| 'changelog-1.4' => 2, | |
| 'license_sentinel' => 2, | |
| 'license_soa' => 2, | |
| 'phpspec-scrutinizer.yml' => 2, | |
| 'assetsautocompresscomponent.php' => 2, | |
| 'demo-sqlite.php' => 2, | |
| 'variantgroupdataprovider.php' => 2, | |
| 'pimdatageneratorbundle.php' => 2, | |
| 'pimcustomentitybundle.php' => 2, | |
| 'provider.php' => 2, | |
| 'routing.yml.dist' => 2, | |
| 'asana.php' => 2, | |
| 'openstack_queues.info.yml' => 2, | |
| 'dm.sql' => 2, | |
| 'eventlistenerinterface.php' => 2, | |
| 'pull.bat' => 2, | |
| 'samples-generator.php' => 2, | |
| 'review-1.0' => 2, | |
| 'ajax-loader.gif' => 2, | |
| 'constructor.php' => 2, | |
| 'phpdoc.xml.dist' => 2, | |
| 'parametersescaper.php' => 2, | |
| 'exercisegoogletranslatebundle.php' => 2, | |
| 'paris.php' => 2, | |
| 'consoleapplication.php' => 2, | |
| 'test_bootstrap.php' => 2, | |
| 'echo.php' => 2, | |
| 'travis-tests.sh' => 2, | |
| 'psurface.php' => 2, | |
| 'puzzles' => 2, | |
| 'push.bat' => 2, | |
| 'topic.php' => 2, | |
| 'jqueryeasingasset.php' => 2, | |
| '.rultor.yml' => 2, | |
| 'wp-media-categories.php' => 2, | |
| 'pstock.php' => 2, | |
| 'harness.example.php' => 2, | |
| 'restapi.php' => 2, | |
| 'alchemyapi.php' => 2, | |
| 'routeprovider.php' => 2, | |
| 'namespace.sh' => 2, | |
| 'login.html' => 2, | |
| 'sncredisbundle.php' => 2, | |
| 'pspring.php' => 2, | |
| 'rss.xml' => 2, | |
| 'psplit.php' => 2, | |
| 'sample-tpl.php' => 2, | |
| 'frontbundle.php' => 2, | |
| 'initialise.php' => 2, | |
| 'wsdlclassfiletpl.php' => 2, | |
| 'runserver.sh' => 2, | |
| 'tags.sh' => 2, | |
| 'jquery.php' => 2, | |
| 'fonts.php' => 2, | |
| 'index.php~' => 2, | |
| 'phpquery.php' => 2, | |
| 'datagridexception.php' => 2, | |
| 'generate_readme' => 2, | |
| 'httputils.php' => 2, | |
| 'basenumber.php' => 2, | |
| 'testbild.jpg' => 2, | |
| 'baseip.php' => 2, | |
| 'description.html' => 2, | |
| 'misc.php' => 2, | |
| 'hooks' => 2, | |
| 'wsdltophpstructvalue.php' => 2, | |
| 'odoo.php' => 2, | |
| 'todo-list' => 2, | |
| 'basegravatar.php' => 2, | |
| 'wsdltophpfunction.php' => 2, | |
| 'wsdltophpgenerator.php' => 2, | |
| 'aa' => 2, | |
| 'mimetypes.php' => 2, | |
| 'yiiwhoopsrunner.php' => 2, | |
| 'bundleinterface.php' => 2, | |
| 'wsdltophpmodel.php' => 2, | |
| 'cryptastic.class.php' => 2, | |
| 'wsdltophpservice.php' => 2, | |
| 'wsdltophpstruct.php' => 2, | |
| 'wsdltophpstructattribute.php' => 2, | |
| 'commit' => 2, | |
| 'pscatter.php' => 2, | |
| 'whoopserrorhandler.php' => 2, | |
| 'license.apache2' => 2, | |
| 'pimage.php' => 2, | |
| 'pdraw.php' => 2, | |
| 'shortlog' => 2, | |
| 'iri.php' => 2, | |
| 'validators.php' => 2, | |
| 'deployment.xml' => 2, | |
| 'pdata.php' => 2, | |
| 'fmbbcodebundle.php' => 2, | |
| 'fmelfinderbundle.php' => 2, | |
| 'desktop.php' => 2, | |
| 'pcache.php' => 2, | |
| 'appbundle.php' => 2, | |
| 'elaomcemediabundle.php' => 2, | |
| 'pbubble.php' => 2, | |
| 'mongohelper.php' => 2, | |
| 'interfaces.php' => 2, | |
| 'redissessionhandlerbundle.php' => 2, | |
| 'pbarcode39.php' => 2, | |
| 'publisher.php' => 2, | |
| 'module.config.php' => 2, | |
| 'decode.php' => 2, | |
| 'all.php' => 2, | |
| 'pbarcode128.php' => 2, | |
| 'basebucket.php' => 2, | |
| 'tor.php' => 2, | |
| 'drupal-org.make' => 2, | |
| 'bucketinterface.php' => 2, | |
| 'bucketsubdirtemplate.php' => 2, | |
| 'relativepath.php' => 2, | |
| 'gnu lesser general public license v2.1 - gnu project - free software foundation.html' => 2, | |
| 'pindicator.php' => 2, | |
| 'uspszipcodelookup.php' => 2, | |
| 'exceldatareader.php' => 2, | |
| 'uspsaddress.php' => 2, | |
| 'hook.php' => 2, | |
| 'mailtankclient.php' => 2, | |
| 'phpqa.yml' => 2, | |
| 'exceldatawriter.php' => 2, | |
| 'slacktarget.php' => 2, | |
| 'exceltemplatewriter.php' => 2, | |
| '.rubocop.yml' => 2, | |
| 'docdatapayments.php' => 2, | |
| 'endroidgcmbundle.php' => 2, | |
| '.scrutinitzer.yml' => 2, | |
| 'mailtankexception.php' => 2, | |
| '.rubocop_todo.yml' => 2, | |
| 'external.php' => 2, | |
| 'usps-php-api.iml' => 2, | |
| 'uspsaddressverify.php' => 2, | |
| 'ppie.php' => 2, | |
| 'uspscitystatelookup.php' => 2, | |
| 'uspstrackconfirm.php' => 2, | |
| 'test.js' => 2, | |
| 'version.js' => 2, | |
| 'error.png' => 2, | |
| 'posttype.php' => 2, | |
| 'uspsrate.php' => 2, | |
| 'index_dev.php' => 2, | |
| 'old_readme' => 2, | |
| 'readme-2.png' => 2, | |
| 'koala-config.json' => 2, | |
| 'pradar.php' => 2, | |
| 'readme-1.png' => 2, | |
| 'uspsbase.php' => 2, | |
| 'iats.php' => 2, | |
| 'commentmodule.php' => 2, | |
| 'file' => 2, | |
| 'containeraware.php' => 2, | |
| 'config-manager.php' => 2, | |
| 'content-video.php' => 2, | |
| 'contactevents.php' => 2, | |
| 'mremicontactbundle.php' => 2, | |
| 'acf-qtranslate.php' => 2, | |
| 'taxonomy-post_format.php' => 2, | |
| 'uploadcare-php' => 2, | |
| 'arrowdown.png' => 2, | |
| 'arrowup.png' => 2, | |
| 'entityfactory.php' => 2, | |
| 'transportinterface.php' => 2, | |
| 'tokenable.php' => 2, | |
| 'description.json' => 2, | |
| 'opensearch.xml' => 2, | |
| 'chosenselect.php' => 2, | |
| 'servergrovetranslationeditorbundle.php' => 2, | |
| 'license-lgpl3' => 2, | |
| 'chosenselectasset.php' => 2, | |
| 'fragment.php' => 2, | |
| 'checkbox.php' => 2, | |
| 'credentials.php.dist' => 2, | |
| 'jobs.sql' => 2, | |
| 'notificationevent.php' => 2, | |
| 'mongostoragemanager.php' => 2, | |
| 'luneticslocalebundle.php' => 2, | |
| 'reflectionclass.php' => 2, | |
| 'dictionary.php' => 2, | |
| 'credentials.yml.dist' => 2, | |
| 'adodb-active-record.inc.php' => 2, | |
| 'adodb-active-recordx.inc.php' => 2, | |
| 'adodb-csvlib.inc.php' => 2, | |
| 'pmmodule.php' => 2, | |
| 'license-gpl2' => 2, | |
| 'sequence.php' => 2, | |
| 'types.php' => 2, | |
| 'bigfootcorebundle.php' => 2, | |
| 'bigfootmediabundle.php' => 2, | |
| 'rsapublic.php' => 2, | |
| 'bigfootnavigationbundle.php' => 2, | |
| 'paginatorinterface.php' => 2, | |
| 'factual.php' => 2, | |
| 'bigfootuserbundle.php' => 2, | |
| 'limit.php' => 2, | |
| 'rsaprivate.php' => 2, | |
| 'messages.yml' => 2, | |
| 'guzzlebundle.php' => 2, | |
| 'table.sql' => 2, | |
| 'fcrnmodule.php' => 2, | |
| 'httpresourceinterface.php' => 2, | |
| 'mosquitto.php' => 2, | |
| 'content-quote.php' => 2, | |
| 'vcard.php' => 2, | |
| 'jqplotwidget.php' => 2, | |
| 'content-image.php' => 2, | |
| 'bump-ver' => 2, | |
| 'editablesaver.php' => 2, | |
| 'cronserviceprovider.php' => 2, | |
| 'content-gallery.php' => 2, | |
| 'content-audio.php' => 2, | |
| 'pgsql.php' => 2, | |
| 'content-aside.php' => 2, | |
| 'author-bio.php' => 2, | |
| 'gravatarserviceprovider.php' => 2, | |
| 'editablefield.php' => 2, | |
| 'editabledetailview.php' => 2, | |
| 'editableconfig.php' => 2, | |
| 'adodb-datadict.inc.php' => 2, | |
| 'simplethingsformserializerbundle.php' => 2, | |
| 'metadata.json' => 2, | |
| 'bootstrap' => 2, | |
| 'studio.json' => 2, | |
| 'ftpwidget.php' => 2, | |
| 'msg-config.php' => 2, | |
| 'fineuploader.php' => 2, | |
| 'fineuploaderasset.php' => 2, | |
| '.scruntinizer.yml' => 2, | |
| 'phonevalidator.php' => 2, | |
| 'example.composer.php' => 2, | |
| 'codegen.json' => 2, | |
| 'meter.php' => 2, | |
| 'gayaphpbbencoderbundle.php' => 2, | |
| 'timthumb.php' => 2, | |
| 'evercookie.php' => 2, | |
| 'piwik.php' => 2, | |
| 'klogger.php' => 2, | |
| 'contextmanager.php' => 2, | |
| 'madmimi.class.php' => 2, | |
| 'spyc.class.php' => 2, | |
| 'solder' => 2, | |
| 'docgen' => 2, | |
| 'phpunit.hhvm.xml.dist' => 2, | |
| 'dbconnect.php' => 2, | |
| 'koharness' => 2, | |
| 'tbs_plugin_opentbs.php' => 2, | |
| 'config.ini.sample' => 2, | |
| '.env.dev' => 2, | |
| 'tbs_class.php' => 2, | |
| 'thorfile' => 2, | |
| 'berksfile' => 2, | |
| 'slide.php' => 2, | |
| 'ftputils.php' => 2, | |
| 'removeaction.php' => 2, | |
| 'objectstorage.php' => 2, | |
| 'funstafftikabundle.php' => 2, | |
| 'adodb-error.inc.php' => 2, | |
| 'adodb-errorhandler.inc.php' => 2, | |
| 'name.php' => 2, | |
| 'adodb-errorpear.inc.php' => 2, | |
| 'adodb-exceptions.inc.php' => 2, | |
| 'adodb-iterator.inc.php' => 2, | |
| 'adodb-lib.inc.php' => 2, | |
| 'directoryinterface.php' => 2, | |
| 'adodb-memcache.lib.inc.php' => 2, | |
| 'adodb-pager.inc.php' => 2, | |
| 'adodb-pear.inc.php' => 2, | |
| 'adodb-perf.inc.php' => 2, | |
| 'adodb-php4.inc.php' => 2, | |
| 'adodb-time.inc.php' => 2, | |
| 'adodb-xmlschema.inc.php' => 2, | |
| 'ftpparser.php' => 2, | |
| 'tohtml.inc.php' => 2, | |
| 'ftpfile.php' => 2, | |
| 'ftpcomponent.php' => 2, | |
| 'cpfvalidator.php' => 2, | |
| 'xmlschema03.dtd' => 2, | |
| 'xmlschema.dtd' => 2, | |
| 'cnpjvalidator.php' => 2, | |
| 'frameworkbundle.php' => 2, | |
| 'helloworld' => 2, | |
| 'toexport.inc.php' => 2, | |
| 'rsfilter.inc.php' => 2, | |
| 'pivottable.inc.php' => 2, | |
| 'adodb.inc.php' => 2, | |
| 'license~' => 2, | |
| 'adodb-xmlschema03.inc.php' => 2, | |
| 'todo.php' => 2, | |
| 'builder.sh' => 2, | |
| 'bigfootcontextbundle.php' => 2, | |
| 'iterator.php' => 2, | |
| 'phpunit.xml~' => 2, | |
| 'inlinewidgetsbehavior.php' => 2, | |
| 'favorites.php' => 2, | |
| 'glob.php' => 2, | |
| '403.html' => 2, | |
| 'example-config.json' => 2, | |
| 'ajaxsubmitbutton.php' => 2, | |
| 'viewserviceprovider.php' => 2, | |
| 'guzzleserviceprovider.php' => 2, | |
| 'txt.todo' => 2, | |
| 'filesessionhandler.php' => 2, | |
| 'changelog.rnd' => 2, | |
| 'markdown_extended.php' => 2, | |
| 'atlassian-ide-plugin.xml' => 2, | |
| '.coveragerc' => 2, | |
| 'registry.hh' => 2, | |
| 'git_hooks' => 2, | |
| 'umeditorasset.php' => 2, | |
| 'querystring.php' => 2, | |
| 'umeditoraction.php' => 2, | |
| 'workflowbundle.php' => 2, | |
| 'umeditor.php' => 2, | |
| 'tox.ini' => 2, | |
| 'layerasset.php' => 2, | |
| 'query' => 2, | |
| '.phpmetrics.yml.dist' => 2, | |
| 'example.codeception.yml' => 2, | |
| 'example.codeception.dist.yml' => 2, | |
| 'drone.yml' => 2, | |
| 'themeserviceprovider.php' => 2, | |
| 'simplenode.php' => 2, | |
| 'databasesessionhandler.php' => 2, | |
| 'minnelli.php' => 2, | |
| 'm.php' => 2, | |
| 'batch.php' => 2, | |
| 'manual-init.php' => 2, | |
| 'readme-fr' => 2, | |
| 'screenshot2.png' => 2, | |
| 'readme-header.jpg' => 2, | |
| 'mathpublisher.php' => 2, | |
| 'install_ext.sh' => 2, | |
| 'extplorer.php' => 2, | |
| '.local.vimrc' => 2, | |
| 'phpunit-unit.xml' => 2, | |
| 'mark.php' => 2, | |
| 'memoize.php' => 2, | |
| 'openskyldapbundle.php' => 2, | |
| 'setup.json' => 2, | |
| 'elmo' => 2, | |
| 'reader.hh' => 2, | |
| 'ladder.php' => 2, | |
| 'edituser.php' => 2, | |
| 'ez_sql_help.htm' => 2, | |
| 'csrftoken.php' => 2, | |
| 'ez_sql_with_smarty.html' => 2, | |
| 'shibbolethbundle.php' => 2, | |
| 'smsgateway.php' => 2, | |
| 'shorten.php' => 2, | |
| 'lists.php' => 2, | |
| '500.php' => 2, | |
| 'responder.php' => 2, | |
| 'createqueryhelper.php' => 2, | |
| 'cookiesessionhandler.php' => 2, | |
| 'ipv4.php' => 2, | |
| 'guild.php' => 2, | |
| '.scruntizer.yml' => 2, | |
| 'filesystemexception.php' => 2, | |
| 'raw.php' => 2, | |
| 'build.user.xml' => 2, | |
| 'build.simpletest.xml' => 2, | |
| 'vfconfig.default.php' => 2, | |
| 'build.registry.xml' => 2, | |
| 'config.default.ini' => 2, | |
| 'build.install.xml' => 2, | |
| 'shared.php' => 2, | |
| 'build.files.xml' => 2, | |
| 'zoo.php' => 2, | |
| 'kachkaevassetsversionbundle.php' => 2, | |
| 'build.features.xml' => 2, | |
| '.build-readme' => 2, | |
| 'oembedfacade.php' => 2, | |
| 'build.database.xml' => 2, | |
| 'callqueuedhandler.php' => 2, | |
| 'assetsversionmanager.php' => 2, | |
| 'location.php' => 2, | |
| '.exclude' => 2, | |
| 'abstractmessage.php' => 2, | |
| 'temporary.php' => 2, | |
| 'gergelypolonkaismssenderbundle.php' => 2, | |
| 'domutils.php' => 2, | |
| 'material.php' => 2, | |
| 'vars.php' => 2, | |
| 'eventserviceprovider.php' => 2, | |
| 'accesstoken.php' => 2, | |
| 'console.bat' => 2, | |
| 'typeextensioninterface.php' => 2, | |
| 'build.cron.xml' => 2, | |
| 'abstractapi.php' => 2, | |
| 'icbasemailbundle.php' => 2, | |
| 'example.csv' => 2, | |
| 'dict.php' => 2, | |
| 'avalertifybundle.php' => 2, | |
| 'dbobject.php' => 2, | |
| 'ticker.php' => 2, | |
| 'mapiterator.php' => 2, | |
| 'parsercsv.php' => 2, | |
| 'net.php' => 2, | |
| 'namespace.php' => 2, | |
| 'discount.php' => 2, | |
| 'files.php' => 2, | |
| 'town.php' => 2, | |
| 'helloworld.xml' => 2, | |
| 'symlinker.php' => 2, | |
| 'pkg_content.xml' => 2, | |
| 'scurvy.php' => 2, | |
| 'pkg_finder.xml' => 2, | |
| 'artist.php' => 2, | |
| 'testdox' => 2, | |
| 'undefined.php' => 2, | |
| 'example.aliases.drushrc.php' => 2, | |
| 'stylesheet.css' => 2, | |
| 'mockplugin.php' => 2, | |
| 'messagebuilder.php' => 2, | |
| 'attribute.php' => 2, | |
| 'installer' => 2, | |
| 'facebookbundle.php' => 2, | |
| 'readme_confirm' => 2, | |
| 'streaminterface.php' => 2, | |
| 'box.phar' => 2, | |
| 'index.twig' => 2, | |
| 'requires.php' => 2, | |
| 'admin.tpl' => 2, | |
| 'pkg_media.xml' => 2, | |
| 'registrybundle.php' => 2, | |
| 'paginationbundle.php' => 2, | |
| 'icontainer.php' => 2, | |
| 'forgotpassword.php' => 2, | |
| 'pdowrapper.php' => 2, | |
| 'span.php' => 2, | |
| 'subdirective.php' => 2, | |
| 'httpkernel_example.php' => 2, | |
| 'datetimepickerwidget.php' => 2, | |
| 'multiimageasset.php' => 2, | |
| 'tex2png.php' => 2, | |
| 'repositoryinitializer.php' => 2, | |
| 'test_index.php' => 2, | |
| 'repositoryinitializerinterface.php' => 2, | |
| 'repositorymanager.php' => 2, | |
| 'dot.htaccess' => 2, | |
| '_heystack_subsystem' => 2, | |
| 'arrays.php' => 2, | |
| 'objectwrapper.php' => 2, | |
| 'translit.php' => 2, | |
| 'unit.bat' => 2, | |
| 'sensiyamlguibundle.php' => 2, | |
| '.thinframerc' => 2, | |
| 'composer.bat' => 2, | |
| 'venomfile' => 2, | |
| 'imagex.php' => 2, | |
| 'default.png' => 2, | |
| 'mopabootstrapbundle.php' => 2, | |
| 'bisonlabnoormbundle.php' => 2, | |
| 'xsolvebootstrapcrudbundle.php' => 2, | |
| 'log.class.php' => 2, | |
| 'bisonlabsugarcrmbundle.php' => 2, | |
| 'build.cache.xml' => 2, | |
| 'jsoneditor.php' => 2, | |
| 'multiimage.php' => 2, | |
| 'metas.php' => 2, | |
| 'hook' => 2, | |
| 'travis.setup.php' => 2, | |
| 'optiontrait.php' => 2, | |
| 'pivotrecord.php' => 2, | |
| 'errcode.php' => 2, | |
| 'mmsortable.php' => 2, | |
| 'galleryasset.php' => 2, | |
| 'optionable.php' => 2, | |
| 'querybuilderasset.php' => 2, | |
| 'smser.php' => 2, | |
| 'querybuilderform.php' => 2, | |
| 'captchabuilder.php' => 2, | |
| 'csrf.php' => 2, | |
| 'captchabuilderinterface.php' => 2, | |
| 'quickstart' => 2, | |
| 'imagefilehandler.php' => 2, | |
| 'phrasebuilder.php' => 2, | |
| 'errormanager.php' => 2, | |
| 'messagetakecontrol.php' => 2, | |
| 'markdownasset.php' => 2, | |
| 'phpunit.xml.default' => 2, | |
| 'yii2fullcalendar.php' => 2, | |
| 'imagehandler.php' => 2, | |
| 'bootstrapclass.php' => 2, | |
| 'gregwarimagebundle.php' => 2, | |
| 'gregwarformbundle.php' => 2, | |
| 'phrasebuilderinterface.php' => 2, | |
| 'postindicator.php' => 2, | |
| 'parserexception.php' => 2, | |
| 'parserdata.php' => 2, | |
| 'restresponse.php' => 2, | |
| 'formidable.php' => 2, | |
| 'dataform.php' => 2, | |
| 'jsoneditorasset.php' => 2, | |
| 'sidenavasset.php' => 2, | |
| 'controllerexception.php' => 2, | |
| 'settings_example.php' => 2, | |
| 'driverexception.php' => 2, | |
| 'ares.php' => 2, | |
| 'contenttype.php' => 2, | |
| 'facetquery.php' => 2, | |
| 'eselect2.php' => 2, | |
| 'phpconfig.php' => 2, | |
| 'testhelper.php' => 2, | |
| 'bootstrapswitch.php' => 2, | |
| '_toolkit_loader.php' => 2, | |
| 'filecache.php' => 2, | |
| 'reference' => 2, | |
| 'swagger-spec.json' => 2, | |
| 'advanced_settings_example.php' => 2, | |
| 'parallel.php' => 2, | |
| 'functions.inc.php' => 2, | |
| 'git-deploy' => 2, | |
| 'default' => 2, | |
| 'kitpagescmsbundle.php' => 2, | |
| 'cloudfiles_http.php' => 2, | |
| 'kitpagescmsevents.php' => 2, | |
| 'amppdfcrowdbundle.php' => 2, | |
| 'cloudfiles_exceptions.php' => 2, | |
| 'cloudfiles.php' => 2, | |
| 'basket.php' => 2, | |
| 'opentbsbundle.php' => 2, | |
| 'upgrade2.0' => 2, | |
| 'ip2location.php' => 2, | |
| 'mediawiki.php' => 2, | |
| 'phpcs.phar' => 2, | |
| 'test.csv' => 2, | |
| 'phpqa' => 2, | |
| 'parsedown.php' => 2, | |
| 'treewidget.php' => 2, | |
| 'abstractvalidator.php' => 2, | |
| 'bcrypthasher.php' => 2, | |
| 'galleryassets.php' => 2, | |
| 'integration.phpunit.xml' => 2, | |
| 'translate.sh' => 2, | |
| 'vardumper.php' => 2, | |
| 'pushover.php' => 2, | |
| 'migrate.bat' => 2, | |
| 'forbiddenexception.php' => 2, | |
| 'html2pdf.class.php' => 2, | |
| 'drivernotinstalledexception.php' => 2, | |
| 'ntlmsoapclient.php' => 2, | |
| 'exchangewebservices.php' => 2, | |
| 'ossexample.php' => 2, | |
| 'anonym' => 2, | |
| 'timehelper.php' => 2, | |
| 'phpmetrics.yml.dist' => 2, | |
| 'ewstype.php' => 2, | |
| 'searchinterface.php' => 2, | |
| 'ipdata.php' => 2, | |
| 'paymentrequest.php' => 2, | |
| 'xmlresponse.php' => 2, | |
| 'streamedresponse.php' => 2, | |
| 'ewsautodiscover.php' => 2, | |
| 'filehelper.php' => 2, | |
| 'eventexception.php' => 2, | |
| 'hellowidget.php' => 2, | |
| 'dynamicrouter.php' => 2, | |
| 'ews_exception.php' => 2, | |
| 'htmlpurifier.php' => 2, | |
| 'all_tests.php' => 2, | |
| 'pinyin.php' => 2, | |
| 'formasset.php' => 2, | |
| 'ftpprotocol.php' => 2, | |
| 'localtest.sh' => 2, | |
| 'egmapbounds.php' => 2, | |
| 'instantiatable.php' => 2, | |
| 'validateinterface.php' => 2, | |
| 'excerpt.php' => 2, | |
| '500.html' => 2, | |
| 'strengthvalidatorasset.php' => 2, | |
| 'presets.php' => 2, | |
| 'egmapbase.php' => 2, | |
| 'configurationmanager.php' => 2, | |
| 'sanitizeinterface.php' => 2, | |
| 'footer.html' => 2, | |
| 'example_base_ruleset.xml' => 2, | |
| 'configure.ac' => 2, | |
| 'webhook.php' => 2, | |
| 'typeaheadbasic.php' => 2, | |
| 'crudcontroller.php' => 2, | |
| 'tinymcelanguageasset.php' => 2, | |
| 'swiftmailercomponent.php' => 2, | |
| 'eventmanagerinterface.php' => 2, | |
| 'phptemplate.php' => 2, | |
| 'keywords.php' => 2, | |
| 'debugbundle.php' => 2, | |
| 'extend.php' => 2, | |
| 'dashboard.html' => 2, | |
| 'github.png' => 2, | |
| 'egmapapikeylist.php' => 2, | |
| 'passwordinput.php' => 2, | |
| '.bashrc' => 2, | |
| 'abstractstorage.php' => 2, | |
| 'documentup.json' => 2, | |
| 'init.php.example' => 2, | |
| 'passwordinputasset.php' => 2, | |
| '.scrutinizer' => 2, | |
| 'class.jbdump.php' => 2, | |
| '_template.php' => 2, | |
| 'performance' => 2, | |
| 'example_drupal7_ruleset.xml' => 2, | |
| 'bazingajqueryuibundle.php' => 2, | |
| 'weixinauth.php' => 2, | |
| 'browscapbundle.php' => 2, | |
| 'strengthvalidator.php' => 2, | |
| 'weiboauth.php' => 2, | |
| 'jjsgeonamesbundle.php' => 2, | |
| 'testinit.sh' => 2, | |
| 'renrenauth.php' => 2, | |
| 'go.sh' => 2, | |
| 'escapeinterface.php' => 2, | |
| 'cartbundle.php' => 2, | |
| 'imperaviredactorwidget.php' => 2, | |
| 'lang.inc.php' => 2, | |
| 'moufla.php' => 2, | |
| 'bootstrap.min.js' => 2, | |
| 'queryengine' => 2, | |
| 'data.inc.php' => 2, | |
| 'routedependencyresolvertrait.php' => 2, | |
| 'generatorsserviceprovider.php' => 2, | |
| 'filealreadyexistsexception.php' => 2, | |
| 'switchinput.php' => 2, | |
| 'objectcollection.php' => 2, | |
| 'template1.tpl' => 2, | |
| 'controllergenerator.php' => 2, | |
| 'spinnerasset.php' => 2, | |
| 'ornicarapcbundle.php' => 2, | |
| 'qqauth.php' => 2, | |
| 'konsole' => 2, | |
| 'chameleon.php' => 2, | |
| 'egmappoint.php' => 2, | |
| 'invoice.html' => 2, | |
| 'pdfdocument.php' => 2, | |
| 'template.tpl' => 2, | |
| 'template2.tpl' => 2, | |
| 'egmapsize.php' => 2, | |
| 'zf2-license' => 2, | |
| 'dbconnection.php' => 2, | |
| 'viewgenerator.php' => 2, | |
| 'seedgenerator.php' => 2, | |
| 'egmaprectangle.php' => 2, | |
| 'negotiator.php' => 2, | |
| 'scaffoldgenerator.php' => 2, | |
| 'config.php.default' => 2, | |
| 'egmapcircle.php' => 2, | |
| 'requestgenerator.php' => 2, | |
| 'pivotgenerator.php' => 2, | |
| 'mailerservicecompilerpass.php' => 2, | |
| 'splash.png' => 2, | |
| 'renderercompilerpass.php' => 2, | |
| 'egmappolylineencoder.php' => 2, | |
| 'autocompleteajax.php' => 2, | |
| 'egmappolygon.php' => 2, | |
| 'wikibasequeryengine.mw.php' => 2, | |
| 'template3.tpl' => 2, | |
| 'wikibasequeryengine.php' => 2, | |
| 'modelgenerator.php' => 2, | |
| 'responsefactory.php' => 2, | |
| 'phpda.yml.dist' => 2, | |
| 'installerplugin.php' => 2, | |
| 'cssparse.css' => 2, | |
| 'locatorinterface.php' => 2, | |
| 'nospam_ajax.php' => 2, | |
| 'renderinterface.php' => 2, | |
| 'tokeninterface.php' => 2, | |
| 'webservicecontext.php' => 2, | |
| 'wp-cli.sample.yml' => 2, | |
| 'flags.php' => 2, | |
| 'wp-cli-ssh.php' => 2, | |
| 'groupgridview.php' => 2, | |
| 'languageinterface.php' => 2, | |
| 'mapinterface.php' => 2, | |
| 'databaseinterface.php' => 2, | |
| 'laelapsgearmanbundle.php' => 2, | |
| 'fields.php' => 2, | |
| 'readme-ptbr' => 2, | |
| 'cleanup.php' => 2, | |
| 'phpthumb.unsharp.php' => 2, | |
| 'arrayloader.php' => 2, | |
| 'phpthumb.ico.php' => 2, | |
| 'phpthumb.gif.php' => 2, | |
| 'schemeinterface.php' => 2, | |
| 'editablecolumnasset.php' => 2, | |
| 'relations.php' => 2, | |
| 'cacheiteminterface.php' => 2, | |
| 'conditionoperator.php' => 2, | |
| 'registryinterface.php' => 2, | |
| 'php_errors.log' => 2, | |
| 'create.sql' => 2, | |
| 'changes 5.7.4' => 2, | |
| 'feed.xml' => 2, | |
| '_config.yml' => 2, | |
| 'packagemanager.php' => 2, | |
| 'baserelation.php' => 2, | |
| 'messageinterface.php' => 2, | |
| 'lightasset.php' => 2, | |
| 'kindeditorassets.php' => 2, | |
| 'index.htm' => 2, | |
| 'fullpageasset.php' => 2, | |
| 'twig-gettext-extractor' => 2, | |
| 'pdfresponse.php' => 2, | |
| 'filterhelper.php' => 2, | |
| 'configmanager.php' => 2, | |
| 'viewstash.php' => 2, | |
| 'readme.tpl' => 2, | |
| 'widgettrait.php' => 2, | |
| 'phpthumb.functions.php' => 2, | |
| 'badmethodcallexception.php' => 2, | |
| 'slick.php' => 2, | |
| 'changelog.json' => 2, | |
| 'templateinterface.php' => 2, | |
| 'maintainer.php' => 2, | |
| 'adcomponentbundle.php' => 2, | |
| 'avrotranslatorbundle.php' => 2, | |
| 'cleantalk.custom.php' => 2, | |
| 'htmlformfield.php' => 2, | |
| 'soap-wsse.php' => 2, | |
| 'jdareclankbundle.php' => 2, | |
| 'readme-es' => 2, | |
| 'id_rsa.enc' => 2, | |
| 'mailerinterface.php' => 2, | |
| 'braintreeasset.php' => 2, | |
| 'messages.html' => 2, | |
| 'browscap.php' => 2, | |
| 'new-package.php' => 2, | |
| 'styles.less' => 2, | |
| 'pickadateasset.php' => 2, | |
| 'p.php' => 2, | |
| 'egmap.php' => 2, | |
| 'ubiquitous-language' => 2, | |
| 'shutdown.php' => 2, | |
| 'versioninfo' => 2, | |
| 'phpthumb.filters.php' => 2, | |
| 'avrosupportbundle.php' => 2, | |
| 'phpthumb.class.php' => 2, | |
| '.coveralls' => 2, | |
| 'phpthumb.bmp.php' => 2, | |
| 'taveopolishextensionsbundle.php' => 2, | |
| 'phpthumb.php' => 2, | |
| 'besimplesoapbundle.php' => 2, | |
| 'thelia_inet.fmt' => 2, | |
| 'cacheplugin.php' => 2, | |
| 'resourceinterface.php' => 2, | |
| 'rbacasset.php' => 2, | |
| 'themeview.php' => 2, | |
| 'rscandir.php' => 2, | |
| 'schematic.php' => 2, | |
| 'gruntconfig.js' => 2, | |
| 'xupload.php' => 2, | |
| 'jqueryfiletree.css' => 2, | |
| 'jqueryfiletree.js' => 2, | |
| 'stack.php' => 2, | |
| 'braintreeform.php' => 2, | |
| 'wa72jsonrpcbundle.php' => 2, | |
| 'downloads.php' => 2, | |
| 'switcher.php' => 2, | |
| 'consolegenerator.php' => 2, | |
| 'standardlist.php' => 2, | |
| 'properties' => 2, | |
| 'egmapinfobox.php' => 2, | |
| 'resolveresponse.php' => 2, | |
| 'runtimeexception.php' => 2, | |
| 'yamlfileloader.php' => 2, | |
| 'c3.php' => 2, | |
| 'egmapinfowindow.php' => 2, | |
| 'propertyaccess.php' => 2, | |
| 'symfony1.php' => 2, | |
| 'slack.php' => 2, | |
| 'sdk.php' => 2, | |
| 'egmapgeocodedaddress.php' => 2, | |
| 'dbal.php' => 2, | |
| 'commandinterface.php' => 2, | |
| 'resolvequery.php' => 2, | |
| 'development.config.php.dist' => 2, | |
| '.pre-commit-config.yaml' => 2, | |
| 'launcher.php' => 2, | |
| 'contentmodule.php' => 2, | |
| 'readresponse.php' => 2, | |
| 'multiresponse.php' => 2, | |
| 'schemaresponse.php' => 2, | |
| 'craft' => 2, | |
| 'egmapkmlservice.php' => 2, | |
| 'app.log' => 2, | |
| 'usermodel.php' => 2, | |
| 'contextmenuasset.php' => 2, | |
| 'linkedin.php' => 2, | |
| 'filelogger.php' => 2, | |
| 'mrpstripewebhookbundle.php' => 2, | |
| 'starratingasset.php' => 2, | |
| 'save.php' => 2, | |
| 'travis_php.ini' => 2, | |
| '.lvimrc' => 2, | |
| 'rangeinput.php' => 2, | |
| 'egmapmarkerimage.php' => 2, | |
| 'unittest.xml' => 2, | |
| 'pnotifyasset.php' => 2, | |
| 'wepay.php' => 2, | |
| 'canvasblobasset.php' => 2, | |
| 'egmapevent.php' => 2, | |
| 'egmapgeocodetool.php' => 2, | |
| 'symfony-shim.php' => 2, | |
| 'envelope.png' => 2, | |
| 'issues' => 2, | |
| 'fpntagbundle.php' => 2, | |
| 'developmentmodecontroller.php' => 2, | |
| 'edit.php' => 2, | |
| 'phpmd_ruleset.xml' => 2, | |
| 'shell' => 2, | |
| 'affix.php' => 2, | |
| 'array2xml.php' => 2, | |
| 'factualfilter.php' => 2, | |
| 'factualcolumnschema.php' => 2, | |
| 'newscoopfacebooknewscoopbundle.php' => 2, | |
| 'iconasset.php' => 2, | |
| 'compilerpass.php' => 2, | |
| 'egmapmarker.php' => 2, | |
| 'ruianuploadifybundle.php' => 2, | |
| 'factualplace.php' => 2, | |
| 'factualcircle.php' => 2, | |
| 'gradlew' => 2, | |
| 'gradlew.bat' => 2, | |
| 'bigfootcontentbundle.php' => 2, | |
| 'lexikfixturesmapperbundle.php' => 2, | |
| 'factualapiexception.php' => 2, | |
| 'resolverinterface.php' => 2, | |
| 'egmaplatloncontrol.php' => 2, | |
| 'dataproviderinterface.php' => 2, | |
| 'tokens.php' => 2, | |
| 'innovaangularuibootstrapbundle.php' => 2, | |
| 'geocoderwrapper.php' => 2, | |
| 'contentprovider.php' => 2, | |
| 'engine.php' => 2, | |
| 'httpcache.php' => 2, | |
| 'fosmessagebundle.php' => 2, | |
| 'depdrop.php' => 2, | |
| 'filtergroup.php' => 2, | |
| 'fieldfilter.php' => 2, | |
| 'ant' => 2, | |
| 'example.phpspec.yml' => 2, | |
| 'dataset.php' => 2, | |
| 'egmapmarkerclusterer.php' => 2, | |
| 'urlroute.php' => 2, | |
| 'factualtest.php' => 2, | |
| 'egmapkeydragzoom.php' => 2, | |
| 'riak.proto' => 2, | |
| 'factualresponse.php' => 2, | |
| 'fosrestbundle.php' => 2, | |
| 'fostwitterbundle.php' => 2, | |
| 'relaynode.php' => 2, | |
| 'colorinput.php' => 2, | |
| 'factualquery.php' => 2, | |
| 'alertblock.php' => 2, | |
| 'datecontrol.php' => 2, | |
| 'loglevel.php' => 2, | |
| 'flush.php' => 2, | |
| 'moduleevent.php' => 2, | |
| 'composer-update.sh' => 2, | |
| 'egmapcontrolposition.php' => 2, | |
| 'fileinfo.php' => 2, | |
| 'glial' => 2, | |
| 'class.csstidy_print.php' => 2, | |
| 'zeroemcurlbundle.php' => 2, | |
| 'egmapmarkerwithlabel.php' => 2, | |
| 'redirectexception.php' => 2, | |
| 'marionette.php' => 2, | |
| 'urlparser.php' => 2, | |
| 'test2' => 2, | |
| 'class.csstidy_optimise.php' => 2, | |
| 'class.csstidy.php' => 2, | |
| 'semanticresultformats.parser.php' => 2, | |
| 'services.json' => 2, | |
| 'marionettecollection.php' => 2, | |
| 'marionettemodel.php' => 2, | |
| 'sample_bootstrap.php' => 2, | |
| 'overview.php' => 2, | |
| 'resque-scheduler.php' => 2, | |
| 'upgradeassets.sh' => 2, | |
| 'iconpickerasset.php' => 2, | |
| 'semanticresultformats.php' => 2, | |
| 'egmapcoord.php' => 2, | |
| 'descriptionlist.php' => 2, | |
| 'chameleon.i18n.php' => 2, | |
| 'smoothscroll.php' => 2, | |
| 'doubanauth.php' => 2, | |
| 'semanticresultformats.utils.php' => 2, | |
| 'scrollablebox.php' => 2, | |
| 'scrollspy.php' => 2, | |
| 'overlay.php' => 2, | |
| 'overflowbox.php' => 2, | |
| 'moufla.xml' => 2, | |
| 'offcanvas.php' => 2, | |
| 'build-release.sh' => 2, | |
| 'egmapclient.php' => 2, | |
| 'ibrowsnewsletterbundle.php' => 2, | |
| 'touchspinasset.php' => 2, | |
| 'close.php' => 2, | |
| 'addressinterface.php' => 2, | |
| 'perl-image-exiftool.spec' => 2, | |
| 'css_optimiser.php' => 2, | |
| 'maintenancecontroller.php' => 2, | |
| 'blockprovidercompilerpass.php' => 2, | |
| 'semanticresultformats.settings.php' => 2, | |
| 'exiftool' => 2, | |
| 'active_record.info' => 2, | |
| 'videoconverter.php' => 2, | |
| 'gnu-lgpl' => 2, | |
| 'report.xml' => 2, | |
| 'egmapdirection.php' => 2, | |
| 'requestlistener.php' => 2, | |
| 'egmapdirectionrenderer.php' => 2, | |
| 'login_script_db.sql' => 2, | |
| 'sxgeocitymax.dat' => 2, | |
| 'egmapdirectionwaypoint.php' => 2, | |
| 'egmapelevationinfo.php' => 2, | |
| 'pedroteixeiragridbundle.php' => 2, | |
| 'migrationinterface.php' => 2, | |
| 'oneupuploaderbundle.php' => 2, | |
| 'icache.php' => 2, | |
| 'active_record.install' => 2, | |
| 'active_record.module' => 2, | |
| 'fixtures.yaml' => 2, | |
| 'demo2.php' => 2, | |
| '.gitchange' => 2, | |
| 'dateformatterasset.php' => 2, | |
| 'translator' => 2, | |
| 'datecontrolasset.php' => 2, | |
| 'semanticresultformats.hooks.php' => 2, | |
| 'themekrajeeasset.php' => 2, | |
| 'semanticresultformats.i18n.magic.php' => 2, | |
| 'jnsxhprofbundle.php' => 2, | |
| 'rules.php' => 2, | |
| 'callout.php' => 2, | |
| 'semanticresultformats.i18n.php' => 2, | |
| 'rulefactory.php' => 2, | |
| 'phploc.xml' => 2, | |
| 'build.json' => 2, | |
| 'mrcore.php' => 1, | |
| 'mqmassetbundle.php' => 1, | |
| 'readme.devel' => 1, | |
| 'phpmig' => 1, | |
| 'streams' => 1, | |
| 'upf.php' => 1, | |
| 'wikihtml.php' => 1, | |
| 'readme_examples' => 1, | |
| 'just-backup-btrfs' => 1, | |
| 'composer.json.orig' => 1, | |
| 'error-0011-in.jsonld' => 1, | |
| 'bootstrappresenter.php' => 1, | |
| 'micromvc.php' => 1, | |
| 'readme_details' => 1, | |
| 'caribou.sh' => 1, | |
| 'expand-0055-out.jsonld' => 1, | |
| 'magento_sales.zip' => 1, | |
| 'providers' => 1, | |
| 'zfc.php' => 1, | |
| 'phpunit.full-urls.xml' => 1, | |
| 'phonegapbuildapi.php' => 1, | |
| 'classes-generator.php' => 1, | |
| 'bbceditorbundle.php' => 1, | |
| 'caribou.php' => 1, | |
| 'nbbcbundle.php' => 1, | |
| 'changelog.sh' => 1, | |
| 'error-0009-in.jsonld' => 1, | |
| 'error-0012-in.jsonld' => 1, | |
| 'ez-jwt.php' => 1, | |
| 'error-0010-in.jsonld' => 1, | |
| 'mqmpaginationbundle.php' => 1, | |
| 'tpmpaymentslimcdbundle.php' => 1, | |
| 'mqmsortbundle.php' => 1, | |
| 'sqlnet.log' => 1, | |
| 'expand-0011-in.jsonld' => 1, | |
| 'expand-0056-in.jsonld' => 1, | |
| 'expand-0071-out.jsonld' => 1, | |
| 'expand-0074-out.jsonld' => 1, | |
| 'expand-0074-in.jsonld' => 1, | |
| 'expand-0073-out.jsonld' => 1, | |
| 'expand-0073-in.jsonld' => 1, | |
| 'proxy-start.sh.erb' => 1, | |
| 'expand-0072-out.jsonld' => 1, | |
| 'generated_sample' => 1, | |
| 'mtmpersiandatebundle.php' => 1, | |
| 'jobby.php' => 1, | |
| 'proxy-config.sh.erb' => 1, | |
| 'provision.sh.erb' => 1, | |
| 'docker-container-ssh.sh.erb' => 1, | |
| 'remove' => 1, | |
| 'expand-0072-in.jsonld' => 1, | |
| 'vagrantfile.erb' => 1, | |
| 'migrationbundle.php' => 1, | |
| 'expand-0071-in.jsonld' => 1, | |
| 'phpunit.composer.xml' => 1, | |
| '.local-dev-vm-env.dist' => 1, | |
| 'fixturehelpercommand.php' => 1, | |
| 'po2json.php' => 1, | |
| 'contentmodelmetadatagenerator.php' => 1, | |
| 'fixturehelperdbfixturemanager.php' => 1, | |
| 'ownerbehavior.php' => 1, | |
| 'benefits' => 1, | |
| 'expand-0070-out.jsonld' => 1, | |
| 'compact-0072-in.jsonld' => 1, | |
| 'zephyradmincorebundle.php' => 1, | |
| 'expand-0070-in.jsonld' => 1, | |
| 'expand-0069-out.jsonld' => 1, | |
| 'migrationsprovider.php' => 1, | |
| 'expand-0075-in.jsonld' => 1, | |
| 'expand-0068-out.jsonld' => 1, | |
| 'casciiart.php' => 1, | |
| 'flatten-0007-in.jsonld' => 1, | |
| 'flatten-0006-out.jsonld' => 1, | |
| 'flatten-0006-in.jsonld' => 1, | |
| 'flatten-0005-out.jsonld' => 1, | |
| 'flatten-0005-in.jsonld' => 1, | |
| 'compact-0071-in.jsonld' => 1, | |
| 'flatten-0004-out.jsonld' => 1, | |
| 'flatten-0004-in.jsonld' => 1, | |
| 'flatten-0003-out.jsonld' => 1, | |
| 'flatten-0003-in.jsonld' => 1, | |
| 'flatten-0002-out.jsonld' => 1, | |
| 'flatten-0002-in.jsonld' => 1, | |
| 'flatten-0001-out.jsonld' => 1, | |
| 'compact-0071-out.jsonld' => 1, | |
| 'ccache.php' => 1, | |
| 'expand-0075-out.jsonld' => 1, | |
| 'chttpget.php' => 1, | |
| 'flatten-0001-in.jsonld' => 1, | |
| 'expand-manifest.jsonld' => 1, | |
| 'compact-0072-context.jsonld' => 1, | |
| 'expand-0078-out.jsonld' => 1, | |
| 'expand-0078-in.jsonld' => 1, | |
| 'expand-0077-out.jsonld' => 1, | |
| 'expand-0077-in.jsonld' => 1, | |
| 'expand-0077-context.jsonld' => 1, | |
| 'expand-0076-out.jsonld' => 1, | |
| 'cimage.php' => 1, | |
| 'cremoteimage.php' => 1, | |
| 'cwhitelist.php' => 1, | |
| 'expand-0076-in.jsonld' => 1, | |
| 'expand-0069-in.jsonld' => 1, | |
| 'expand-0068-in.jsonld' => 1, | |
| 'expand-0056-out.jsonld' => 1, | |
| 'expand-0060-in.jsonld' => 1, | |
| 'containerawareruleprovider.php' => 1, | |
| 'error-0005-in.jsonld' => 1, | |
| 'nucleusbusinessruleenginebundle.php' => 1, | |
| 'expand-0063-in.jsonld' => 1, | |
| 'expand-0062-out.jsonld' => 1, | |
| 'expand-0062-in.jsonld' => 1, | |
| 'error-0006-in.jsonld' => 1, | |
| 'expand-0061-out.jsonld' => 1, | |
| 'drawdrawbundle.php' => 1, | |
| 'expand-0061-in.jsonld' => 1, | |
| 'drawtesthelperbundle.php' => 1, | |
| 'error-0007-in.jsonld' => 1, | |
| 'expand-0060-out.jsonld' => 1, | |
| 'nucleuscorebundle.php' => 1, | |
| 'error-0008-in.jsonld' => 1, | |
| 'error-0004-in.jsonld' => 1, | |
| 'mplt.php' => 1, | |
| 'nucleusconsolebundle.php' => 1, | |
| 'oxymeltest.php' => 1, | |
| 'nucleusmigrationbundle.php' => 1, | |
| 'drawswaggerbundle.php' => 1, | |
| 'oxymel.php' => 1, | |
| 'run-unit-tests.php' => 1, | |
| 'expand-0059-out.jsonld' => 1, | |
| 'expand-0059-in.jsonld' => 1, | |
| 'expand-0058-out.jsonld' => 1, | |
| 'expand-0058-in.jsonld' => 1, | |
| 'expand-0057-out.jsonld' => 1, | |
| 'expand-0057-in.jsonld' => 1, | |
| 'jmsserializerlistener.php' => 1, | |
| 'nucleusbinderbundle.php' => 1, | |
| 'checksums' => 1, | |
| 'expand-0067-out.jsonld' => 1, | |
| 'twitterwidgetbundle.php' => 1, | |
| 'pagebundle.php' => 1, | |
| 'unity.php' => 1, | |
| 'tiimber' => 1, | |
| 'publish-gh-pages.rb' => 1, | |
| 'compact-0072-out.jsonld' => 1, | |
| 'compact-manifest.jsonld' => 1, | |
| 'error-0001-in.jsonld' => 1, | |
| 'simpletreeview.php' => 1, | |
| 'expand-0067-in.jsonld' => 1, | |
| 'ncelephantiobundle.php' => 1, | |
| 'expand-0066-out.jsonld' => 1, | |
| 'awl.yml' => 1, | |
| 'fixntest' => 1, | |
| 'metrics' => 1, | |
| 'expand-0066-in.jsonld' => 1, | |
| 'error-0003-in.jsonld' => 1, | |
| 'expand-0065-out.jsonld' => 1, | |
| 'expand-0065-in.jsonld' => 1, | |
| 'wikiphp.php' => 1, | |
| 'jeandejeanapiparisbundle.php' => 1, | |
| 'berksfile.lock' => 1, | |
| 'error-0002-in.jsonld' => 1, | |
| 'consoleapp.php' => 1, | |
| 'parse_loop_example.php' => 1, | |
| 'error-0003-ctx.jsonld' => 1, | |
| 'parse_serialize_example.php' => 1, | |
| 'expand-0064-out.jsonld' => 1, | |
| 'expand-0064-in.jsonld' => 1, | |
| 'phpspec-code_coverage.yml' => 1, | |
| 'expand-0063-out.jsonld' => 1, | |
| 'expand-0055-in.jsonld' => 1, | |
| 'expand-0040-out.jsonld' => 1, | |
| 'error-0013-in.jsonld' => 1, | |
| 'stringgeneratorbundle.php' => 1, | |
| 'nahoyimportbundle.php' => 1, | |
| 'kashflow.php' => 1, | |
| 'expand-0020-out.jsonld' => 1, | |
| 'license_mit' => 1, | |
| 'error-0039-in.jsonld' => 1, | |
| 'dbpatcherbundle.php' => 1, | |
| 'testutilitybundle.php' => 1, | |
| 'error-0041-in.jsonld' => 1, | |
| 'namshiutilitybundle.php' => 1, | |
| 'error-0038-in.jsonld' => 1, | |
| 'namshivoyeurbundle.php' => 1, | |
| 'example_validator.php' => 1, | |
| 'assetloader.php' => 1, | |
| 'expand-0021-in.jsonld' => 1, | |
| 'error-0037-in.jsonld' => 1, | |
| 'error-0040-in.jsonld' => 1, | |
| 'expand-0020-in.jsonld' => 1, | |
| 'error-0036-in.jsonld' => 1, | |
| 'expand-0018-in.jsonld' => 1, | |
| 'expand-0016-out.jsonld' => 1, | |
| 'expand-0017-in.jsonld' => 1, | |
| 'mvrhovdoctrineextensionsbundle.php' => 1, | |
| 'datadotgovadminapi_sdk.php' => 1, | |
| 'plugin_template.php' => 1, | |
| 'readme.cakephp' => 1, | |
| 'expand-0017-out.jsonld' => 1, | |
| 'phpmd-tests.xml' => 1, | |
| 'hezarfendenetmenbundle.php' => 1, | |
| 'error-0042-context.jsonld' => 1, | |
| 'expand-0018-out.jsonld' => 1, | |
| 'expand-0019-in.jsonld' => 1, | |
| 'quebolu.sql' => 1, | |
| 'expand-0019-out.jsonld' => 1, | |
| 'qb.php' => 1, | |
| 'social-counter-class.php' => 1, | |
| 'expand-0021-out.jsonld' => 1, | |
| 'expand-0022-in.jsonld' => 1, | |
| 'uml.xmi' => 1, | |
| 'treeimage.php' => 1, | |
| 'expand-0026-out.jsonld' => 1, | |
| 'expand-0027-in.jsonld' => 1, | |
| 'adoptableroutinginterface.php' => 1, | |
| 'routeentity.php' => 1, | |
| 'expand-0027-out.jsonld' => 1, | |
| 'routefield.php' => 1, | |
| 'sonataadminbundle.php' => 1, | |
| 'instagramstrategy.php' => 1, | |
| 'expand-0026-in.jsonld' => 1, | |
| 'webicon.ico' => 1, | |
| 'routinginterface.php' => 1, | |
| 'mpcatalogbundle.php' => 1, | |
| 'error-0035-in.jsonld' => 1, | |
| 'segment.php' => 1, | |
| 'expand-0028-in.jsonld' => 1, | |
| 'expand-0028-out.jsonld' => 1, | |
| 'phycachebundle.php' => 1, | |
| 'githook.php' => 1, | |
| 'expand-0022-out.jsonld' => 1, | |
| 'expand-0025-in.jsonld' => 1, | |
| 'credentials.inc.php' => 1, | |
| 'pwstrengthasset.php' => 1, | |
| 'expand-0023-in.jsonld' => 1, | |
| 'expand-0023-out.jsonld' => 1, | |
| 'expand-0024-in.jsonld' => 1, | |
| 'nano.rocks' => 1, | |
| 'expand-0024-out.jsonld' => 1, | |
| 'messenger.php' => 1, | |
| 'index-cancel.php' => 1, | |
| 'elfindervolumeflysystemext.php' => 1, | |
| 'pwstrength.php' => 1, | |
| 'expand-0025-out.jsonld' => 1, | |
| 'naonedoaipmhserverbundle.php' => 1, | |
| 'pkr.php' => 1, | |
| 'index-sendpayment.php' => 1, | |
| 'index-query.php' => 1, | |
| 'mvrhovresourcebundle.php' => 1, | |
| 'nzedbbase.php' => 1, | |
| 'customerio.php' => 1, | |
| 'jqueryfileuploadbundle.php' => 1, | |
| 'expand-0009-in.jsonld' => 1, | |
| 'expand-0008-out.jsonld' => 1, | |
| 'expand-0008-in.jsonld' => 1, | |
| '17monipdb.dat' => 1, | |
| 'expand-0007-out.jsonld' => 1, | |
| 'expand-0014-out.jsonld' => 1, | |
| 'expand-0015-in.jsonld' => 1, | |
| 'expand-0009-out.jsonld' => 1, | |
| 'expand-0007-in.jsonld' => 1, | |
| 'client.class.php' => 1, | |
| 'api.class.php' => 1, | |
| 'version.xml' => 1, | |
| 'expand-0006-out.jsonld' => 1, | |
| 'expand-0006-in.jsonld' => 1, | |
| 'menuhelper.php' => 1, | |
| 'travis_init.sh' => 1, | |
| 'expand-0014-in.jsonld' => 1, | |
| 'expand-0005-out.jsonld' => 1, | |
| 'commitlog' => 1, | |
| 'expand-0012-in.jsonld' => 1, | |
| 'ssdbsession.php' => 1, | |
| 'expand-0012-out.jsonld' => 1, | |
| 'rock.php' => 1, | |
| 'expand-0010-out.jsonld' => 1, | |
| 'plugin_manager.php' => 1, | |
| 'config.new.php' => 1, | |
| 'expand-0010-in.jsonld' => 1, | |
| 'expand-0013-out.jsonld' => 1, | |
| 'function_mock.php' => 1, | |
| 'pdfmerger.php' => 1, | |
| 'hamark.com' => 1, | |
| 'myxaxafilesearchbundle.php' => 1, | |
| 'run-demo' => 1, | |
| 'dropdownlte.php' => 1, | |
| 'expand-0013-in.jsonld' => 1, | |
| 'wkhtmltopdf' => 1, | |
| 'expand-0005-in.jsonld' => 1, | |
| 'upcommand.php' => 1, | |
| 'n1c0officialtextbundle.php' => 1, | |
| 'expand-0001-in.jsonld' => 1, | |
| 'error-manifest.jsonld' => 1, | |
| 'mwtagadminbundle.php' => 1, | |
| 'passwordgenerator.inc.php' => 1, | |
| 'yahoo_business_browser.php' => 1, | |
| 'n1c0dissertationbundle.php' => 1, | |
| 'n1c0lessonbundle.php' => 1, | |
| 'expand-0015-out.jsonld' => 1, | |
| 'semanticbundle.php' => 1, | |
| 'n1c0quotebundle.php' => 1, | |
| 'mwshortcodebundle.php' => 1, | |
| 'expand-0016-in.jsonld' => 1, | |
| 'yajit.php' => 1, | |
| 'error-0043-in.jsonld' => 1, | |
| 'error-0042-in.jsonld' => 1, | |
| 'up.php' => 1, | |
| 'uagent.php' => 1, | |
| 'conductor' => 1, | |
| 'expand-0004-out.jsonld' => 1, | |
| 'mybuildercronosbundle.php' => 1, | |
| 'expand-0004-in.jsonld' => 1, | |
| 'expand-0003-out.jsonld' => 1, | |
| 'navlte.php' => 1, | |
| 'abstractsoapclient.php' => 1, | |
| 'wkhtmltoimage' => 1, | |
| 'domainstatus.php' => 1, | |
| 'expand-0003-in.jsonld' => 1, | |
| 'soapclientinterface.php' => 1, | |
| 'nscontactbundle.php' => 1, | |
| 'expand-0002-out.jsonld' => 1, | |
| 'usernamestatus.php' => 1, | |
| 'expand-0002-in.jsonld' => 1, | |
| 'c' => 1, | |
| 'conductor-logo.png' => 1, | |
| 't' => 1, | |
| 'expand-0001-out.jsonld' => 1, | |
| 'narogasearchbundle.php' => 1, | |
| 'expand-0029-in.jsonld' => 1, | |
| 'expand-0054-out.jsonld' => 1, | |
| 'recipexport.php' => 1, | |
| 'expand-0043-in.jsonld' => 1, | |
| 'expand-0043-out.jsonld' => 1, | |
| 'expand-0044-in.jsonld' => 1, | |
| 'expand-0044-out.jsonld' => 1, | |
| 'error-0016-in.jsonld' => 1, | |
| 'phpunit-shutdown.php' => 1, | |
| 'authdatasample.ini' => 1, | |
| 'error-0018-in.jsonld' => 1, | |
| 'error-0015-in.jsonld' => 1, | |
| 'expand-0045-in.jsonld' => 1, | |
| 'expand-0045-out.jsonld' => 1, | |
| 'user.properties' => 1, | |
| 'expand-0046-in.jsonld' => 1, | |
| 'mrt.sh' => 1, | |
| 'expand-0046-out.jsonld' => 1, | |
| 'error-0017-in.jsonld' => 1, | |
| 'error-0019-in.jsonld' => 1, | |
| 'expand-0047-out.jsonld' => 1, | |
| 'expand-0040-in.jsonld' => 1, | |
| 'error-0024-in.jsonld' => 1, | |
| 'globalstatedb.php' => 1, | |
| 'dbbatch.php' => 1, | |
| 'expand-0038-out.jsonld' => 1, | |
| 'error-0023-in.jsonld' => 1, | |
| 'expand-0039-in.jsonld' => 1, | |
| 'expand-0039-out.jsonld' => 1, | |
| 'expand-0011-out.jsonld' => 1, | |
| 'error-0020-in.jsonld' => 1, | |
| 'expand-0041-in.jsonld' => 1, | |
| 'expand-0041-out.jsonld' => 1, | |
| 'expand-0042-in.jsonld' => 1, | |
| 'expand-0042-out.jsonld' => 1, | |
| 'cwr.bat' => 1, | |
| 'error-0022-in.jsonld' => 1, | |
| 'error-0021-in.jsonld' => 1, | |
| 'expand-0047-in.jsonld' => 1, | |
| 'db-sync.phar' => 1, | |
| 'globalstateform.php' => 1, | |
| 'mremiurlshortenerbundle.php' => 1, | |
| 'keystone.php' => 1, | |
| 'expand-0052-out.jsonld' => 1, | |
| 'httpconnection.php' => 1, | |
| 'mssql.php' => 1, | |
| 'dbalinterface.php' => 1, | |
| 'expand-0053-in.jsonld' => 1, | |
| 'apiinterface.php' => 1, | |
| 'expand-0053-out.jsonld' => 1, | |
| 'nativeconnection.php' => 1, | |
| 'mremitemplatingextrabundle.php' => 1, | |
| 'mremidolistbundle.php' => 1, | |
| 'mremibootstrapbundle.php' => 1, | |
| 'csvtabletest.php' => 1, | |
| 'csvtable.php' => 1, | |
| 'graph.gif' => 1, | |
| 'expand-0054-in.jsonld' => 1, | |
| 'keystoneinterface.php' => 1, | |
| 'guest.php' => 1, | |
| 'autobahn.json' => 1, | |
| 'expand-0050-out.jsonld' => 1, | |
| 'error-0014-in.jsonld' => 1, | |
| 'expand-0048-in.jsonld' => 1, | |
| 'expand-0048-out.jsonld' => 1, | |
| 'mssqlstore.php' => 1, | |
| 'expand-0049-in.jsonld' => 1, | |
| 'expand-0049-out.jsonld' => 1, | |
| 'expand-0050-in.jsonld' => 1, | |
| 'expand-0051-in.jsonld' => 1, | |
| 'loginterface.php' => 1, | |
| 'mongostore.php' => 1, | |
| 'reqs' => 1, | |
| 'phrets.php' => 1, | |
| 'expand-0051-out.jsonld' => 1, | |
| 'apigen.config' => 1, | |
| 'dbstore.php' => 1, | |
| 'other.php' => 1, | |
| 'globalstatefile.php' => 1, | |
| 'gridbundle.php' => 1, | |
| 'error-0034-in.jsonld' => 1, | |
| 'auntyentity.php' => 1, | |
| 'mongojson.php' => 1, | |
| 'imdb_charts.class.php' => 1, | |
| 'element.json' => 1, | |
| 'expand-0032-out.jsonld' => 1, | |
| 'error-0032-in.jsonld' => 1, | |
| 'newscred.php' => 1, | |
| 'expand-0033-in.jsonld' => 1, | |
| 'imdb_movielist.class.php' => 1, | |
| 'expand-0031-out.jsonld' => 1, | |
| 'imdb_nowplaying.class.php' => 1, | |
| 'yiiaws.php' => 1, | |
| 'less.js' => 1, | |
| 'error-0031-in.jsonld' => 1, | |
| 'error-0030-in.jsonld' => 1, | |
| 'imdb_person.class.php' => 1, | |
| 'error-0029-in.jsonld' => 1, | |
| 'expand-0032-in.jsonld' => 1, | |
| 'expand-0031-in.jsonld' => 1, | |
| 'bootstrapper.min.less' => 1, | |
| 'expand-0029-out.jsonld' => 1, | |
| 'nass600cosmbundle.php' => 1, | |
| 'nass600lyricsbundle.php' => 1, | |
| 'ucnode.inc.php' => 1, | |
| 'sysconfig.inc.php' => 1, | |
| 'supports' => 1, | |
| 'nass600mediainfobundle.php' => 1, | |
| 'license.commercial' => 1, | |
| 'oai.php' => 1, | |
| 'error-0033-in.jsonld' => 1, | |
| 'expand-0030-in.jsonld' => 1, | |
| 'browseremulator.class.php' => 1, | |
| 'imdbxml.php' => 1, | |
| 'imdb_budget.class.php' => 1, | |
| 'chatserver.php' => 1, | |
| 'expand-0030-out.jsonld' => 1, | |
| 'muchomasfacilformbyemailbundle.php' => 1, | |
| 'imdb_trailers.class.php' => 1, | |
| 'bootstrapper.html' => 1, | |
| 'expand-0037-out.jsonld' => 1, | |
| 'sitemapinterface.php' => 1, | |
| 's3streamwrapper.php' => 1, | |
| 'pouyasoftdatebundle.php' => 1, | |
| 'expand-0035-out.jsonld' => 1, | |
| 'test_config.dist.json' => 1, | |
| 'openexchangeratesbundle.php' => 1, | |
| 'expand-0036-in.jsonld' => 1, | |
| 'pilot.class.php' => 1, | |
| 'expand-0036-out.jsonld' => 1, | |
| 'expand-0035-in.jsonld' => 1, | |
| 'pilot_person.class.php' => 1, | |
| 'mdashfilter.php' => 1, | |
| 'pilotsearch.class.php' => 1, | |
| 'mdash.php' => 1, | |
| 'cwr' => 1, | |
| 'globalstateinterface.php' => 1, | |
| 'expand-0037-in.jsonld' => 1, | |
| 'abstractgenerator.php' => 1, | |
| 'expand-0034-out.jsonld' => 1, | |
| 'imdbsearch.class.php' => 1, | |
| 'movie.php' => 1, | |
| 'mdb_base.class.php' => 1, | |
| 'mdb_config.class.php' => 1, | |
| 'error-0028-in.jsonld' => 1, | |
| 'error-0027-in.jsonld' => 1, | |
| 'mdb_request.class.php' => 1, | |
| 'error-0026-in.jsonld' => 1, | |
| 'msulistijophpseclibbundle.php' => 1, | |
| 'gulpfile.babel.js' => 1, | |
| 'resourcebag.php' => 1, | |
| 'movie_base.class.php' => 1, | |
| 'error-0025-in.jsonld' => 1, | |
| 'movieposterdb.class.php' => 1, | |
| 'person_base.class.php' => 1, | |
| 'expand-0033-out.jsonld' => 1, | |
| 'expand-0034-in.jsonld' => 1, | |
| 'google-api' => 1, | |
| 'expand-0052-in.jsonld' => 1, | |
| 'metatag.module' => 1, | |
| 'license_gplv3' => 1, | |
| 'reinstall_e.sh' => 1, | |
| 'json-patch-tests' => 1, | |
| 'normalize-0033-in.jsonld' => 1, | |
| 'normalize-0033-out.nq' => 1, | |
| 'normalize-0034-in.jsonld' => 1, | |
| 'normalize-0034-out.nq' => 1, | |
| '.rock.yml' => 1, | |
| 'normalize-0035-in.jsonld' => 1, | |
| 'masterbaker.gemspec' => 1, | |
| 'syncdocs.sh' => 1, | |
| 'repackage.sh' => 1, | |
| 'package.xml.base' => 1, | |
| 'run_tests.php' => 1, | |
| 'build.xml.new' => 1, | |
| 'php_compiler.class.php' => 1, | |
| 'normalize-0035-out.nq' => 1, | |
| 'update-all' => 1, | |
| 'apidocvim' => 1, | |
| 'xreturnable.php' => 1, | |
| 'normalize-0036-in.jsonld' => 1, | |
| 'normalize-0036-out.nq' => 1, | |
| 'xcrudcontroller.php' => 1, | |
| 'normalize-0037-in.jsonld' => 1, | |
| 'normalize-0037-out.nq' => 1, | |
| 'local_tests.json' => 1, | |
| 'normalize-0032-out.nq' => 1, | |
| 'normalize-0038-in.jsonld' => 1, | |
| 'normalize-0028-in.jsonld' => 1, | |
| 'google_tag.libraries.yml' => 1, | |
| 'google_tag.install' => 1, | |
| 'google_tag.info.yml' => 1, | |
| 'normalize-0026-in.jsonld' => 1, | |
| 'sendemail.php' => 1, | |
| 'dateintervalvalidator.php' => 1, | |
| 'headerparamauth.php' => 1, | |
| 'normalize-0026-out.nq' => 1, | |
| 'normalize-0027-in.jsonld' => 1, | |
| 'normalize-0027-out.nq' => 1, | |
| 'normalize-0028-out.nq' => 1, | |
| 'normalize-0032-in.jsonld' => 1, | |
| 'x11-license' => 1, | |
| 'efullcalendar.php' => 1, | |
| 'mikemeierphpnodebridgebundle.php' => 1, | |
| 'mikemeiereasyauthbundle.php' => 1, | |
| 'simplexml_tests.json' => 1, | |
| 'normalize-0029-in.jsonld' => 1, | |
| 'normalize-0029-out.nq' => 1, | |
| 'normalize-0030-in.jsonld' => 1, | |
| 'normalize-0030-out.nq' => 1, | |
| 'normalize-0031-in.jsonld' => 1, | |
| 'normalize-0031-out.nq' => 1, | |
| 'translatable.php' => 1, | |
| 'normalize-0038-out.nq' => 1, | |
| 'google_tag.module' => 1, | |
| 'mzmailchimpbundle.php' => 1, | |
| 'msserializerbundle.php' => 1, | |
| 'sereal_spec.pod' => 1, | |
| 'readme.pod' => 1, | |
| 'rpcexception.php' => 1, | |
| 'msrpcbundle.php' => 1, | |
| 'msdoctrinetypesbundle.php' => 1, | |
| 'namespacing.php' => 1, | |
| 'mscachebundle.php' => 1, | |
| 'odin' => 1, | |
| 'mzpostmarkbundle.php' => 1, | |
| 'doctrinefixturesautonumberresetbundle.php' => 1, | |
| 'documenthash.php' => 1, | |
| 'std.include.php' => 1, | |
| 'normalize-0043-out.nq' => 1, | |
| 'travis_trigger' => 1, | |
| 'rdfmapper.php' => 1, | |
| 'normalize-0044-in.jsonld' => 1, | |
| 'normalize-0044-out.nq' => 1, | |
| 'normalize-0045-in.jsonld' => 1, | |
| 'normalize-0045-out.nq' => 1, | |
| 'normalize-0046-in.jsonld' => 1, | |
| 'normalize-0046-out.nq' => 1, | |
| 'normalize-0047-in.jsonld' => 1, | |
| 'mstestbundle.php' => 1, | |
| 'readabillity.php' => 1, | |
| 'wkhtmltopdf.php' => 1, | |
| 'normalize-0040-in.jsonld' => 1, | |
| 'pdfable.php' => 1, | |
| 'pdffile.php' => 1, | |
| 'packagescommand.php' => 1, | |
| 'packagecompressor.php' => 1, | |
| 'normalize-0039-in.jsonld' => 1, | |
| 'flushabledependency.php' => 1, | |
| 'attributedefaultspersister.php' => 1, | |
| 'rsa.php' => 1, | |
| 'noddy' => 1, | |
| 'normalize-0039-out.nq' => 1, | |
| 'normalize-0040-out.nq' => 1, | |
| 'mapgoogleasset.php' => 1, | |
| 'normalize-0041-in.jsonld' => 1, | |
| 'g2s' => 1, | |
| 'third-party' => 1, | |
| 'normalize-0041-out.nq' => 1, | |
| 'config-example.json' => 1, | |
| 'sshv' => 1, | |
| '.scruitnizer.yml' => 1, | |
| 'normalize-0042-in.jsonld' => 1, | |
| 'normalize-0042-out.nq' => 1, | |
| 'mapyandexasset.php' => 1, | |
| 'normalize-0043-in.jsonld' => 1, | |
| 'google_tag.links.menu.yml' => 1, | |
| 'google_tag.permissions.yml' => 1, | |
| 'normalize-0048-in.jsonld' => 1, | |
| 'vsymfopaymentegopaybundle.php' => 1, | |
| 'xdebugtraceextension.php' => 1, | |
| 'xdebugtrace.php' => 1, | |
| 'normalize-0009-out.nq' => 1, | |
| 'typeconverter.php' => 1, | |
| 'normalize-0010-in.jsonld' => 1, | |
| 'normalize-0010-out.nq' => 1, | |
| 'vsymfopaymentperfectmoneybundle.php' => 1, | |
| 'normalize-0011-in.jsonld' => 1, | |
| 'vsymfopaymentpayeerbundle.php' => 1, | |
| 'vsymfopaymentokpaybundle.php' => 1, | |
| 'vsymfopaymentblockchainbundle.php' => 1, | |
| 'normalize-0009-in.jsonld' => 1, | |
| 'normalize-0011-out.nq' => 1, | |
| 'rapidsitemap.xml' => 1, | |
| 'normalize-0012-in.jsonld' => 1, | |
| 'normalize-0012-out.nq' => 1, | |
| 'normalize-0013-in.jsonld' => 1, | |
| 'rapidimage.xml' => 1, | |
| 'normalize-0013-out.nq' => 1, | |
| 'rapidimage.php' => 1, | |
| 'nginx.conf.default' => 1, | |
| 'normalize-0014-in.jsonld' => 1, | |
| 'token.tokens.inc' => 1, | |
| 'content.latte' => 1, | |
| 'error.latte' => 1, | |
| 'normalize-0014-out.nq' => 1, | |
| 'mg-events.php' => 1, | |
| 'normalize-0006-in.jsonld' => 1, | |
| 'firephp.php' => 1, | |
| 'blogwidget.php' => 1, | |
| 'normalize-0006-out.nq' => 1, | |
| 'unbox-logo.png' => 1, | |
| 'normalize-0007-in.jsonld' => 1, | |
| 'composer_path.func.php' => 1, | |
| 'integrated.json' => 1, | |
| 'normalize-0007-out.nq' => 1, | |
| 'style-guide' => 1, | |
| 'mgeventsrequirements.php' => 1, | |
| 'normalize-0008-out.nq' => 1, | |
| 'mg-cache.php' => 1, | |
| 'mgcacherouting.php' => 1, | |
| 'mgcacherequirements.php' => 1, | |
| 'convert-os.php' => 1, | |
| 'convert-engine.php' => 1, | |
| 'convert-devices.php' => 1, | |
| 'convert-browser.php' => 1, | |
| 'normalize-0008-in.jsonld' => 1, | |
| 'manual.en' => 1, | |
| 'manual.cs' => 1, | |
| 'aliasexpander.php' => 1, | |
| 'token.services.yml' => 1, | |
| 'normalize-0015-in.jsonld' => 1, | |
| 'google_tag.routing.yml' => 1, | |
| '.travis-after-before-script.sh' => 1, | |
| 'redirect.info.yml' => 1, | |
| 'redirect.generate.inc' => 1, | |
| 'normalize-0021-in.jsonld' => 1, | |
| 'normalize-0021-out.nq' => 1, | |
| 'normalize-0022-in.jsonld' => 1, | |
| 'normalize-0022-out.nq' => 1, | |
| 'normalize-0023-in.jsonld' => 1, | |
| 'normalize-0023-out.nq' => 1, | |
| 'redirect.drush.inc' => 1, | |
| 'redirect.api.php' => 1, | |
| 'metatag.services.yml' => 1, | |
| 'redirect.install' => 1, | |
| 'metatag.routing.yml' => 1, | |
| 'metatag.permissions.yml' => 1, | |
| 'normalize-0024-in.jsonld' => 1, | |
| 'normalize-0024-out.nq' => 1, | |
| 'metatag.links.menu.yml' => 1, | |
| 'metatag.links.action.yml' => 1, | |
| 'normalize-0025-in.jsonld' => 1, | |
| 'metatag.install' => 1, | |
| 'normalize-0025-out.nq' => 1, | |
| 'metatag.info.yml' => 1, | |
| 'google_tag.services.yml' => 1, | |
| 'normalize-0020-out.nq' => 1, | |
| 'redirect.links.action.yml' => 1, | |
| 'normalize-0015-out.nq' => 1, | |
| 'token.libraries.yml' => 1, | |
| 'normalize-0016-in.jsonld' => 1, | |
| 'normalize-0016-out.nq' => 1, | |
| 'normalize-0017-in.jsonld' => 1, | |
| 'normalize-0017-out.nq' => 1, | |
| 'token.routing.yml' => 1, | |
| 'token.pages.inc' => 1, | |
| 'normalize-0018-in.jsonld' => 1, | |
| 'normalize-0018-out.nq' => 1, | |
| 'normalize-0019-in.jsonld' => 1, | |
| 'token.module' => 1, | |
| 'token.links.task.yml' => 1, | |
| 'token.install' => 1, | |
| 'normalize-0020-in.jsonld' => 1, | |
| 'token.info.yml' => 1, | |
| 'token.drush.inc' => 1, | |
| 'arrow-right.png' => 1, | |
| 'arrow-down.png' => 1, | |
| 'redirect.services.yml' => 1, | |
| 'redirect.routing.yml' => 1, | |
| 'redirect.permissions.yml' => 1, | |
| 'redirect.module' => 1, | |
| 'normalize-0019-out.nq' => 1, | |
| 'redirect.links.task.yml' => 1, | |
| 'redirect.links.menu.yml' => 1, | |
| 'normalize-0047-out.nq' => 1, | |
| 'normalize-0048-out.nq' => 1, | |
| 'normalize-0005-out.nq' => 1, | |
| 'deep_json_decode.php' => 1, | |
| 'tordf-0010-out.nq' => 1, | |
| 'search_json_index.php' => 1, | |
| 'tordf-0011-in.jsonld' => 1, | |
| 'rrmdir.php' => 1, | |
| 'read_file_lines.php' => 1, | |
| 'goto_dir.php' => 1, | |
| 'get_modified_files_since.php' => 1, | |
| 'get_json_index.php' => 1, | |
| 'get_json.php' => 1, | |
| 'get_directory_last_modified.php' => 1, | |
| 'tordf-0011-out.nq' => 1, | |
| 'set_json_index.php' => 1, | |
| 'tordf-0012-in.jsonld' => 1, | |
| 'copy_dir.php' => 1, | |
| 'tordf-0012-out.nq' => 1, | |
| 'tordf-0013-in.jsonld' => 1, | |
| 'tordf-0013-out.nq' => 1, | |
| 'tordf-0014-in.jsonld' => 1, | |
| 'tordf-0014-out.nq' => 1, | |
| 'tordf-0015-in.jsonld' => 1, | |
| 'platform-docker' => 1, | |
| 'drupalorg' => 1, | |
| 'tordf-0015-out.nq' => 1, | |
| 'set_json.php' => 1, | |
| 'sfile_get_contents.php' => 1, | |
| 'tordf-0016-out.nq' => 1, | |
| 'tordf-0007-in.jsonld' => 1, | |
| 'mseventdatabundle.php' => 1, | |
| 'phpunit-generator.php' => 1, | |
| 'tordf-0004-out.nq' => 1, | |
| 'geodb.sqlite' => 1, | |
| 'update.py' => 1, | |
| 'tordf-0005-in.jsonld' => 1, | |
| 'tordf-0005-out.nq' => 1, | |
| 'tordf-0006-in.jsonld' => 1, | |
| 'checker.py' => 1, | |
| 'tordf-0006-out.nq' => 1, | |
| 'tordf-0007-out.nq' => 1, | |
| 'sfile_put_contents.php' => 1, | |
| 'mhujerfioapibundle.php' => 1, | |
| 'tordf-0008-in.jsonld' => 1, | |
| 'mhormediainfobundle.php' => 1, | |
| 'tordf-0008-out.nq' => 1, | |
| 'diacriticsremover.php' => 1, | |
| 'secret_envs.sh.enc' => 1, | |
| 'tordf-0009-in.jsonld' => 1, | |
| 'composers.json' => 1, | |
| 'tordf-0009-out.nq' => 1, | |
| 'tordf-0010-in.jsonld' => 1, | |
| 'unzip.php' => 1, | |
| 'tordf-0016-in.jsonld' => 1, | |
| 'pushnotificationmanager.php' => 1, | |
| 'edible.yaml' => 1, | |
| 'tordf-0025-out.nq' => 1, | |
| 'tordf-0024-out.nq' => 1, | |
| 'castnumbertostringvalidator.php' => 1, | |
| 'jqueryserializeobjectasset.php' => 1, | |
| 'tordf-0025-in.jsonld' => 1, | |
| 'intllocaleasset.php' => 1, | |
| 'intlasset.php' => 1, | |
| 'disablecsrfvalidationfilter.php' => 1, | |
| 'httpexecute.php' => 1, | |
| 'run-single-test.sh' => 1, | |
| 'wrecker.yml' => 1, | |
| 'scratchpad' => 1, | |
| 'tordf-0024-in.jsonld' => 1, | |
| 'tordf-0026-in.jsonld' => 1, | |
| 'mzzbundle.php' => 1, | |
| 'jtimepickerasset.php' => 1, | |
| 'proto.php' => 1, | |
| 'tordf-0026-out.nq' => 1, | |
| 'e2e-test.bats' => 1, | |
| 'metrobundle.php' => 1, | |
| 'tordf-0027-in.jsonld' => 1, | |
| 'commandintegrator.php' => 1, | |
| 'tordf-0027-out.nq' => 1, | |
| 'tordf-0028-in.jsonld' => 1, | |
| 'euvatnumbervalidator.php' => 1, | |
| 'ibanvalidator.php' => 1, | |
| 'tordf-0017-in.jsonld' => 1, | |
| 'tordf-0019-in.jsonld' => 1, | |
| 'manticorapushnotificationbundle.php' => 1, | |
| 'manticorarestextrabundle.php' => 1, | |
| 'tordf-0017-out.nq' => 1, | |
| 'manticoraoauthbundle.php' => 1, | |
| 'manticoragooglefederatedloginbundle.php' => 1, | |
| 'tordf-0018-in.jsonld' => 1, | |
| 'tordf-0018-out.nq' => 1, | |
| 'manticoracmsbundle.php' => 1, | |
| 'mgiclassifiedsbundle.php' => 1, | |
| 'mgiblogbundle.php' => 1, | |
| 'lyraadminbundle.php' => 1, | |
| 'tordf-0023-out.nq' => 1, | |
| 'tordf-0019-out.nq' => 1, | |
| 'mgdebugbundle.php' => 1, | |
| 'mgblockbundle.php' => 1, | |
| 'tordf-0020-in.jsonld' => 1, | |
| 'jqgrid.png' => 1, | |
| 'tordf-0020-out.nq' => 1, | |
| 'mgpesmodelbundle.php' => 1, | |
| 'tordf-0022-in.jsonld' => 1, | |
| 'tordf-0022-out.nq' => 1, | |
| 'sfmducksboardbundle.php' => 1, | |
| 'tordf-0023-in.jsonld' => 1, | |
| 'msfrontcontrollersecuritybundle.php' => 1, | |
| 'tordf-0004-in.jsonld' => 1, | |
| 'normalize-0049-in.jsonld' => 1, | |
| 'normalize-0057-out.nq' => 1, | |
| 'normalize-0055-out.nq' => 1, | |
| 'normalize-0056-in.jsonld' => 1, | |
| 'dasliderasset.php' => 1, | |
| 'normalize-0056-out.nq' => 1, | |
| 'deletemultipleaction.php' => 1, | |
| 'actionbarasset.php' => 1, | |
| 'amwhoopsbundle.php' => 1, | |
| 'mickadoobasedatabundle.php' => 1, | |
| 'mickadooyamlapidocannotationbundle.php' => 1, | |
| 'normalize-0057-in.jsonld' => 1, | |
| 'normalize-manifest.jsonld' => 1, | |
| 'prowlclient.php' => 1, | |
| 'weedstorage.php' => 1, | |
| 'remote-doc-0001-in.jsonld' => 1, | |
| 'remote-doc-0001-out.jsonld' => 1, | |
| 'weedmanager.php' => 1, | |
| 'micjohnsonweedphpbundle.php' => 1, | |
| 'rbaccontroller.php' => 1, | |
| 'rbacconsolebootstrap.php' => 1, | |
| 'dutyconsole.php' => 1, | |
| 'remote-doc-0002-in.json' => 1, | |
| 'dutybootstrap.php' => 1, | |
| 'qr.php' => 1, | |
| 'micronaxprowlbundle.php' => 1, | |
| 'checkout.php' => 1, | |
| 'qrbundle.php' => 1, | |
| 'phpcs.php' => 1, | |
| 'mgdschema.php' => 1, | |
| 'normalize-0049-out.nq' => 1, | |
| 'application.yml' => 1, | |
| 'normalize-0050-in.jsonld' => 1, | |
| 'normalize-0050-out.nq' => 1, | |
| 'normalize-0051-in.jsonld' => 1, | |
| 'normalize-0051-out.nq' => 1, | |
| 'normalize-0052-in.jsonld' => 1, | |
| 'normalize-0052-out.nq' => 1, | |
| 'normalize-0053-in.jsonld' => 1, | |
| 'normalize-0053-out.nq' => 1, | |
| 'clean.php' => 1, | |
| 'text_page.php' => 1, | |
| 'template_settings.php' => 1, | |
| 'normalize-0054-in.jsonld' => 1, | |
| 'template_settings.css' => 1, | |
| 'mw_sql_restore.sql' => 1, | |
| 'normalize-0054-out.nq' => 1, | |
| 'mw_default_content.zip' => 1, | |
| 'inner.php' => 1, | |
| 'normalize-0055-in.jsonld' => 1, | |
| 'header_options.php' => 1, | |
| 'contacts.php' => 1, | |
| 'remote-doc-0002-out.jsonld' => 1, | |
| 'commerce_profile.profile' => 1, | |
| 'cmap' => 1, | |
| 'tordf-0001-out.nq' => 1, | |
| 'remote-doc-0011-out.jsonld' => 1, | |
| 'remote-doc-0012-context1.jsonld' => 1, | |
| 'remote-doc-0012-context2.jsonld' => 1, | |
| 'remote-doc-0012-in.json' => 1, | |
| 'forumnode.php' => 1, | |
| 'catnode.php' => 1, | |
| 'cathierarchy.php' => 1, | |
| 'remote-doc-manifest.jsonld' => 1, | |
| 'tordf-0001-in.jsonld' => 1, | |
| 'blacklist' => 1, | |
| 'tordf-0002-in.jsonld' => 1, | |
| 'remote-doc-0011-context.jsonld' => 1, | |
| 'phpunit.cov.xml' => 1, | |
| 'xmlrepeater.php' => 1, | |
| 'tordf-0002-out.nq' => 1, | |
| 'xmldecoratorinterface.php' => 1, | |
| 'documentation_guideline' => 1, | |
| 'tordf-0003-in.jsonld' => 1, | |
| 'tordf-0003-out.nq' => 1, | |
| 'admin-page-framework-loader.php' => 1, | |
| 'aretusaflashbundle.php' => 1, | |
| '.remarkrc' => 1, | |
| 'cmap.php' => 1, | |
| 'remote-doc-0011-in.jldt' => 1, | |
| 'hierarchynode.php' => 1, | |
| 'commerce_profile.links.menu.yml' => 1, | |
| 'bccmyrrixbundle.php' => 1, | |
| 'commerce_profile.install' => 1, | |
| 'remote-doc-0003-in.jldt' => 1, | |
| 'remote-doc-0003-out.jsonld' => 1, | |
| 'remote-doc-0004-in.jldte' => 1, | |
| 'commerce_profile.info.yml' => 1, | |
| 'remote-doc-0009-context.jsonld' => 1, | |
| 'michelvdoctrinecachesweeperbundle.php' => 1, | |
| 'cachesweeper.php' => 1, | |
| 'cachesweepableinterface.php' => 1, | |
| 'remote-doc-0009-in.jsonld' => 1, | |
| 'myrrix.jar' => 1, | |
| 'bccextratoolsbundle.php' => 1, | |
| 'ihierarchynode.php' => 1, | |
| 'remote-doc-0009-out.jsonld' => 1, | |
| 'remote-doc-0010-context.jsonld' => 1, | |
| 'remote-doc-0010-in.json' => 1, | |
| 'remote-doc-0010-out.jsonld' => 1, | |
| 'bccautomapperbundle.php' => 1, | |
| 'epsjqgridbundle.php' => 1, | |
| 'betterdd_example.png' => 1, | |
| 'teamcity-clover.php' => 1, | |
| 'teamcity-clover' => 1, | |
| 'oauth2servermongodbbundle.php' => 1, | |
| 'git.aws-push.php' => 1, | |
| 'symfonycommands.php' => 1, | |
| 'normalize-0005-in.jsonld' => 1, | |
| 'cform.php' => 1, | |
| 'frame-0001-in.jsonld' => 1, | |
| 'flatten-0044-context.jsonld' => 1, | |
| 'flatten-0044-in.jsonld' => 1, | |
| 'flatten-0044-out.jsonld' => 1, | |
| 'flatten-0045-in.jsonld' => 1, | |
| 'flatten-0045-out.jsonld' => 1, | |
| 'flatten-0046-in.jsonld' => 1, | |
| 'flatten-0046-out.jsonld' => 1, | |
| 'flatten-manifest.jsonld' => 1, | |
| 'frame-0001-frame.jsonld' => 1, | |
| 'spring.jpg' => 1, | |
| 'pdatepicker.js' => 1, | |
| 'summer.jpg' => 1, | |
| 'frame-0001-out.jsonld' => 1, | |
| 'frame-0002-frame.jsonld' => 1, | |
| 'frame-0002-in.jsonld' => 1, | |
| 'frame-0002-out.jsonld' => 1, | |
| 'frame-0003-frame.jsonld' => 1, | |
| 'frame-0003-in.jsonld' => 1, | |
| 'frame-0003-out.jsonld' => 1, | |
| 'frame-0004-frame.jsonld' => 1, | |
| 'frame-0004-in.jsonld' => 1, | |
| 'frame-0004-out.jsonld' => 1, | |
| 'pdatepicker.css' => 1, | |
| 'flatten-0043-out.jsonld' => 1, | |
| 'winter.jpg' => 1, | |
| 'frame-0005-frame.jsonld' => 1, | |
| 'flatten-0040-in.jsonld' => 1, | |
| 'flatten-0038-out.jsonld' => 1, | |
| 'dssmarty.php' => 1, | |
| 'smarty_compiler.class.php' => 1, | |
| 'config_file.class.php' => 1, | |
| 'test-json.php' => 1, | |
| 'harbour' => 1, | |
| 'phake.zsh-completion' => 1, | |
| 'flatten-0039-in.jsonld' => 1, | |
| 'flatten-0039-out.jsonld' => 1, | |
| 'phake' => 1, | |
| 'basgeneratorbundle.php' => 1, | |
| 'tst' => 1, | |
| 'fixturesgeneratorbundle.php' => 1, | |
| 'flatten-0040-out.jsonld' => 1, | |
| 'flatten-0041-in.jsonld' => 1, | |
| 'flatten-0041-out.jsonld' => 1, | |
| 'flatten-0042-in.jsonld' => 1, | |
| 'flatten-0042-out.jsonld' => 1, | |
| 'mohebifardatetimebundle.php' => 1, | |
| 'mohebifarcalendarbundle.php' => 1, | |
| 'meisaratingbundle.php' => 1, | |
| 'flatten-0043-in.jsonld' => 1, | |
| 'meisamenubundle.php' => 1, | |
| 'autumn.jpg' => 1, | |
| 'jqueryticker.js' => 1, | |
| 'xmlfeed.php' => 1, | |
| 'moderaconfigbundle.php' => 1, | |
| 'moderalanguagesbundle.php' => 1, | |
| 'moderafoundationbundle.php' => 1, | |
| 'moderafileuploaderbundle.php' => 1, | |
| 'moderafilerepositorybundle.php' => 1, | |
| 'moderadynamicallyconfigurablemjrbundle.php' => 1, | |
| 'frame-0007-frame.jsonld' => 1, | |
| 'moderadynamicallyconfigurableappbundle.php' => 1, | |
| 'frame-0007-in.jsonld' => 1, | |
| 'kernelconfig.php' => 1, | |
| 'moderadirectbundle.php' => 1, | |
| 'moderabackendtranslationstoolbundle.php' => 1, | |
| 'moderamjrsecurityintegrationbundle.php' => 1, | |
| 'moderabackendtoolssettingsbundle.php' => 1, | |
| 'frame-0007-out.jsonld' => 1, | |
| 'frame-0008-frame.jsonld' => 1, | |
| 'frame-0008-in.jsonld' => 1, | |
| 'frame-0008-out.jsonld' => 1, | |
| 'moderabackendtoolsbundle.php' => 1, | |
| 'moderabackendtoolsactivitylogbundle.php' => 1, | |
| 'moderabackendsecuritybundle.php' => 1, | |
| 'moderabackendonsteroidsbundle.php' => 1, | |
| 'moderabackendmodulebundle.php' => 1, | |
| 'frame-0009-frame.jsonld' => 1, | |
| 'moderamjrcacheawareclassloaderbundle.php' => 1, | |
| 'moderamjrthemeintegrationbundle.php' => 1, | |
| 'specshapercalendarbundle.php' => 1, | |
| 'circleci.modx.config.xml' => 1, | |
| 'necktie-v0.4-alpha.jpg' => 1, | |
| 'frame-0005-in.jsonld' => 1, | |
| 'frame-0005-out.jsonld' => 1, | |
| 'widgetsbundle.php' => 1, | |
| 'passthroughnamingstrategy.php' => 1, | |
| 'frame-0006-frame.jsonld' => 1, | |
| 'trinitynotificationbundle.php' => 1, | |
| 'frame-0006-in.jsonld' => 1, | |
| 'frame-0006-out.jsonld' => 1, | |
| 'loggerbundle.php' => 1, | |
| 'modernfactoryresourcesbundle.php' => 1, | |
| 'moderamjrintegrationbundle.php' => 1, | |
| 'mcloud.yml' => 1, | |
| 'mf-upgrade-3.0' => 1, | |
| '.mcignore' => 1, | |
| 'versions.json' => 1, | |
| 'moderaupgradebundle.php' => 1, | |
| 'moderatranslationsbundle.php' => 1, | |
| 'moderaservercrudbundle.php' => 1, | |
| 'moderasecuritybundle.php' => 1, | |
| 'moderaroutingbundle.php' => 1, | |
| 'moderanotificationbundle.php' => 1, | |
| 'moderamodulebundle.php' => 1, | |
| 'basexmlpipe.php' => 1, | |
| 'mongrate' => 1, | |
| 'moderabackendlanguagesbundle.php' => 1, | |
| 'flatten-0019-out.jsonld' => 1, | |
| 'class.ooyalaapiconfig.php' => 1, | |
| 'flatten-0016-in.jsonld' => 1, | |
| 'flatten-0016-out.jsonld' => 1, | |
| 'disqus.yml' => 1, | |
| 'flatten-0017-in.jsonld' => 1, | |
| 'morbicerconverterbundle.php' => 1, | |
| 'flatten-0017-out.jsonld' => 1, | |
| 'flatten-0018-in.jsonld' => 1, | |
| 'flatten-0018-out.jsonld' => 1, | |
| 'flatten-0019-in.jsonld' => 1, | |
| 'flatten-0020-in.jsonld' => 1, | |
| 'class.ooyaladownloader.php' => 1, | |
| 'flatten-0020-out.jsonld' => 1, | |
| 'flatten-0021-in.jsonld' => 1, | |
| 'flatten-0021-out.jsonld' => 1, | |
| 'flatten-0022-in.jsonld' => 1, | |
| 'flatten-0022-out.jsonld' => 1, | |
| 'skybot.php' => 1, | |
| 'flatten-0023-in.jsonld' => 1, | |
| 'flatten-0023-out.jsonld' => 1, | |
| 'config.yml.sample' => 1, | |
| 'flatten-0024-in.jsonld' => 1, | |
| 'flatten-0024-out.jsonld' => 1, | |
| 'flatten-0015-out.jsonld' => 1, | |
| 'sdk' => 1, | |
| 'flatten-0025-out.jsonld' => 1, | |
| 'flatten-0012-in.jsonld' => 1, | |
| 'morusacceticbundle.php' => 1, | |
| 'flatten-0007-out.jsonld' => 1, | |
| 'flatten-0008-in.jsonld' => 1, | |
| 'flatten-0008-out.jsonld' => 1, | |
| 'flatten-0009-in.jsonld' => 1, | |
| 'flatten-0009-out.jsonld' => 1, | |
| 'flatten-0010-in.jsonld' => 1, | |
| 'flatten-0010-out.jsonld' => 1, | |
| 'flatten-0011-in.jsonld' => 1, | |
| 'flatten-0011-out.jsonld' => 1, | |
| 'bootstrap.php.example' => 1, | |
| 'morkibouncebundle.php' => 1, | |
| 'flatten-0012-out.jsonld' => 1, | |
| 'example.build.properties' => 1, | |
| 'flatten-0013-in.jsonld' => 1, | |
| 'flatten-0013-out.jsonld' => 1, | |
| 'build.base.properties' => 1, | |
| 'flatten-0014-in.jsonld' => 1, | |
| 'genericselect.php' => 1, | |
| 'genericlibevent.php' => 1, | |
| 'flatten-0014-out.jsonld' => 1, | |
| 'mttdoctrinetoemberbundle.php' => 1, | |
| 'flatten-0015-in.jsonld' => 1, | |
| 'flatten-0025-in.jsonld' => 1, | |
| 'async.php' => 1, | |
| 'advanced_html_dom.php' => 1, | |
| 'monstrumsymfonycropboxbundle.php' => 1, | |
| 'flatten-0032-out.jsonld' => 1, | |
| 'flatten-0033-in.jsonld' => 1, | |
| 'flatten-0033-out.jsonld' => 1, | |
| '.travis.dist.yml' => 1, | |
| 'bvtestbundle.php' => 1, | |
| 'flatten-0034-in.jsonld' => 1, | |
| 'flatten-0034-out.jsonld' => 1, | |
| 'monstrumsymfonyjcropbundle.php' => 1, | |
| 'monstrumsymfonydropzonebundle.php' => 1, | |
| 'flatten-0035-in.jsonld' => 1, | |
| 'flatten-0035-out.jsonld' => 1, | |
| 'autogrow.php' => 1, | |
| 'flatten-0036-in.jsonld' => 1, | |
| 'mechantsimplemailerbundle.php' => 1, | |
| 'flatten-0036-out.jsonld' => 1, | |
| 'flatten-0037-in.jsonld' => 1, | |
| 'envy.json' => 1, | |
| 'gentry' => 1, | |
| 'sinyamazonproductadvertisingapibundle.php' => 1, | |
| 'flatten-0037-out.jsonld' => 1, | |
| 'phpuri.php' => 1, | |
| 'pgbrowser.php' => 1, | |
| 'flatten-0038-in.jsonld' => 1, | |
| 'flatten-0032-in.jsonld' => 1, | |
| 'autogrowinput.php' => 1, | |
| 'amtelcomusersbundle.php' => 1, | |
| 'mops1kapibundle.php' => 1, | |
| 'flatten-0026-in.jsonld' => 1, | |
| 'flatten-0026-out.jsonld' => 1, | |
| 'flatten-0027-in.jsonld' => 1, | |
| 'mops1ktwbsbundle.php' => 1, | |
| 'flatten-0027-out.jsonld' => 1, | |
| 'jmdsettingsbundle.php' => 1, | |
| 'flatten-0028-in.jsonld' => 1, | |
| 'flatten-0028-out.jsonld' => 1, | |
| 'security.yml.dist' => 1, | |
| 'amtelcomloginbundle.php' => 1, | |
| 'flatten-0029-in.jsonld' => 1, | |
| 'flatten-0029-out.jsonld' => 1, | |
| 'flatten-0031-out.jsonld' => 1, | |
| 'apiservice.yml.dist' => 1, | |
| 'compact-0043-context.jsonld' => 1, | |
| 'flatten-0030-out.jsonld' => 1, | |
| 'jmdrestbundle.php' => 1, | |
| 'optimisticlockvalidator.php' => 1, | |
| 'flatten-0031-in.jsonld' => 1, | |
| 'slughelper.php' => 1, | |
| 'typeaheadplugin.php' => 1, | |
| 'datepickerplugin.php' => 1, | |
| 'basepicker.php' => 1, | |
| 'autogrowplugin.php' => 1, | |
| 'frame-0009-in.jsonld' => 1, | |
| 'frame-0009-out.jsonld' => 1, | |
| 'normalize-0004-out.nq' => 1, | |
| '.phpmd-ruleset.xml' => 1, | |
| 'multibehavior.php' => 1, | |
| 'multiasset.php' => 1, | |
| 'addrowaction.php' => 1, | |
| 'pinba.png' => 1, | |
| 'ko-package' => 1, | |
| 'ko' => 1, | |
| 'misteiocloudinarybundle.php' => 1, | |
| 'fromrdf-0008-out.jsonld' => 1, | |
| 'fromrdf-0009-in.nq' => 1, | |
| 'fromrdf-0009-out.jsonld' => 1, | |
| 'bootstrap.netteforms.js' => 1, | |
| 'fromrdf-0008-in.nq' => 1, | |
| 'fromrdf-0010-in.nq' => 1, | |
| 'stylemanager.php' => 1, | |
| 'scriptmanager.php' => 1, | |
| 'fromrdf-0010-out.jsonld' => 1, | |
| 'fromrdf-0011-in.nq' => 1, | |
| 'istylemanager.php' => 1, | |
| 'iscriptmanager.php' => 1, | |
| '@styles.latte' => 1, | |
| '@scripts.latte' => 1, | |
| 'sheet.php' => 1, | |
| 'iextractor.php' => 1, | |
| 'jpark.komodoproject' => 1, | |
| 'amchart.php' => 1, | |
| 'fromrdf-0011-out.jsonld' => 1, | |
| 'example-cli-formats.php' => 1, | |
| 'fromrdf-0005-out.jsonld' => 1, | |
| 'fromrdf-0006-in.nq' => 1, | |
| 'alipaywapconfig.php' => 1, | |
| 'alipaywap.php' => 1, | |
| 'xlsxwriter.class.php' => 1, | |
| 'fromrdf-0006-out.jsonld' => 1, | |
| 'fromrdf-0007-in.nq' => 1, | |
| 'example-cli.php' => 1, | |
| 'example-cli-merge-cells.php' => 1, | |
| 'example-cli-load.php' => 1, | |
| 'filenamer.php' => 1, | |
| 'ammap.php' => 1, | |
| 'config_file_breadcrumbs.php' => 1, | |
| 'codesniffer_git_install.sh' => 1, | |
| 'loggerawaretrait.php' => 1, | |
| 'loggerawarebundle.php' => 1, | |
| 'hotfix.php' => 1, | |
| 'polymer.php' => 1, | |
| 'basepolymer.php' => 1, | |
| 'regionasset.php' => 1, | |
| 'leancloud.php' => 1, | |
| 'fromrdf-0007-out.jsonld' => 1, | |
| 'ammapasset.php' => 1, | |
| 'grouper.php' => 1, | |
| 'fromrdf-0012-in.nq' => 1, | |
| 'kdtclient.php' => 1, | |
| 'sg_ical.php' => 1, | |
| 'fromrdf-0020-in.nq' => 1, | |
| 'fromrdf-0020-out.jsonld' => 1, | |
| 'fromrdf-0021-in.nq' => 1, | |
| 'fromrdf-0021-out.jsonld' => 1, | |
| 'fromrdf-0022-in.nq' => 1, | |
| 'fromrdf-0022-out.jsonld' => 1, | |
| 'metaactiverecord.php' => 1, | |
| 'fromrdf-manifest.jsonld' => 1, | |
| 'doctrine_inflector.php' => 1, | |
| 'smartthink.php' => 1, | |
| 'normalize-0001-in.jsonld' => 1, | |
| 'fromrdf-0019-in.nq' => 1, | |
| 'normalize-0001-out.nq' => 1, | |
| 'normalize-0002-in.jsonld' => 1, | |
| 'normalize-0002-out.nq' => 1, | |
| 'phpjasperxmlsubreport.inc.php' => 1, | |
| 'phpjasperxml.inc.php' => 1, | |
| 'potter-orm.iml' => 1, | |
| 'minima-php.iml' => 1, | |
| 'normalize-0003-in.jsonld' => 1, | |
| 'normalize-0003-out.nq' => 1, | |
| 'normalize-0004-in.jsonld' => 1, | |
| 'recaptcha.png' => 1, | |
| 'fromrdf-0019-out.jsonld' => 1, | |
| 'fromrdf-0018-out.jsonld' => 1, | |
| 'misdravenbundle.php' => 1, | |
| 'md.sh' => 1, | |
| 'projectlightbundle.php' => 1, | |
| 'misdphonenumberbundle.php' => 1, | |
| 'fromrdf-0012-out.jsonld' => 1, | |
| 'fromrdf-0013-in.nq' => 1, | |
| 'misdmockravenservicebundle.php' => 1, | |
| 'misdlinkifybundle.php' => 1, | |
| 'fromrdf-0013-out.jsonld' => 1, | |
| 'misdhighchartsbundle.php' => 1, | |
| 'phpunit.vagrant.sh' => 1, | |
| 'autoloadtest.php' => 1, | |
| 'permissions' => 1, | |
| 'fromrdf-0018-in.nq' => 1, | |
| 'fromrdf-0014-in.nq' => 1, | |
| 'fromrdf-0014-out.jsonld' => 1, | |
| 'my.php' => 1, | |
| 'mmigration.php' => 1, | |
| 'threadunit' => 1, | |
| 'fromrdf-0015-in.nq' => 1, | |
| 'fromrdf-0015-out.jsonld' => 1, | |
| 'fromrdf-0016-in.nq' => 1, | |
| 'fromrdf-0016-out.jsonld' => 1, | |
| 'fromrdf-0017-in.nq' => 1, | |
| 'fromrdf-0017-out.jsonld' => 1, | |
| 'jsapi.php' => 1, | |
| 'fromrdf-0005-in.nq' => 1, | |
| 'frame-0010-frame.jsonld' => 1, | |
| 'mjmkrumobundle.php' => 1, | |
| 'frame-0014-out.jsonld' => 1, | |
| 'paging-demo.php' => 1, | |
| 'screen.gif' => 1, | |
| 'srfdatadogstatsdbundle.php' => 1, | |
| 'srfezlegacydebugbundle.php' => 1, | |
| 'srfcloudstackclientbundle.php' => 1, | |
| 'mysqlpdohelper.php' => 1, | |
| 'logginghelper.php' => 1, | |
| 'frame-0015-frame.jsonld' => 1, | |
| 'frame-0015-in.jsonld' => 1, | |
| 'dtcgridbundle.php' => 1, | |
| 'frame-0014-frame.jsonld' => 1, | |
| 'dependentbundleinterface.php' => 1, | |
| 'cachedbundledependenciesresolver.php' => 1, | |
| 'bundlestacknotcacheableexception.php' => 1, | |
| 'bundledependenciesresolver.php' => 1, | |
| 'httpheadersbundle.php' => 1, | |
| 'spotifyapibundle.php' => 1, | |
| 'rsqueueevents.php' => 1, | |
| 'rsqueuebundle.php' => 1, | |
| 'upgrade-3' => 1, | |
| 'formfillerbundle.php' => 1, | |
| 'frame-0015-out.jsonld' => 1, | |
| 'frame-0014-in.jsonld' => 1, | |
| 'frame-0013-out.jsonld' => 1, | |
| 'cacheflushevents.php' => 1, | |
| 'file-created-after-1.0.0-tagged-already' => 1, | |
| 'moderabackendgoogleanalyticsconfigbundle.php' => 1, | |
| 'frame-0010-in.jsonld' => 1, | |
| 'moderabackendgoogleanalyticsbundle.php' => 1, | |
| 'frame-0010-out.jsonld' => 1, | |
| 'moderabackenddashboardbundle.php' => 1, | |
| 'frame-0011-frame.jsonld' => 1, | |
| 'frame-0011-in.jsonld' => 1, | |
| 'moderabackendconfigutilsbundle.php' => 1, | |
| 'moderaactivityloggerbundle.php' => 1, | |
| 'frame-0011-out.jsonld' => 1, | |
| 'persistentpest.php' => 1, | |
| 'frame-0013-in.jsonld' => 1, | |
| 'frame-0012-frame.jsonld' => 1, | |
| 'example_form.html' => 1, | |
| 'example_balance.php' => 1, | |
| 'frame-0012-in.jsonld' => 1, | |
| 'mobilecarthwioauthbundle.php' => 1, | |
| 'frame-0012-out.jsonld' => 1, | |
| 'mobilecartelasticsearch17bundle.php' => 1, | |
| 'mobilecartcorebundle.php' => 1, | |
| 'frame-0013-frame.jsonld' => 1, | |
| 'mobilecartdummypaymentbundle.php' => 1, | |
| 'moactionjsonrpcbundle.php' => 1, | |
| 'controllerextrabundle.php' => 1, | |
| 'frame-0016-frame.jsonld' => 1, | |
| 'fromrdf-0004-out.jsonld' => 1, | |
| 'frame-0021-in.jsonld' => 1, | |
| 'frame-0019-out.jsonld' => 1, | |
| 'frame-0020-frame.jsonld' => 1, | |
| 'readme_pt-br' => 1, | |
| 'palantyr.php.zip' => 1, | |
| 'frame-0020-in.jsonld' => 1, | |
| 'completer.php' => 1, | |
| 'sc-bootstrap.php' => 1, | |
| 'frame-0020-out.jsonld' => 1, | |
| 'colorsystems.php' => 1, | |
| 'frame-0021-frame.jsonld' => 1, | |
| 'frame-0021-out.jsonld' => 1, | |
| 'analyze.xml' => 1, | |
| 'frame-manifest.jsonld' => 1, | |
| 'fromrdf-0001-in.nq' => 1, | |
| 'fromrdf-0001-out.jsonld' => 1, | |
| 'fromrdf-0002-in.nq' => 1, | |
| 'fromrdf-0002-out.jsonld' => 1, | |
| 'dataurlhandler.php' => 1, | |
| 'fromrdf-0003-in.nq' => 1, | |
| 'fromrdf-0003-out.jsonld' => 1, | |
| 'fromrdf-0004-in.nq' => 1, | |
| 'phplinq.php' => 1, | |
| 'missing_types.hhi' => 1, | |
| 'crane' => 1, | |
| 'composer-mini.xml' => 1, | |
| 'cacheflushbundle.php' => 1, | |
| 'mmanos-laravel' => 1, | |
| 'shim.php' => 1, | |
| 'screenshots' => 1, | |
| 'frame-0016-in.jsonld' => 1, | |
| 'licencia' => 1, | |
| 'textareatokensasset.php' => 1, | |
| 'textareatokens.php' => 1, | |
| 'frame-0016-out.jsonld' => 1, | |
| 'frame-0017-frame.jsonld' => 1, | |
| 'smartimagefieldasset.php' => 1, | |
| 'smartimagefield.php' => 1, | |
| 'imageuploadaction.php' => 1, | |
| 'ip-lib.php' => 1, | |
| 'frame-0019-in.jsonld' => 1, | |
| 'frame-0017-in.jsonld' => 1, | |
| 'frame-0017-out.jsonld' => 1, | |
| 'mloconsolebundle.php' => 1, | |
| 'frame-0018-frame.jsonld' => 1, | |
| 'validate-commit' => 1, | |
| 'frame-0018-in.jsonld' => 1, | |
| 'validate.xml' => 1, | |
| 'frame-0018-out.jsonld' => 1, | |
| 'frame-0019-frame.jsonld' => 1, | |
| 'symfony.xml' => 1, | |
| 'phpant.xml' => 1, | |
| 'expand-0038-in.jsonld' => 1, | |
| 'remainingcharacters.php' => 1, | |
| 'compact-0071-context.jsonld' => 1, | |
| 'adminbundle.php' => 1, | |
| 'build.sample.xml' => 1, | |
| 'floicon.php' => 1, | |
| 'jimicon.php' => 1, | |
| 'build_extensions.php' => 1, | |
| 'blob.php' => 1, | |
| 'baseconfighelper.php' => 1, | |
| 'config_sample.php' => 1, | |
| 'accountbundle.php' => 1, | |
| 'oidnuswalletbundle.php' => 1, | |
| 'oidnusadminthemebundle.php' => 1, | |
| 'ol.js' => 1, | |
| 'phpunit-test-checker.json' => 1, | |
| 'ol.css' => 1, | |
| 'bundlecontainer.php' => 1, | |
| 'ol-debug.js' => 1, | |
| '.htmlhintrc' => 1, | |
| '.html-minifier.conf' => 1, | |
| 'sample_print.png' => 1, | |
| 'dbawareinterface.php' => 1, | |
| 'dbawaretrait.php' => 1, | |
| 'filesystemawareinterface.php' => 1, | |
| 'filesystemawaretrait.php' => 1, | |
| 'phpunit-test-checker.php' => 1, | |
| 'homesteader' => 1, | |
| 'phonehelper.php' => 1, | |
| 'menuwidget.php' => 1, | |
| 'juliusrefererbundle.php' => 1, | |
| 'ocs_init.php' => 1, | |
| 'bootstrap.inc' => 1, | |
| 'migraine.yml.dist' => 1, | |
| 'fs.inc' => 1, | |
| 'alicephpmodule.php' => 1, | |
| 'frontendcontentbundle.php' => 1, | |
| 'sliderwidget.php' => 1, | |
| 'testconfig.php' => 1, | |
| 'callback-queue-example.php' => 1, | |
| 'levelwidget.php' => 1, | |
| 'cron.yaml' => 1, | |
| 'axismodule.php' => 1, | |
| 'clip' => 1, | |
| 'example.di.php' => 1, | |
| 'example.silex.php' => 1, | |
| 'okapondoctrinesettypebundle.php' => 1, | |
| 'sniff.sh' => 1, | |
| 'timeago.inc.php' => 1, | |
| 'openjournalsoftwarebibtexbundle.php' => 1, | |
| 'westsworld.datetime.class.php' => 1, | |
| 'queue.yaml' => 1, | |
| 'requestawareinterface.php' => 1, | |
| 'clear-cache-for-timber.php' => 1, | |
| 'juliusboilerplatebundle.php' => 1, | |
| 'cat.tpl' => 1, | |
| 'position.php' => 1, | |
| 'menu.json' => 1, | |
| 'run.php.default' => 1, | |
| 'xlsxreader.php' => 1, | |
| 'mark.tpl' => 1, | |
| 'find.tpl' => 1, | |
| 'filters.tpl' => 1, | |
| 'filters.layer.json' => 1, | |
| 'extend.tpl' => 1, | |
| 'catalog.layer.json' => 1, | |
| 'test_intset.php' => 1, | |
| 'position.tpl' => 1, | |
| 'schema.mysql.sql' => 1, | |
| 'ripcord_server.php' => 1, | |
| 'ripcord_client.php' => 1, | |
| 'ripcord.php' => 1, | |
| 'test_map_string_int.php' => 1, | |
| 'test_map_timeuuid_boolean.php' => 1, | |
| 'test_map_uuid_string.php' => 1, | |
| 'rabbit' => 1, | |
| 'odiseoprojectbundle.php' => 1, | |
| 'odiseobackendbundle.php' => 1, | |
| 'sample-nginx.conf' => 1, | |
| 'sample-apache.htaccess' => 1, | |
| 'ogiencodpwdcommandbundle.php' => 1, | |
| 'search.tpl' => 1, | |
| 'requestawaretrait.php' => 1, | |
| 'gshoppingcontent.php' => 1, | |
| 'deckard.yml.dist' => 1, | |
| 'routeawareinterface.php' => 1, | |
| 'routeawaretrait.php' => 1, | |
| 'deckard' => 1, | |
| 'httpapplication.php' => 1, | |
| 'objectmanagerawareinterface.php' => 1, | |
| 'stat.tpl' => 1, | |
| 'seo.json' => 1, | |
| 'rubrics.tpl' => 1, | |
| 'nousite.sh' => 1, | |
| 'objectmanagerawaretrait.php' => 1, | |
| 'rubrics.php' => 1, | |
| 'restfulbundle.php' => 1, | |
| 'producers.tpl' => 1, | |
| 'producers.schema.json' => 1, | |
| 'jit.php' => 1, | |
| 'jjanviercrowdinbundle.php' => 1, | |
| 'routes_cached.php' => 1, | |
| 'producers.php' => 1, | |
| 'ext.slow_page_logger.php' => 1, | |
| 'exemple.conf' => 1, | |
| 'juliusframeworkextrabundle.php' => 1, | |
| 'nokogiri.php' => 1, | |
| '.nikki.yml' => 1, | |
| 'hybridauth.readme' => 1, | |
| 'treedropdownlist.php' => 1, | |
| 'drupalbase.routing.yml' => 1, | |
| 'treearrayhelper.php' => 1, | |
| 'listgroupwidget.php' => 1, | |
| 'drupalbase.services.yml' => 1, | |
| 'drupalbase.themehook.yml' => 1, | |
| 'listgroupasset.php' => 1, | |
| 'drupalbase.themesuggestions.yml' => 1, | |
| 'screenshotmachine.class.php' => 1, | |
| 'calculate' => 1, | |
| 'list_files.php' => 1, | |
| 'drupalbase.module' => 1, | |
| 'onceitraygunbundle.php' => 1, | |
| 'yz.php' => 1, | |
| 'vagrant.yaml.dist' => 1, | |
| 'admintinymceasset.php' => 1, | |
| 'skiprowexception.php' => 1, | |
| 'interruptimportexception.php' => 1, | |
| 'importform.php' => 1, | |
| 'phpstorm_reference_card.pdf' => 1, | |
| 'batchimportaction.php' => 1, | |
| 'validationform.php' => 1, | |
| 'treenamecolumn.php' => 1, | |
| 'drupalbase.info.yml' => 1, | |
| 'phpstorm_workshop.pptx' => 1, | |
| 'askme-compose.json' => 1, | |
| 'jessedevcartcomponentbundle.php' => 1, | |
| 'scheduler.sh.example' => 1, | |
| 'magicutils.php' => 1, | |
| 'magicutilstraits.php' => 1, | |
| 'ongair.php' => 1, | |
| 'manual.php' => 1, | |
| 'logrotate.sh' => 1, | |
| 'activator.php' => 1, | |
| '.env.template' => 1, | |
| 'maigcutilstest.php' => 1, | |
| 'adiboxcachebundle.php' => 1, | |
| 'php_compat.php' => 1, | |
| 'classyfile' => 1, | |
| 'bencode.php' => 1, | |
| 'baseapibundle.php' => 1, | |
| 'servable.php' => 1, | |
| 'bencodetest.php' => 1, | |
| 'valiantasset.php' => 1, | |
| 'phonewidget.php' => 1, | |
| 'treeorderwidgetasset.php' => 1, | |
| 'jsontest.php' => 1, | |
| 'treeorderwidget.php' => 1, | |
| 'treeordermodeltrait.php' => 1, | |
| 'phpstorm_workshop.pdf' => 1, | |
| 'geobehavior.php' => 1, | |
| 'olarabbitmqadmintoolkitbundle.php' => 1, | |
| 'yona-cms.sql' => 1, | |
| 'ohcolorpickertypebundle.php' => 1, | |
| 'olix21calendarbundle.php' => 1, | |
| 'o80-i18n.iml' => 1, | |
| 'guerriatmetricsbundle.php' => 1, | |
| 'gmapbundle.php' => 1, | |
| 'headers-json.php' => 1, | |
| 'git-submodule.sh' => 1, | |
| 'm150929_122401_settings.php' => 1, | |
| 'settingscomponent.php' => 1, | |
| 'proplogic.class.php' => 1, | |
| 'thanks.php' => 1, | |
| 'ohemojibundle.php' => 1, | |
| 'proudfieldfacebookbundle.php' => 1, | |
| 'sample_loca.php' => 1, | |
| 'ostsensiobuzzprofilerbundle.php' => 1, | |
| 'osterrorbundle.php' => 1, | |
| 'report-sample.php' => 1, | |
| 'vhosthandler.php' => 1, | |
| 'permutation.sublime-project' => 1, | |
| 'permutation.sublime-workspace' => 1, | |
| 'jiabinholterbundle.php' => 1, | |
| 'vhostconfiguration.php' => 1, | |
| 'ohdateextravalidatorbundle.php' => 1, | |
| 'ohgooglemapformtypebundle.php' => 1, | |
| 'stam.yml' => 1, | |
| 'patterneventsprovider.php' => 1, | |
| 'jfdlformbundle.php' => 1, | |
| 'schedulecontroller.php' => 1, | |
| 'callbackevent.php' => 1, | |
| 'phonenumbervalidator.php' => 1, | |
| 'phonenumberbehavior.php' => 1, | |
| 'momentlanguageasset.php' => 1, | |
| 'manymanyrelationbehavior.php' => 1, | |
| 'filetrait.php' => 1, | |
| 'gmap.php' => 1, | |
| 'prefixmethodfinder.php' => 1, | |
| 'daterangepickerbootstrap3asset.php' => 1, | |
| 'berttimezonebundle.php' => 1, | |
| 'daterangepickerbootstrap2asset.php' => 1, | |
| 'icons.php' => 1, | |
| 'phpunit_travis.xml' => 1, | |
| 'create_test_reports.sh' => 1, | |
| 'tpuserbundle.php' => 1, | |
| 'taosistemasajaxgridbundle.php' => 1, | |
| 'gizmo.phar' => 1, | |
| 'gizmo' => 1, | |
| '.jsbeautifyrc' => 1, | |
| 'faker' => 1, | |
| 'license-3rd-party' => 1, | |
| 'phpunit-notifications.sh' => 1, | |
| 'test_stringset.php' => 1, | |
| 'ongrconnectionsbundle.php' => 1, | |
| 'gearman_test_client.php' => 1, | |
| 'routing.json' => 1, | |
| 'amukanaplvalidatorbundle.php' => 1, | |
| 'nyrodevutilitybundle.php' => 1, | |
| 'ventureoaklabsfavicongeneratorbundle.php' => 1, | |
| 'nyrodevnyrocmsbundle.php' => 1, | |
| 'ventureoaklabswsdl2phpgeneratorclibundle.php' => 1, | |
| 'simplecache-htaccess' => 1, | |
| 'frontend-cache.php' => 1, | |
| 'caches.conf.sample.php' => 1, | |
| 'cache-main-auth.php' => 1, | |
| 'gearman_runner.php' => 1, | |
| 'minifyplugin.php' => 1, | |
| 'careerjet_api.php' => 1, | |
| 'datagridvector.php' => 1, | |
| 'crowdtilt.php' => 1, | |
| 'nvboosterphpcrassetsbundle.php' => 1, | |
| 'update_ruckusing_database.php' => 1, | |
| 'swiftmessageutils.php' => 1, | |
| 'banister.php' => 1, | |
| 'memcachedtool' => 1, | |
| 'heatmap.php' => 1, | |
| 'nuxiamailstoragebundle.php' => 1, | |
| 'docker-compose.env.dist' => 1, | |
| 'seomaticplugin.php' => 1, | |
| 'morgenstillevisualheatmapbundle.php' => 1, | |
| 'abstractparser.php' => 1, | |
| 'ivanvolkovsearchfilesbycontentbundle.php' => 1, | |
| 'jlmawsbundle.php' => 1, | |
| 'jlmserializerexpressionbundle.php' => 1, | |
| 'projectlint.yml' => 1, | |
| 'commandprocess.php' => 1, | |
| 'commandformatter.php' => 1, | |
| '.package.tag' => 1, | |
| '.package.split' => 1, | |
| 'soko.yml' => 1, | |
| 'httppersister.php' => 1, | |
| 'jmikolaautologinbundle.php' => 1, | |
| 'scaffolder' => 1, | |
| 'cqlclient.php' => 1, | |
| 'literals.php' => 1, | |
| 'cqlpersister.php' => 1, | |
| 'persister.php' => 1, | |
| 'jmikolainsecureroutesbundle.php' => 1, | |
| 'criteriaparser.php' => 1, | |
| 'jmikolajsassetshelperbundle.php' => 1, | |
| 'jmikolawildcardeventdispatcherbundle.php' => 1, | |
| 'mojosonatauibundle.php' => 1, | |
| 'doctrineormpersister.php' => 1, | |
| 'osmeasyrestbundle.php' => 1, | |
| 'parameterbaginterface.php' => 1, | |
| 'abstractcli.sublime-project' => 1, | |
| 'tpboot.php' => 1, | |
| 'embedgithub.php' => 1, | |
| 'factorysequence.php' => 1, | |
| 'factorygirl.php' => 1, | |
| 'extended-template-parts.php' => 1, | |
| 'photoswipe.css' => 1, | |
| 'extended-widgets.php' => 1, | |
| 'query-monitor.php' => 1, | |
| 'user-switching.php' => 1, | |
| 'mycal.ics' => 1, | |
| 'class.icalreader.php' => 1, | |
| 'captcha-login.php' => 1, | |
| 'talandewebb.php' => 1, | |
| 'extended-cpts.php' => 1, | |
| '[email protected]' => 1, | |
| 'kml.class.php' => 1, | |
| 'icons.png' => 1, | |
| 'error.gif' => 1, | |
| 'kmlcircle.php' => 1, | |
| 'code.photoswipe.jquery-3.0.5.min.js' => 1, | |
| 'kmlcsv.jar' => 1, | |
| 'redbox-scan.php' => 1, | |
| 'help-me-help-you.php' => 1, | |
| 'hmhy.js' => 1, | |
| 'extended-taxos.php' => 1, | |
| 'googlenews.php' => 1, | |
| 'jogaramreactphpbundle.php' => 1, | |
| 'jsmysqlndbundle.php' => 1, | |
| 'push.php' => 1, | |
| 'nurolophersummernotebundle.php' => 1, | |
| 'nurikabestarratingbundle.php' => 1, | |
| 'twitterapiinterface.php' => 1, | |
| 'scytaledatabaseconfigurationbundle.php' => 1, | |
| 'autoloader.php~' => 1, | |
| 'memory::' => 1, | |
| 'arkoqueuemanagerbundle.php' => 1, | |
| 'queuemanagerinterface.php' => 1, | |
| 'test.html~' => 1, | |
| 'phpunit_travis_mysql.xml' => 1, | |
| 'android.class.php' => 1, | |
| 'wf.php' => 1, | |
| 'run_poste.sh' => 1, | |
| 'track.sh' => 1, | |
| 'test-one-file.sh' => 1, | |
| 'codeoasiscurlbundle.php' => 1, | |
| 'jbzfetchbundle.php' => 1, | |
| 'robots.php' => 1, | |
| 'x.bat' => 1, | |
| 'notification.class.php' => 1, | |
| 'ios.class.php' => 1, | |
| 'jbzimapbundle.php' => 1, | |
| 'l.php' => 1, | |
| 'yiidbhttptokensession.php' => 1, | |
| 'dbcon.php' => 1, | |
| 'cronqueue.php' => 1, | |
| 'jlbsadminbundle.php' => 1, | |
| 'jlbsadminfosuserbundle.php' => 1, | |
| 'tusk.json' => 1, | |
| 'mobiledemo.php' => 1, | |
| 'seleniumrcdemo.php' => 1, | |
| 'webdriverdemo.php' => 1, | |
| 'webdriverdemoshootout.php' => 1, | |
| 'webdriverfileuploaddemo.php' => 1, | |
| 'webdrivernologinlinkdemo.php' => 1, | |
| 'kirk.jpg' => 1, | |
| 'cronjob.php' => 1, | |
| 'jaitecclickbundle.php' => 1, | |
| 'cronconnector.php' => 1, | |
| 'sauce_api_test.php' => 1, | |
| 'jlmaskbundle.php' => 1, | |
| 'jlmbootstrapbundle.php' => 1, | |
| 'jlmcommercebundle.php' => 1, | |
| 'jlmcommerceevents.php' => 1, | |
| 'jlmcondominiumbundle.php' => 1, | |
| 'jlmcontactbundle.php' => 1, | |
| 'jlmcontractbundle.php' => 1, | |
| 'walkerinterface.php' => 1, | |
| 'jlasozimbrasoapapibundle.php' => 1, | |
| 'translationsapibundle.php' => 1, | |
| 'octavabranchingbundle.php' => 1, | |
| 'mpdfextended.php' => 1, | |
| 'odeskphystrixbundle.php' => 1, | |
| 'designbundle.php' => 1, | |
| 'qrreaderasset.php' => 1, | |
| 'comoempezar.pdf' => 1, | |
| 'qrreader.php' => 1, | |
| 'prueba.sql' => 1, | |
| 'dockerremote.php' => 1, | |
| 'profilinginstructions' => 1, | |
| 'measurement.ods' => 1, | |
| 'bracket.php' => 1, | |
| 'jlasojsoneditorbundle.php' => 1, | |
| 'sample.csv' => 1, | |
| 'jlasoapidocbundle.php' => 1, | |
| 'consoleargs.php' => 1, | |
| 'memorycache.php' => 1, | |
| 'halcyonserviceprovider.php' => 1, | |
| 'php-tools.php' => 1, | |
| 'sessionstoragebundle.php' => 1, | |
| 'jlasositemapbundle.php' => 1, | |
| 'commands.ini.dist' => 1, | |
| 'servers.ini.dist' => 1, | |
| 'config.ini.dis' => 1, | |
| 'csv2po.php' => 1, | |
| 'geggs.yml' => 1, | |
| 'jlmcontractevents.php' => 1, | |
| 'remainingcharactersasset.php' => 1, | |
| 'installtaotask.php' => 1, | |
| 'jlmmodelbundle.php' => 1, | |
| 'jlmmodelevents.php' => 1, | |
| 'jlmofficebundle.php' => 1, | |
| 'getfile.php' => 1, | |
| 'tools.xml' => 1, | |
| 'compilejscss.xml' => 1, | |
| 'taodbconfig.php' => 1, | |
| 'jlmproductbundle.php' => 1, | |
| 'taoconfig.php' => 1, | |
| 'restoredbtask.php' => 1, | |
| 'gitdifftask.php' => 1, | |
| 'composer.json_' => 1, | |
| 'generisconfig.php' => 1, | |
| 'createdbtask.php' => 1, | |
| 'jlmproductevents.php' => 1, | |
| 'backupdbtask.php' => 1, | |
| 'fdl-1.3' => 1, | |
| 'test2.json' => 1, | |
| 'jlmstatebundle.php' => 1, | |
| 'silk.log' => 1, | |
| 'jlmtransmitterbundle.php' => 1, | |
| 'jlmuserbundle.php' => 1, | |
| 'protobuf.php' => 1, | |
| 'composer.json__' => 1, | |
| 'octanteupsapibundle.php' => 1, | |
| 'httpauth-recipe.rb' => 1, | |
| 'jlmcorebundle.php' => 1, | |
| 'jlmdailybundle.php' => 1, | |
| 'octantenatsbundle.php' => 1, | |
| 'octantemarvelapibundle.php' => 1, | |
| 'jlmdailyevents.php' => 1, | |
| 'dockercomposebundle.php' => 1, | |
| 'parameters.dist.yml' => 1, | |
| 'opcache-recipe.rb' => 1, | |
| 'modman-recipe.rb' => 1, | |
| 'magento-recipe.rb' => 1, | |
| 'jlmdefaultbundle.php' => 1, | |
| 'logtailminutes.php' => 1, | |
| 'croogo-recipe.rb' => 1, | |
| 'composer-recipe.rb' => 1, | |
| 'cakephp2x-recipe.rb' => 1, | |
| 'cakephp1x-recipe.rb' => 1, | |
| 'backupdatabase-recipe.rb' => 1, | |
| 'apc-recipe.rb' => 1, | |
| 'obtaohtml2pdfbundle.php' => 1, | |
| 'jlmfeebundle.php' => 1, | |
| 'obtaoamazonwebservicesbundle.php' => 1, | |
| 'jlmfollowbundle.php' => 1, | |
| 'jlminstallationbundle.php' => 1, | |
| 'service.template' => 1, | |
| 'ongrcontentbundle.php' => 1, | |
| 'vandelay.php' => 1, | |
| 'mysql_wrapper.class.php' => 1, | |
| 'setflash.iml' => 1, | |
| 'crowi.php' => 1, | |
| 'puffer.sublime-project' => 1, | |
| 'puffer-logo.png' => 1, | |
| 'tests-api-token.txt.sample' => 1, | |
| 'osimek1articlesbundle.php' => 1, | |
| 'php.log' => 1, | |
| 'lastfmbundle.php' => 1, | |
| 'osbekrocommentsbundle.php' => 1, | |
| 'middlewares.php' => 1, | |
| 'upgrade-1.8.3' => 1, | |
| 'outlandishrestbundle.php' => 1, | |
| 'upgrade-1.10' => 1, | |
| 'ororequirejsbundle.php' => 1, | |
| 'orocrmmagentocontactusbundle.php' => 1, | |
| 'orokernel.php' => 1, | |
| 'orodistributionbundle.php' => 1, | |
| 'oroconfigbundle.php' => 1, | |
| 'cumulativeresourcemanager.php' => 1, | |
| 'cumulativeresourceinfo.php' => 1, | |
| 'cumulativeresource.php' => 1, | |
| 'ornjmarkdownbundle.php' => 1, | |
| 'example-report.php' => 1, | |
| 'outlandishroutemasterbundle.php' => 1, | |
| 'ornicarmessagebundle.php' => 1, | |
| 'evalnametoken.php' => 1, | |
| 'spellchecker' => 1, | |
| 'simple-ru' => 1, | |
| 'minimum-requirements.php' => 1, | |
| 'rat_exclude' => 1, | |
| 'overblogwsclientbundle.php' => 1, | |
| 'overblogthriftbundle.php' => 1, | |
| 'leafsimple.php' => 1, | |
| 'leafpre.php' => 1, | |
| 'jcrollfoursquareapibundle.php' => 1, | |
| 'leafparagraph.php' => 1, | |
| 'leafheading.php' => 1, | |
| 'overblogactivemqbundle.php' => 1, | |
| 'branchlistunordered.php' => 1, | |
| 'branchlistordered.php' => 1, | |
| 'itoken.php' => 1, | |
| 'branchlistitem.php' => 1, | |
| 'branchlist.php' => 1, | |
| 'nametoken.php' => 1, | |
| 'templategenerator.php' => 1, | |
| 'templatemanager.php' => 1, | |
| 'branch.php' => 1, | |
| 'overbloggraphqlbundle.php' => 1, | |
| 'overblogembedlybundle.php' => 1, | |
| 'ornjarchivebundle.php' => 1, | |
| 'orkestrawebservicebundle.php' => 1, | |
| 'simple-contact-forms.php' => 1, | |
| 'jdecoolmonologextrabundle.php' => 1, | |
| 'subvert.php' => 1, | |
| 'cachedecorator.php' => 1, | |
| 'jdecoolexceptionhelpbundle.php' => 1, | |
| 'cachablequeryserviceprovider.php' => 1, | |
| 'policy.php' => 1, | |
| 'authorizationserviceprovider.php' => 1, | |
| 'resourcemirrorfactory.php' => 1, | |
| 'resourcemirror.php' => 1, | |
| 'imageworkshopbundle.php' => 1, | |
| 'orbtstylemirrorbundle.php' => 1, | |
| 'orbtresourcemirrorbundle.php' => 1, | |
| 'hashidserviceprovider.php' => 1, | |
| 'covers-validator' => 1, | |
| 'jdecooltwigconstantaccessorbundle.php' => 1, | |
| 'opwocoforecastbundle.php' => 1, | |
| 'opwocoxeditablebundle.php' => 1, | |
| 'opwocobootstrapbundle.php' => 1, | |
| 'reactasset.php' => 1, | |
| 'jsxtransformerasset.php' => 1, | |
| 'jdecosterroutingextrabundle.php' => 1, | |
| 'shortify.php' => 1, | |
| 'cert.pem' => 1, | |
| 'formrequest.php' => 1, | |
| 'replacementmanager2.php' => 1, | |
| 'orkestratransactorbundle.php' => 1, | |
| 'abstractreport.php' => 1, | |
| 'reportinterface.php' => 1, | |
| 'reportfactory.php' => 1, | |
| 'presenterinterface.php' => 1, | |
| 'tokendef.php' => 1, | |
| 'tokentype.php' => 1, | |
| 'basecodehandler.php' => 1, | |
| 'basiccodepattern.php' => 1, | |
| 'codeformatter.php' => 1, | |
| 'presentation.php' => 1, | |
| 'orkestrareportbundle.php' => 1, | |
| 'codepattern.php' => 1, | |
| 'commandserviceprovider.php' => 1, | |
| 'orkestrapdfbundle.php' => 1, | |
| 'guzzle.php' => 1, | |
| 'orkestraapplicationbundle.php' => 1, | |
| 'bootils.php' => 1, | |
| 'delimitedcodepattern.php' => 1, | |
| 'replacementmanager.php' => 1, | |
| 'origammiblocksbundle.php' => 1, | |
| 'blockscontainer.php' => 1, | |
| 'fullcasset.php' => 1, | |
| 'fullcall.php' => 1, | |
| 'middlewareserviceprovider.php' => 1, | |
| 'validity.php' => 1, | |
| 'acf-page-builder.php' => 1, | |
| 'oauth2clientbundle.php' => 1, | |
| 'pagarme.php' => 1, | |
| 'jbsearchbundle.php' => 1, | |
| 'jbtagcloudbundle.php' => 1, | |
| 'corsslim.php' => 1, | |
| 'jbsimplepagebundle.php' => 1, | |
| 'send' => 1, | |
| 'response' => 1, | |
| 'civicrm.php' => 1, | |
| 'request' => 1, | |
| 'consoletarget.php' => 1, | |
| 'paggyboletobundle.php' => 1, | |
| 'gpgalleryasset.php' => 1, | |
| 'slimnocache.php' => 1, | |
| 'bigtype.html' => 1, | |
| 'gpgallery.php' => 1, | |
| 'bluesatellite.html' => 1, | |
| 'bootstrapped.html' => 1, | |
| 'elefant' => 1, | |
| 'abstractplace.php' => 1, | |
| 'workbench' => 1, | |
| 'inflicted.html' => 1, | |
| 'inflicted.png' => 1, | |
| 'refactor.php' => 1, | |
| 'jbdatenavigationbundle.php' => 1, | |
| 'angular' => 1, | |
| 'optionbag.php' => 1, | |
| 'pdo-debug.sql' => 1, | |
| 'cli_facebook.php' => 1, | |
| '.gdbinit' => 1, | |
| 'edifactbundle.php' => 1, | |
| 'linksextractor.php' => 1, | |
| 'language' => 1, | |
| 'adapters' => 1, | |
| 'dynamicobject.php' => 1, | |
| 'dynamicobject' => 1, | |
| 'chequer.php' => 1, | |
| 'mydbvc.yaml' => 1, | |
| 'pdo-debug.php' => 1, | |
| 'angular.zip' => 1, | |
| 'jbfileuploaderbundle.php' => 1, | |
| 'startserver' => 1, | |
| 'gear.php' => 1, | |
| 'loaderexception.php' => 1, | |
| 'auto.php' => 1, | |
| 'jbphumborbundle.php' => 1, | |
| 'datenavigationgenerator.php' => 1, | |
| 'sqlinterface.php' => 1, | |
| 'datenavigationprovider.php' => 1, | |
| 'sqlabstract.php' => 1, | |
| 'cachedi.php' => 1, | |
| 'pablodipmodulebundle.php' => 1, | |
| 'pablodipadminmodulebundle.php' => 1, | |
| 'wufoohtmlwrapper.php' => 1, | |
| 'yepsuacommonsbundle.php' => 1, | |
| 'siteparser.php' => 1, | |
| 'sitelinks.php' => 1, | |
| 'check_minecraft.php' => 1, | |
| 'phpunit-travis.xml.dist' => 1, | |
| 'yepsuathemebundle.php' => 1, | |
| 'yepsuasmartwigbundle.php' => 1, | |
| 'unit_tests.xml' => 1, | |
| 'yepsuaradbundle.php' => 1, | |
| 'yepsuamenubundle.php' => 1, | |
| 'yepsuageneratorbundle.php' => 1, | |
| 'tutorial4' => 1, | |
| 'p1r0generatorbundle.php' => 1, | |
| 'tutorial3' => 1, | |
| 'tutorial2' => 1, | |
| 'savvycontactbundle.php' => 1, | |
| 'kengai.png' => 1, | |
| 'mediafactory.php' => 1, | |
| 'smiletrainingbundle.php' => 1, | |
| 'pre-commit.phpeach' => 1, | |
| 'phpeach.conf.dist' => 1, | |
| 'phpeach' => 1, | |
| 'build.ini.dist' => 1, | |
| 'integration_tests.xml' => 1, | |
| 'previewtheme.php' => 1, | |
| 'literati.html' => 1, | |
| 'phkapa.readme' => 1, | |
| 'elefant_icon.png' => 1, | |
| 'adminsession.php' => 1, | |
| 'montreal.html' => 1, | |
| 'quick-user-guide-phkondo-pt' => 1, | |
| 'quick-user-guide-phkondo-en' => 1, | |
| 'raleway.html' => 1, | |
| 'saasy.html' => 1, | |
| 'simplement.html' => 1, | |
| 'bright_squares.png' => 1, | |
| 'subtlesquared.html' => 1, | |
| 'urlify.php' => 1, | |
| 'isgdhelpers.php' => 1, | |
| 'installation_instructions' => 1, | |
| 'init.ph7' => 1, | |
| 'ph7.license' => 1, | |
| 'ph7.copyright' => 1, | |
| 'help_us' => 1, | |
| 'subdivx' => 1, | |
| 'washi.html' => 1, | |
| 'washi.png' => 1, | |
| 'changelog-0.2' => 1, | |
| 'uuidhelpers.php' => 1, | |
| 'readme ramsey uuid' => 1, | |
| 'ivalidator.php' => 1, | |
| 'userroles.php' => 1, | |
| 'ongrmagentoconnectorbundle.php' => 1, | |
| 'jseimagecropbundle.php' => 1, | |
| 'ui-multiselect-transfer.html' => 1, | |
| 'ui-multiselect-transfer.js' => 1, | |
| 'jerivecontainerexplorerbundle.php' => 1, | |
| 'security-exchanges.json' => 1, | |
| 'exchanges.json' => 1, | |
| 'algorithms.json' => 1, | |
| 'jerivefileprocessingbundle.php' => 1, | |
| 'jeriveworkflowbundle.php' => 1, | |
| 'jseamfbundle.php' => 1, | |
| 'jseemgeneratorbundle.php' => 1, | |
| 'kloutapibundle.php' => 1, | |
| 'demo.js' => 1, | |
| 'jseblockgeneratorbundle.php' => 1, | |
| 'todo.textile' => 1, | |
| 'as3-signals.as3proj' => 1, | |
| 'package-descriptions.xml' => 1, | |
| 'sdk.properties' => 1, | |
| 'openpay.php' => 1, | |
| 'sculpingistembedbundle.php' => 1, | |
| 'jeroendeslooveregeolocationbundle.php' => 1, | |
| 'jeroendeslooverevcardbundle.php' => 1, | |
| 'jvdhasseticcachebustingbundle.php' => 1, | |
| 'ticket_create_example.php' => 1, | |
| 'udf_query_example.php' => 1, | |
| 'twitterstrategy.php' => 1, | |
| 'openrootcronjobbundle.php' => 1, | |
| 'opensoftdoctrineadditionsbundle.php' => 1, | |
| 'log4php.dist.xml' => 1, | |
| 'add-site.php' => 1, | |
| 'openskyruntimeconfigbundle.php' => 1, | |
| 'crawl' => 1, | |
| 'asf-license-2.0' => 1, | |
| 'openroothttpcontextbundle.php' => 1, | |
| 'apache_license_v2' => 1, | |
| 'pdepend.xml' => 1, | |
| 'schedulermodule.php' => 1, | |
| 'openrootclientcontextbundle.php' => 1, | |
| 'exclude' => 1, | |
| 'jmabbundle.php' => 1, | |
| 'jmbalancedpaymentbundle.php' => 1, | |
| 'jmcrmbundle.php' => 1, | |
| 'demo.css' => 1, | |
| 'calculator.php' => 1, | |
| 'lss_version.php' => 1, | |
| 'openifyproductbundle.php' => 1, | |
| 'openifyjqgridbundle.php' => 1, | |
| 'openifycustomerbundle.php' => 1, | |
| 'openifyconfigurationbundle.php' => 1, | |
| 'openifyaws2bundle.php' => 1, | |
| 'sculpincontentgeneratorbundle.php' => 1, | |
| 'identifier_request.html' => 1, | |
| 'freeagentworkflowbundle.php' => 1, | |
| 'ongrrouterbundle.php' => 1, | |
| 'imagickext.php' => 1, | |
| 'onmotionasset.php' => 1, | |
| 'sendmail-wrapper.php' => 1, | |
| 'larareposerviceprovider.php' => 1, | |
| 'sendmail-throttle.php' => 1, | |
| 'prepend.php' => 1, | |
| 'onlimeexceptionreportbundle.php' => 1, | |
| 'quality.sh' => 1, | |
| 'ongrtranslationsbundle.php' => 1, | |
| 'ongrsettingsbundle.php' => 1, | |
| 'ongrmonitoringbundle.php' => 1, | |
| 'oodlekrumobundle.php' => 1, | |
| 'serializableinterface.php' => 1, | |
| 'ongrfiltermanagerbundle.php' => 1, | |
| 'ongrelasticsearchbundle.php' => 1, | |
| 'ongrcurrencyexchangebundle.php' => 1, | |
| 'ongrcookiesbundle.php' => 1, | |
| 'ongrapibundle.php' => 1, | |
| 'ongrtestingbundle.php' => 1, | |
| 'ongrtaskmessengerbundle.php' => 1, | |
| 'ongrpagerbundle.php' => 1, | |
| 'ongroxidconnectorbundle.php' => 1, | |
| 'onpubapi.php' => 1, | |
| 'canaltpscrumboarditbundle.php' => 1, | |
| 'cachebustingworker.php' => 1, | |
| 'baseexporter.php' => 1, | |
| 'serializedtype.php' => 1, | |
| 'unserializer.php' => 1, | |
| 'unserializerinterface.php' => 1, | |
| 'openidstrategy.php' => 1, | |
| 'livestrategy.php' => 1, | |
| 'jvdhtwigrelativecachekeybundle.php' => 1, | |
| 'linkedinstrategy.php' => 1, | |
| 'githubstrategy.php' => 1, | |
| 'debugserviceprovider.php' => 1, | |
| 'travis-ci.xml' => 1, | |
| 'wordpress-nav-menus-improved.php' => 1, | |
| 'jsonexporter.php' => 1, | |
| 'sharedcount.php' => 1, | |
| 'excelexporter.php' => 1, | |
| 'wp-svn.pl' => 1, | |
| 'oomph-plugin-notes.php' => 1, | |
| 'oomph-plugin-notes.js' => 1, | |
| 'google-places.php' => 1, | |
| 'google_oauth.routing.yml' => 1, | |
| 'google_oauth.links.menu.yml' => 1, | |
| 'google_oauth.info.yml' => 1, | |
| 'wp-forms-api.php' => 1, | |
| 'finally.jpg' => 1, | |
| 'opensofteplbundle.php' => 1, | |
| 'godaddy_wildwestdomainsapi.php' => 1, | |
| 'iuser.php' => 1, | |
| 'memcachedbridge.php' => 1, | |
| 'et_client.php' => 1, | |
| 'ievent.php' => 1, | |
| 'jdphpprojectanalyzerbundle.php' => 1, | |
| 'istatement.php' => 1, | |
| 'ppaindex.png' => 1, | |
| 'idriver.php' => 1, | |
| 'iconnection.php' => 1, | |
| 'statuscodes.php' => 1, | |
| 'codecoverage.php' => 1, | |
| 'redisbridge.php' => 1, | |
| 'wechatbundle.php' => 1, | |
| 'avrogeneratorbundle.php' => 1, | |
| 'icachebridge.php' => 1, | |
| 'coordinatesdistancebundle.php' => 1, | |
| 'filebridge.php' => 1, | |
| 'arraybridge.php' => 1, | |
| 'ilazybootstrapper.php' => 1, | |
| 'ibootstrapperregistry.php' => 1, | |
| 'openfirebundle.php' => 1, | |
| 'bootstrapperregistry.php' => 1, | |
| 'config.module.config.php' => 1, | |
| 'jira.dist.yml' => 1, | |
| 'token.json' => 1, | |
| 'invalidcsrftokenexception.php' => 1, | |
| 'iauthenticationcontext.php' => 1, | |
| 'invalidqueryexception.php' => 1, | |
| 'guestuser.php' => 1, | |
| 'avroblogbundle.php' => 1, | |
| 'avrocasebundle.php' => 1, | |
| 'isession.php' => 1, | |
| 'routeexception.php' => 1, | |
| 'avrocsvbundle.php' => 1, | |
| 'updatequery.php' => 1, | |
| 'avroimagebundle.php' => 1, | |
| 'avrolocationbundle.php' => 1, | |
| 'selectquery.php' => 1, | |
| 'insertquery.php' => 1, | |
| 'iocexception.php' => 1, | |
| 'avroratingbundle.php' => 1, | |
| 'avrostripebundle.php' => 1, | |
| 'deletequery.php' => 1, | |
| 'conditionalquerybuilder.php' => 1, | |
| 'augmentingquerybuilder.php' => 1, | |
| 'ipipeline.php' => 1, | |
| 'iunitofwork.php' => 1, | |
| 'ientityregistry.php' => 1, | |
| 'ientity.php' => 1, | |
| 'entitystates.php' => 1, | |
| 'entityregistry.php' => 1, | |
| 'applicationbinder.php' => 1, | |
| 'readme-php' => 1, | |
| 'apc.ini' => 1, | |
| 'ligneinstance.php' => 1, | |
| 'project.xml' => 1, | |
| 'todo_release' => 1, | |
| 'upgrade-to-2.0' => 1, | |
| 'doc-en' => 1, | |
| 'de_ch.csv' => 1, | |
| 'doc-fr' => 1, | |
| 'mindfireexpiryfieldbundle.php' => 1, | |
| 'thirdparty' => 1, | |
| 'cnx.php' => 1, | |
| 'dbrm.php' => 1, | |
| 'vue.php' => 1, | |
| 'developing' => 1, | |
| 'datas.php' => 1, | |
| 'groupe.php' => 1, | |
| 'jsonrpcclient.php' => 1, | |
| 'jsonrpcexception.php' => 1, | |
| 'minify-options.php.dist' => 1, | |
| 'opensoftsimpleserializerbundle.php' => 1, | |
| 'opensoftrolloutbundle.php' => 1, | |
| 'jsonrpcserver.php' => 1, | |
| 'optimus' => 1, | |
| 'custompoststatus.php' => 1, | |
| 'application.init.php' => 1, | |
| 'dzangocartbundle.php' => 1, | |
| 'autogen.sh' => 1, | |
| 'travis-ci.enc' => 1, | |
| 'entitytypes.php' => 1, | |
| '1.travis.yml' => 1, | |
| 'jekaimagebundle.php' => 1, | |
| 'authenticationstatustypes.php' => 1, | |
| 'authenticationcontext.php' => 1, | |
| 'email_reader.php' => 1, | |
| 'email_parser.php' => 1, | |
| 'jekaqiwibundle.php' => 1, | |
| '.jelix-scripts.ini' => 1, | |
| 'optilolapibundle.php' => 1, | |
| 'payment.sql' => 1, | |
| 'dzangocartsubscriptionbundle.php' => 1, | |
| 'inc_setup_form.php' => 1, | |
| 'inc_sample.php' => 1, | |
| 'inc_index.php' => 1, | |
| 'inc_add_form.php' => 1, | |
| 'inc_add_conf.php' => 1, | |
| 'colibri' => 1, | |
| 'test_services.json.dist' => 1, | |
| 'uamamazonsearchbundle.php' => 1, | |
| 'uamdatatablesbundle.php' => 1, | |
| 'uamawsecsbundle.php' => 1, | |
| 'uamawsbundle.php' => 1, | |
| 'verily.php' => 1, | |
| 'code.photoswipe.jquery-3.0.5.js' => 1, | |
| 'compact-0070-out.jsonld' => 1, | |
| 'mergerfactory.php' => 1, | |
| 'compact-0023-out.jsonld' => 1, | |
| 'ocipdolobstreamwrapper.php' => 1, | |
| 'ocipdoadapter.php' => 1, | |
| 'compact-0024-context.jsonld' => 1, | |
| 'compact-0024-in.jsonld' => 1, | |
| 'ocidbconnection.php' => 1, | |
| 'compact-0024-out.jsonld' => 1, | |
| 'transformerinterface.php' => 1, | |
| 'compact-0025-context.jsonld' => 1, | |
| 'compact-0025-in.jsonld' => 1, | |
| 'merger.php' => 1, | |
| 'ocipdostatementadapter.php' => 1, | |
| 'compact-0025-out.jsonld' => 1, | |
| 'compact-0026-context.jsonld' => 1, | |
| 'compact-0026-in.jsonld' => 1, | |
| 'compact-0026-out.jsonld' => 1, | |
| 'compact-0027-context.jsonld' => 1, | |
| 'compact-0027-in.jsonld' => 1, | |
| 'compact-0027-out.jsonld' => 1, | |
| 'compact-0028-context.jsonld' => 1, | |
| 'compact-0028-in.jsonld' => 1, | |
| 'compact-0028-out.jsonld' => 1, | |
| 'compact-0023-in.jsonld' => 1, | |
| 'string2stream.php' => 1, | |
| 'compact-0029-in.jsonld' => 1, | |
| 'correiosshipping.php' => 1, | |
| 'compact-0021-context.jsonld' => 1, | |
| 'compact-0021-in.jsonld' => 1, | |
| 'newscoopgoogleeventspluginbundle.php' => 1, | |
| 'nsmtwigextensionsbundle.php' => 1, | |
| 'compact-0021-out.jsonld' => 1, | |
| 'nsmemojibundle.php' => 1, | |
| 'compact-0022-context.jsonld' => 1, | |
| 'nsmdatetimebundle.php' => 1, | |
| 'jcrop.php' => 1, | |
| 'compact-0022-in.jsonld' => 1, | |
| 'compact-0022-out.jsonld' => 1, | |
| 'neutroncomponentbundle.php' => 1, | |
| 'd' => 1, | |
| 'phpunit.travis.xml.dist' => 1, | |
| 'compact-0023-context.jsonld' => 1, | |
| 'phpunit-hhvm.xml' => 1, | |
| 'hhvm.properties' => 1, | |
| 'coverage.db' => 1, | |
| 'webkitcontentblocker.php' => 1, | |
| 'easylistparser.php' => 1, | |
| '.travis-generate-docs.sh' => 1, | |
| 'reademe.md' => 1, | |
| 'compact-0029-context.jsonld' => 1, | |
| 'compact-0029-out.jsonld' => 1, | |
| 'compact-0020-in.jsonld' => 1, | |
| 'compact-0037-in.jsonld' => 1, | |
| 'compact-0036-in.jsonld' => 1, | |
| 'selenium-server-standalone-2.46.0.jar' => 1, | |
| 'generate-api-docs.php' => 1, | |
| 'netvliesformbundle.php' => 1, | |
| 'netvliesbolopenapibundle.php' => 1, | |
| 'netvliesbasecampbundle.php' => 1, | |
| 'compact-0036-out.jsonld' => 1, | |
| 'compact-0037-context.jsonld' => 1, | |
| 'netvliesdoctrinebridgebundle.php' => 1, | |
| 'nettobrdwbundle.php' => 1, | |
| 'rsslib.php' => 1, | |
| 'compact-0035-out.jsonld' => 1, | |
| 'compact-0037-out.jsonld' => 1, | |
| 'compact-0038-context.jsonld' => 1, | |
| 'compact-0038-in.jsonld' => 1, | |
| 'compact-0038-out.jsonld' => 1, | |
| 'compact-0039-context.jsonld' => 1, | |
| 'compact-0039-in.jsonld' => 1, | |
| 'compact-0039-out.jsonld' => 1, | |
| 'compact-0040-context.jsonld' => 1, | |
| 'compact-0040-in.jsonld' => 1, | |
| 'compact-0040-out.jsonld' => 1, | |
| 'compact-0036-context.jsonld' => 1, | |
| 'selenium-server-standalone.jar' => 1, | |
| 'compact-0030-context.jsonld' => 1, | |
| 'js.jar' => 1, | |
| 'compact-0030-in.jsonld' => 1, | |
| 'compact-0030-out.jsonld' => 1, | |
| 'compact-0031-context.jsonld' => 1, | |
| 'compact-0031-in.jsonld' => 1, | |
| 'compact-0031-out.jsonld' => 1, | |
| 'compact-0032-context.jsonld' => 1, | |
| 'compact-0032-in.jsonld' => 1, | |
| 'fieldregistry.php' => 1, | |
| 'zepto.min.js' => 1, | |
| 'zepto.js' => 1, | |
| 'compact-0032-out.jsonld' => 1, | |
| 'compact-0035-in.jsonld' => 1, | |
| 'compact-0033-context.jsonld' => 1, | |
| 'compact-0033-in.jsonld' => 1, | |
| 'mysql-connector-java-5.1.26-bin.jar' => 1, | |
| 'compact-0033-out.jsonld' => 1, | |
| 'jslint.js' => 1, | |
| 'compact-0034-context.jsonld' => 1, | |
| 'compact-0034-in.jsonld' => 1, | |
| 'compact-0034-out.jsonld' => 1, | |
| 'compact-0035-context.jsonld' => 1, | |
| 'netzmacht.main.xml' => 1, | |
| 'simplexmlrpc.php' => 1, | |
| 'compact-0020-out.jsonld' => 1, | |
| 'newscoopinstagrampluginbundle.php' => 1, | |
| 'compact-0041-in.jsonld' => 1, | |
| 'compact-0012-in.jsonld' => 1, | |
| 'mongosession.php' => 1, | |
| 'resume.xml' => 1, | |
| 'custom-style.css' => 1, | |
| 'nickprocdnbundle.php' => 1, | |
| 'bootstrap.json' => 1, | |
| 'start-server.bat' => 1, | |
| 'start-server-visible.bat' => 1, | |
| 'propel.xml.dist' => 1, | |
| 'compact-0011-out.jsonld' => 1, | |
| 'compact-0012-context.jsonld' => 1, | |
| 'propel.xml' => 1, | |
| 'compact-0011-in.jsonld' => 1, | |
| 'propel-config.php' => 1, | |
| 'compact-0012-out.jsonld' => 1, | |
| 'compact-0013-context.jsonld' => 1, | |
| 'appbox' => 1, | |
| 'compact-0013-in.jsonld' => 1, | |
| 'compact-0013-out.jsonld' => 1, | |
| 'pinboard-archive' => 1, | |
| 'compact-0014-context.jsonld' => 1, | |
| 'compact-0014-in.jsonld' => 1, | |
| 'compact-0014-out.jsonld' => 1, | |
| 'nicokaagqueueingbundle.php' => 1, | |
| 'compact-0011-context.jsonld' => 1, | |
| 'compact-0015-in.jsonld' => 1, | |
| 'header_no_display.php' => 1, | |
| 'ndewezwebhomeauthapibundle.php' => 1, | |
| 'compact-0006-out.jsonld' => 1, | |
| 'compact-0007-context.jsonld' => 1, | |
| 'xh_types.php' => 1, | |
| 'xh_formalertemail.php' => 1, | |
| 'compact-0007-in.jsonld' => 1, | |
| 'compact-0007-out.jsonld' => 1, | |
| 'compact-0008-context.jsonld' => 1, | |
| 'compact-0008-in.jsonld' => 1, | |
| 'compact-0008-out.jsonld' => 1, | |
| 'footer_no_display.php' => 1, | |
| 'compact-0010-out.jsonld' => 1, | |
| 'bootup.shim.php' => 1, | |
| 'compact-0009-context.jsonld' => 1, | |
| 'postfix_log_bounces.sql' => 1, | |
| 'bootup.logger.php' => 1, | |
| 'form_helper.php' => 1, | |
| 'nbprestacmsthemestarterbundle.php' => 1, | |
| 'compact-0009-in.jsonld' => 1, | |
| 'compact-0009-out.jsonld' => 1, | |
| 'nbprestacmslinkbundle.php' => 1, | |
| 'compact-0010-context.jsonld' => 1, | |
| 'compact-0010-in.jsonld' => 1, | |
| 'compact-0015-context.jsonld' => 1, | |
| 'kellersoundexfrbundle.php' => 1, | |
| 'compact-0020-context.jsonld' => 1, | |
| 'newscooppaywallbundle.php' => 1, | |
| 'readme.md.ready' => 1, | |
| 'silkworm.php' => 1, | |
| 'readme[zh]' => 1, | |
| 'readme[jp]' => 1, | |
| 'newup' => 1, | |
| 'newup.php' => 1, | |
| 'newscoopprintissuemanagerbundle.php' => 1, | |
| 'newscoopsendfeedbackbundle.php' => 1, | |
| 'compact-0018-out.jsonld' => 1, | |
| 'newscooppublishingplatformspluginbundle.php' => 1, | |
| 'newscoopnewsletterpluginbundle.php' => 1, | |
| 'example_dns01.php' => 1, | |
| 'newscoopexamplepluginbundle.php' => 1, | |
| 'newscoopcommentlistsbundle.php' => 1, | |
| 'compact-0019-context.jsonld' => 1, | |
| 'newscoopcitizenreporterpluginbundle.php' => 1, | |
| 'compact-0019-in.jsonld' => 1, | |
| 'compact-0019-out.jsonld' => 1, | |
| 'newscooparticlescalendarbundle.php' => 1, | |
| 'newscooparticlerecommendationbundle.php' => 1, | |
| 'pluginsinstaller.php' => 1, | |
| 'newscoop-instagram-plugin-bundle-0.0.1.zip' => 1, | |
| 'compact-0018-in.jsonld' => 1, | |
| 'example_http01.php' => 1, | |
| 'convertrangemessage.php' => 1, | |
| 'lyst.php' => 1, | |
| 'salvapdfjsbundle.php' => 1, | |
| 'compact-0015-out.jsonld' => 1, | |
| 'pdfjs license' => 1, | |
| 'salvajshrinkbundle.php' => 1, | |
| 'serverip.php' => 1, | |
| 'compact-0016-context.jsonld' => 1, | |
| 'jssdk.php' => 1, | |
| 'compact-0016-in.jsonld' => 1, | |
| 'altoroutertest.php' => 1, | |
| 'lystinterface.php' => 1, | |
| 'immutablelyst.php' => 1, | |
| 'compact-0018-context.jsonld' => 1, | |
| 'entityproviderinterface.php' => 1, | |
| 'actor.php' => 1, | |
| 'compact-0016-out.jsonld' => 1, | |
| 'db-migrate.phar' => 1, | |
| 'compact-0017-context.jsonld' => 1, | |
| 'readmecomplete' => 1, | |
| 'minifw' => 1, | |
| 'compact-0017-in.jsonld' => 1, | |
| 'tritoqshippingbundle.php' => 1, | |
| 'tritoqmanagerboletobundle.php' => 1, | |
| 'compact-0017-out.jsonld' => 1, | |
| 'compact-0041-context.jsonld' => 1, | |
| 'compact-0041-out.jsonld' => 1, | |
| 'compact-0006-context.jsonld' => 1, | |
| 'compact-0062-out.jsonld' => 1, | |
| 'dbus.c' => 1, | |
| 'neogen.yml' => 1, | |
| 'neogen.cypher' => 1, | |
| 'graphenedb_info.yml' => 1, | |
| 'coding_rules.xml' => 1, | |
| 'phpunit.xml.dist ' => 1, | |
| 'cayetanosorianokarmacracybundle.php' => 1, | |
| 'cayetanosorianohashidsbundle.php' => 1, | |
| 'compact-0062-in.jsonld' => 1, | |
| 'cakefile' => 1, | |
| 'releasehelpers.sh' => 1, | |
| 'print.jpg' => 1, | |
| 'filterstabilityflags.php' => 1, | |
| 'composermanifestmerger.php' => 1, | |
| 'ioniconsbundle.php' => 1, | |
| 'docker-compose-local.yml' => 1, | |
| 'readme.es' => 1, | |
| 'compact-0063-context.jsonld' => 1, | |
| 'compact-0063-in.jsonld' => 1, | |
| 'compact-0063-out.jsonld' => 1, | |
| 'physalis.bat' => 1, | |
| 'install-sendtoafriend' => 1, | |
| 'introspect.c' => 1, | |
| 'introspect.h' => 1, | |
| 'eicaptcha.php' => 1, | |
| 'compact-0059-out.jsonld' => 1, | |
| 'compact-0057-out.jsonld' => 1, | |
| 'loghelperplugin.php' => 1, | |
| 'customlogviewerplugin.php' => 1, | |
| 'ner0ticfoursquarebundle.php' => 1, | |
| 'landmarxbundle.php' => 1, | |
| 'compact-0058-context.jsonld' => 1, | |
| 'compact-0058-in.jsonld' => 1, | |
| 'compact-0058-out.jsonld' => 1, | |
| 'compact-0059-context.jsonld' => 1, | |
| 'compact-0059-in.jsonld' => 1, | |
| 'ner0ticjqueryplusbundle.php' => 1, | |
| 'compact-0062-context.jsonld' => 1, | |
| 'ddnetfoursquarebundle.php' => 1, | |
| 'compact-0060-context.jsonld' => 1, | |
| 'compact-0060-in.jsonld' => 1, | |
| 'compact-0060-out.jsonld' => 1, | |
| 'compact-0061-context.jsonld' => 1, | |
| 'compact-0061-in.jsonld' => 1, | |
| 'filemessageimporter.php' => 1, | |
| 'compact-0061-out.jsonld' => 1, | |
| 'dbmessageimporter.php' => 1, | |
| 'basis.php' => 1, | |
| 'php_dbus.h' => 1, | |
| 'install-productcomments' => 1, | |
| 'compact-0064-context.jsonld' => 1, | |
| 'compact-0057-in.jsonld' => 1, | |
| 'nejotwigextensionsbundle.php' => 1, | |
| 'compact-0068-out.jsonld' => 1, | |
| 'compact-0069-context.jsonld' => 1, | |
| 'ismscprovider.php' => 1, | |
| 'esmscprovider.php' => 1, | |
| 'esmscexception.php' => 1, | |
| 'compact-0069-in.jsonld' => 1, | |
| 'compact-0069-out.jsonld' => 1, | |
| 'compact-0070-context.jsonld' => 1, | |
| 'esmsc.php' => 1, | |
| 'econsolecommand.php' => 1, | |
| '.coach.log' => 1, | |
| 'compact-0068-context.jsonld' => 1, | |
| '.coach.dist.json' => 1, | |
| 'phraseappdescription.json' => 1, | |
| 'phraseappbundle.php' => 1, | |
| 'nuditydetector.php' => 1, | |
| 'compact-0070-in.jsonld' => 1, | |
| 'codeception.yml.erb' => 1, | |
| '_set-codeception-group-args.sh' => 1, | |
| '_before-test.sh' => 1, | |
| 'web-start.sh.erb' => 1, | |
| 'web-config.sh.erb' => 1, | |
| 'compact-0068-in.jsonld' => 1, | |
| 'compact-0067-out.jsonld' => 1, | |
| 'compact-0064-in.jsonld' => 1, | |
| 'logs.php' => 1, | |
| 'compact-0064-out.jsonld' => 1, | |
| 'eicaptcha-ajax.php' => 1, | |
| 'compact-0065-context.jsonld' => 1, | |
| 'twitter-essentials.php.dist' => 1, | |
| 'select2jsbundle.php' => 1, | |
| 'compact-0065-in.jsonld' => 1, | |
| 'foundationbundle.php' => 1, | |
| 'fontawesomebundle.php' => 1, | |
| 'compact-0065-out.jsonld' => 1, | |
| 'd3jsbundle.php' => 1, | |
| 'compact-0066-context.jsonld' => 1, | |
| 'nelmiocorsbundle.php' => 1, | |
| 'compact-0066-in.jsonld' => 1, | |
| 'activities.php' => 1, | |
| 'votes.php' => 1, | |
| 'fetch.php' => 1, | |
| 'apigen.yml.obsolete' => 1, | |
| 'reactserversiderendererbundle.php' => 1, | |
| 'compact-0066-out.jsonld' => 1, | |
| 'compact-0067-context.jsonld' => 1, | |
| 'compact-0067-in.jsonld' => 1, | |
| 'nelmiojsloggerbundle.php' => 1, | |
| 'nelmioesidebugbundle.php' => 1, | |
| 'schematic_amnavplugin.php' => 1, | |
| 'bild' => 1, | |
| 'imageedit.php' => 1, | |
| 'onescript.json' => 1, | |
| 'netinfluencesecuredisplaybundle.php' => 1, | |
| 'netinfluenceuploadbundle.php' => 1, | |
| 'compact-0046-context.jsonld' => 1, | |
| 'compact-0046-in.jsonld' => 1, | |
| 'compact-0046-out.jsonld' => 1, | |
| 'compact-0047-context.jsonld' => 1, | |
| 'compact-0047-in.jsonld' => 1, | |
| 'compact-0047-out.jsonld' => 1, | |
| 'compact-0048-context.jsonld' => 1, | |
| 'compact-0048-in.jsonld' => 1, | |
| 'netgustoparametertouchbundle.php' => 1, | |
| 'authorizerbehavior.php' => 1, | |
| 'netgustohmvcbundle.php' => 1, | |
| 'netgustodynamicsubdomainbundle.php' => 1, | |
| 'netgustodistributionbundle.php' => 1, | |
| 'netgustodeviationbundle.php' => 1, | |
| 'compact-0048-out.jsonld' => 1, | |
| 'netgustodevserverbundle.php' => 1, | |
| 'netgustobootcampbundle.php' => 1, | |
| 'netgustoautoroutebundle.php' => 1, | |
| 'compact-0049-context.jsonld' => 1, | |
| 'baikalwellknownbundle.php' => 1, | |
| 'authmanagertrait.php' => 1, | |
| 'authorizerquerybehavior.php' => 1, | |
| 'baikalmodelbundle.php' => 1, | |
| 'compact-0044-context.jsonld' => 1, | |
| 'imageclass.php' => 1, | |
| 'compact-0042-context.jsonld' => 1, | |
| 'imageadd_form.php' => 1, | |
| 'compact-0042-in.jsonld' => 1, | |
| 'compact-0042-out.jsonld' => 1, | |
| 'tordf-0028-out.nq' => 1, | |
| 'compact-0043-in.jsonld' => 1, | |
| 'compact-0043-out.jsonld' => 1, | |
| 'imageadd.php' => 1, | |
| 'comment_form.php' => 1, | |
| 'nmnmultiuserbundle.php' => 1, | |
| 'compact-0045-out.jsonld' => 1, | |
| 'compact-0044-in.jsonld' => 1, | |
| 'compact-0044-out.jsonld' => 1, | |
| 'netlabssmsgatewaybundle.php' => 1, | |
| 'netlabsadminextensionsbundle.php' => 1, | |
| 'safenet.php' => 1, | |
| 'safenet.c' => 1, | |
| 'php_safenet.h' => 1, | |
| 'compact-0045-context.jsonld' => 1, | |
| 'compact-0045-in.jsonld' => 1, | |
| 'traceableauthmanager.php' => 1, | |
| 'relationsrule.php' => 1, | |
| 'compact-0049-in.jsonld' => 1, | |
| 'compact-0049-out.jsonld' => 1, | |
| 'compact-0057-context.jsonld' => 1, | |
| 'compact-0053-in.jsonld' => 1, | |
| 'apiregistercontroller.php' => 1, | |
| 'sidebar' => 1, | |
| 'maisum' => 1, | |
| 'compact-0052-out.jsonld' => 1, | |
| 'johann' => 1, | |
| 'netdudesjstreebundle.php' => 1, | |
| 'netdudesdatasourcerybundle.php' => 1, | |
| 'compact-0053-context.jsonld' => 1, | |
| 'netboxdashboardbundle.php' => 1, | |
| 'app.groovy' => 1, | |
| 'compact-0053-out.jsonld' => 1, | |
| 'exceptionattributes.php' => 1, | |
| 'compact-0054-context.jsonld' => 1, | |
| 'compact-0054-in.jsonld' => 1, | |
| 'compact-0054-out.jsonld' => 1, | |
| 'compact-0055-context.jsonld' => 1, | |
| 'compact-0055-in.jsonld' => 1, | |
| 'compact-0055-out.jsonld' => 1, | |
| 'namecheap' => 1, | |
| 'compact-0056-context.jsonld' => 1, | |
| 'compact-0056-in.jsonld' => 1, | |
| 'compact-0056-out.jsonld' => 1, | |
| 'ioserviceprovider.php' => 1, | |
| 'compact-0052-in.jsonld' => 1, | |
| 'baikalkernelbundle.php' => 1, | |
| 'tagsserviceawaretrait.php' => 1, | |
| 'compact-0050-context.jsonld' => 1, | |
| 'compact-0050-in.jsonld' => 1, | |
| 'compact-0050-out.jsonld' => 1, | |
| 'compact-0051-context.jsonld' => 1, | |
| 'compact-0051-in.jsonld' => 1, | |
| 'compact-0051-out.jsonld' => 1, | |
| 'baikaldavservicesbundle.php' => 1, | |
| 'netgensearchandfilterbundle.php' => 1, | |
| 'ezpublish_readme' => 1, | |
| 'ezpublish_install' => 1, | |
| 'tagsserviceawareinterface.php' => 1, | |
| 'num.php' => 1, | |
| 'netgentagsbundle.php' => 1, | |
| 'netgenopengraphbundle.php' => 1, | |
| 'netgenezsyliusbundle.php' => 1, | |
| 'netgenezformsbundle.php' => 1, | |
| 'netgenenhancedselectionbundle.php' => 1, | |
| 'netgencontenttypelistbundle.php' => 1, | |
| 'netgenbirthdaybundle.php' => 1, | |
| 'compact-0052-context.jsonld' => 1, | |
| 'netgenhybridapproachbundle.php' => 1, | |
| 'netgenhtmlpdfapibundle.php' => 1, | |
| 'htmlpdfapi.php' => 1, | |
| 'compact-0006-in.jsonld' => 1, | |
| 'compact-0005-out.jsonld' => 1, | |
| 'wp-fos-export.php' => 1, | |
| 'job' => 1, | |
| 'packager.xml' => 1, | |
| 'docman.php' => 1, | |
| 'form_validator_props.php' => 1, | |
| 'form_admin.css' => 1, | |
| 'fileman_admin.css' => 1, | |
| 'fileman.php' => 1, | |
| 'docman.xml' => 1, | |
| 'install.script.php' => 1, | |
| 'web' => 1, | |
| 'bitapp.yml.dist' => 1, | |
| 'peclcmd.php' => 1, | |
| 'legacy.xml.dist' => 1, | |
| 'pkg_catcher.xml' => 1, | |
| 'pkg_categories.xml' => 1, | |
| 'pearcmd.php' => 1, | |
| 'mdb2.php' => 1, | |
| 'nomayasocialbundle.php' => 1, | |
| 'nosectionsconfigparserinterface.php' => 1, | |
| 'nosectionsconfigparser.php' => 1, | |
| 'configparserinterface.php' => 1, | |
| 'configparser.php' => 1, | |
| 'baseconfigparser.php' => 1, | |
| 'packager.test.xml' => 1, | |
| 'iblock.php' => 1, | |
| 'noiselabscountrybundle.php' => 1, | |
| 'server_off.html' => 1, | |
| 'vote_tools.php' => 1, | |
| 'vote_admin.css' => 1, | |
| 'keepvoting.php' => 1, | |
| 'translate_tools.php' => 1, | |
| 'herokutarget.php' => 1, | |
| '.env.enc' => 1, | |
| 'jonlilckfinderbundle.php' => 1, | |
| '.scss-lint.yml' => 1, | |
| 'translate_admin.css' => 1, | |
| 'options_user_settings_1.php' => 1, | |
| 'spread.php' => 1, | |
| 'wp-sane-setup.php' => 1, | |
| 'save_colors.php' => 1, | |
| 'option_triggers.php' => 1, | |
| 'jscore.php' => 1, | |
| 'filter_tools.php' => 1, | |
| 'coding_guidelines' => 1, | |
| 'test-requirements' => 1, | |
| 'checklist_structure.php' => 1, | |
| 'bx_root.php' => 1, | |
| 'ajax_tools.php' => 1, | |
| '.director.yml' => 1, | |
| 'director' => 1, | |
| 'noiselabsnusoapbundle.php' => 1, | |
| 'countrymanager.php' => 1, | |
| 'edgarezcdnbundle.php' => 1, | |
| 'useragentobject.php' => 1, | |
| 'kunena.php' => 1, | |
| 'kunena.xml' => 1, | |
| 'nnmerutilsbundle.php' => 1, | |
| 'nnmerpushnotificationbundle.php' => 1, | |
| 'doorman.php' => 1, | |
| 'rephpd.sh' => 1, | |
| 'makefile.ini' => 1, | |
| 'useragentparser.php' => 1, | |
| 'remository.php' => 1, | |
| 'remository.xml' => 1, | |
| 'bootstrappbundle.php' => 1, | |
| 'sdl' => 1, | |
| 'default_transcoder.php' => 1, | |
| 'connstr.php' => 1, | |
| 'couchbaseviewquery.class.php' => 1, | |
| 'zoo.xml' => 1, | |
| 'couchbasen1qlquery.class.php' => 1, | |
| 'couchbaseclustermanager.class.php' => 1, | |
| 'jordillonchcrudgeneratorbundle.php' => 1, | |
| 'jordillonchdeploybundle.php' => 1, | |
| 'couchbasecluster.class.php' => 1, | |
| 'couchbasebucketmanager.class.php' => 1, | |
| 'readme-0.1.x' => 1, | |
| 'komento.xml' => 1, | |
| 'readme-pixiv' => 1, | |
| 'nodrewembedlybundle.php' => 1, | |
| 'readme-aozora' => 1, | |
| 'easydiscuss.php' => 1, | |
| 'easydiscuss.xml' => 1, | |
| 'bootstrap.phpunit.php' => 1, | |
| 'noetixtractionbundle.php' => 1, | |
| 'parameters.ini.dist' => 1, | |
| 'simpleorm.class.php' => 1, | |
| 'nodrewexceptionalbundle.php' => 1, | |
| 'jevents.php' => 1, | |
| 'jevents.xml' => 1, | |
| 'marvin' => 1, | |
| 'wm.api' => 1, | |
| 'k2.php' => 1, | |
| 'traits.twig' => 1, | |
| 'namespaces.twig' => 1, | |
| 'k2.xml' => 1, | |
| 'namespace.twig' => 1, | |
| 'interfaces.twig' => 1, | |
| 'doc-index.twig' => 1, | |
| 'classes.twig' => 1, | |
| 'komento.php' => 1, | |
| 'class.twig' => 1, | |
| 'phormat' => 1, | |
| 'template.json.dist' => 1, | |
| 'edgarezqrcodebundle.php' => 1, | |
| 'wtfcartbundle.php' => 1, | |
| 'noylecorpdoctrineextrasbundle.php' => 1, | |
| 'travisci-install.sh' => 1, | |
| 'phpiredis.ini' => 1, | |
| 'jomi' => 1, | |
| 'jomi.php' => 1, | |
| 'googleauthenticatorbundle.php' => 1, | |
| '.config.env.sample' => 1, | |
| '.config.env' => 1, | |
| 'php5-image.png' => 1, | |
| 'ajaxyasset.php' => 1, | |
| 'ajaxy.php' => 1, | |
| 'sunrise.php' => 1, | |
| 'nescartbundle.php' => 1, | |
| 'novuso-wp-common.php' => 1, | |
| 'novuscomcmfuserbundle.php' => 1, | |
| 'numeratormasker.php' => 1, | |
| 'numerator.php' => 1, | |
| 'flex_config.php' => 1, | |
| 'templatetrait.php' => 1, | |
| 'flexiblegrid.php' => 1, | |
| 'flexibleform.php' => 1, | |
| 'collapsablefield.php' => 1, | |
| 'phpqrcodebundle.php' => 1, | |
| 'servicesadminbundle.php' => 1, | |
| 'multiactiverecord.php' => 1, | |
| 'novawayfilemanagementbundle.php' => 1, | |
| 'mediaelementasset.php' => 1, | |
| 'wp-fos-import.php' => 1, | |
| 'options-admin.php' => 1, | |
| 'code.photoswipe-3.0.5.min.js' => 1, | |
| 'code.photoswipe-3.0.5.js' => 1, | |
| 'intercom.php' => 1, | |
| 'nutoolboxfoundationbundle.php' => 1, | |
| 'wyf_bootstrap.php' => 1, | |
| 'nthrootenhancedimagebundle.php' => 1, | |
| 'xzjg.xml' => 1, | |
| 'chartsredactorpluginasset.php' => 1, | |
| 'options-user.php' => 1, | |
| 'info.plist' => 1, | |
| 'shibboleth-mu.php' => 1, | |
| 'mediaelement.php' => 1, | |
| 'apachetikabundle.php' => 1, | |
| 'ntscorecalculatorbundle.php' => 1, | |
| 'gifexceptionbundle.php' => 1, | |
| 'jscrollpanewidget.php' => 1, | |
| 'intllessslugbehavior.php' => 1, | |
| 'nscpsformbundle.php' => 1, | |
| 'jolitypobundle.php' => 1, | |
| 'nscpsbrazilformbundle.php' => 1, | |
| 'kocart.sql' => 1, | |
| 'novawayopengraphbundle.php' => 1, | |
| 'nova' => 1, | |
| 'logger-example.php' => 1, | |
| 'jsoner.php' => 1, | |
| 'construct' => 1, | |
| 'balloufactory.php' => 1, | |
| 'project.sublime-workspace' => 1, | |
| 'jgibillogrambundle.php' => 1, | |
| 'project.sublime-project' => 1, | |
| 'sentrytarget.php' => 1, | |
| 'jgideadmanssnitchbundle.php' => 1, | |
| 'jgiswedishdatesbundle.php' => 1, | |
| 'agents-list.png' => 1, | |
| 'norzechowiczaceeditorbundle.php' => 1, | |
| 'jsoner.i18n.magic.php' => 1, | |
| 'campfirefactory.php' => 1, | |
| 'jsoner.hooks.php' => 1, | |
| 'noregressiontestbundle.php' => 1, | |
| 'nsactiverecord.php' => 1, | |
| 'airplane-mode.php' => 1, | |
| 'uploadform.php' => 1, | |
| 'pipes.php' => 1, | |
| 'pkg_todo.xml' => 1, | |
| 'basicauth.xml' => 1, | |
| 'basicauth.php' => 1, | |
| 'mysqli_etc.php' => 1, | |
| 'ballougateway.php' => 1, | |
| 'campfiregateway.php' => 1, | |
| 'yogateway.php' => 1, | |
| 'twiliofactory.php' => 1, | |
| 'registry-bundle.iml' => 1, | |
| 'tcpdfbundle.php' => 1, | |
| 'acf_pages_by_template.php' => 1, | |
| 'acf_pages_by_template_v4.php' => 1, | |
| 'acf_pages_by_template_v5.php' => 1, | |
| 'yofactory.php' => 1, | |
| 'jbibrowscapbundle.php' => 1, | |
| 'webhookgateway.php' => 1, | |
| 'webhookfactory.php' => 1, | |
| 'twiliogateway.php' => 1, | |
| 'slackgateway.php' => 1, | |
| 'notifymefactory.php' => 1, | |
| 'slackfactory.php' => 1, | |
| 'pushovergateway.php' => 1, | |
| 'pushoverfactory.php' => 1, | |
| 'pagerdutygateway.php' => 1, | |
| 'pagerdutyfactory.php' => 1, | |
| 'notifymemanager.php' => 1, | |
| 'gatewaytrait.php' => 1, | |
| 'hipchatgateway.php' => 1, | |
| 'hipchatfactory.php' => 1, | |
| 'gittergateway.php' => 1, | |
| 'gitterfactory.php' => 1, | |
| 'hyperion' => 1, | |
| 'couchbasebucket.class.php' => 1, | |
| 'compact-0005-in.jsonld' => 1, | |
| 'admin.settings.load.php' => 1, | |
| 'constants.inc.php' => 1, | |
| 'favico.ico' => 1, | |
| 'duo.load.php' => 1, | |
| 'apache-default.conf' => 1, | |
| 'modifiers.inc.php' => 1, | |
| 'tdnpilotbundle.php' => 1, | |
| 'admin.settings_duo.php' => 1, | |
| 'admin.settings_categories.php' => 1, | |
| 'admin.settings_api.php' => 1, | |
| 'admin.settings.php' => 1, | |
| 'csvexport.php' => 1, | |
| 'jrkdynamicpopupbundle.php' => 1, | |
| 'php_todo_finder.yml.sample' => 1, | |
| 'php_forbidden_function.yml.sample' => 1, | |
| 'php_forbidden_function.yml' => 1, | |
| 'sphinx.conf' => 1, | |
| 'mahana.sql' => 1, | |
| 'movies.sql' => 1, | |
| 'westest.php' => 1, | |
| 'mahana_address.php' => 1, | |
| 'after_build.sh' => 1, | |
| 'myfile' => 1, | |
| 'jrklevenshteinbundle.php' => 1, | |
| 'jrkadminatombundle.php' => 1, | |
| 'tests_config.sample' => 1, | |
| 'joypasswd.php' => 1, | |
| 'transit.php' => 1, | |
| 'kb.load.php' => 1, | |
| 'jotform.php' => 1, | |
| 'status.log' => 1, | |
| 'amazons3.php' => 1, | |
| 'items.php' => 1, | |
| 'items.offline.php' => 1, | |
| 'items.load.php' => 1, | |
| 'items.import.php' => 1, | |
| 'items.export.php' => 1, | |
| 'home.load.php' => 1, | |
| 'jrkpaymentsipsbundle.php' => 1, | |
| 'folders.php' => 1, | |
| 'mogreet.php' => 1, | |
| 'exploringfileutilitybundle.php' => 1, | |
| 'exploringstatusbundle.php' => 1, | |
| 'jpierrontapibatchbundle.php' => 1, | |
| 'changelog-0.0.0' => 1, | |
| 'hclabsmodelmanagerbundle.php' => 1, | |
| 'folders.load.php' => 1, | |
| 'jrkeasypaginationbundle.php' => 1, | |
| 'jrkfoobundle.php' => 1, | |
| 'find.load.php' => 1, | |
| 'nazkaaccesstokensecuritybundle.php' => 1, | |
| 'example.tpl' => 1, | |
| 'kb.php' => 1, | |
| 'satisbundle.php' => 1, | |
| 'install_mecab_php-mecab.sh' => 1, | |
| 'nighonweixinevents.php' => 1, | |
| 'nighonweixinbundle.php' => 1, | |
| 'nietonfirraygunbundle.php' => 1, | |
| 'compact-0002-in.jsonld' => 1, | |
| 'compact-0002-out.jsonld' => 1, | |
| 'compact-0003-context.jsonld' => 1, | |
| 'nietonfirgooglerecaptchabundle.php' => 1, | |
| 'googlerecaptcha.sublime-project' => 1, | |
| 'icebreadcrumbsbundle.php' => 1, | |
| 'nkuserbundle.php' => 1, | |
| 'compact-0001-out.jsonld' => 1, | |
| 'nkadminbundle.php' => 1, | |
| 'compact-0003-in.jsonld' => 1, | |
| 'compact-0003-out.jsonld' => 1, | |
| 'nicotecdoctrineautobundle.php' => 1, | |
| 'nmureencryptorbundle.php' => 1, | |
| 'ndewezwebhomecalendarapibundle.php' => 1, | |
| 'compact-0004-context.jsonld' => 1, | |
| 'compact-0004-in.jsonld' => 1, | |
| 'compact-0004-out.jsonld' => 1, | |
| 'compact-0005-context.jsonld' => 1, | |
| 'compact-0002-context.jsonld' => 1, | |
| 'compact-0001-in.jsonld' => 1, | |
| 'div.php' => 1, | |
| 'nazkaobjectmanagerbundle.php' => 1, | |
| 'div.html' => 1, | |
| 'dissalowed.php' => 1, | |
| 'dissalowedwomensnameslist_el_gr' => 1, | |
| 'dissalowedusernameslist' => 1, | |
| 'dissalowedpornsiteslist' => 1, | |
| 'dissalowedmannameslist_el_gr' => 1, | |
| 'nazkaattachmentbundle.php' => 1, | |
| 'dissalowedbadwordslist_en_us' => 1, | |
| 'dissalowedbadwordslist_el_gr' => 1, | |
| 'nazkalocationbundle.php' => 1, | |
| 'fastroute.hhi' => 1, | |
| 'compact-0001-context.jsonld' => 1, | |
| 'nazkapayablebundle.php' => 1, | |
| 'lazyloader.php' => 1, | |
| 'o.php' => 1, | |
| '.csscomb.json' => 1, | |
| 'gitlab-ci.yml' => 1, | |
| 'md-ruleset.xml' => 1, | |
| 'travis-php-mecab.sh' => 1, | |
| 'xdebughelper.php' => 1, | |
| 'xdebug-helper.tab.phtml' => 1, | |
| 'oocurl.php' => 1, | |
| 'limelight_console' => 1, | |
| 'scandb.php' => 1, | |
| 'otv.php' => 1, | |
| 'migration.tpl' => 1, | |
| 'build.watchdog.xml' => 1, | |
| 'amazonproductlink.php' => 1, | |
| 'amazonconfig.php' => 1, | |
| 'dtpspybundle.php' => 1, | |
| 'colourpicker.png' => 1, | |
| 'usrmodule.php' => 1, | |
| 'nfymodule.php' => 1, | |
| 'build.download.xml' => 1, | |
| 'exportaction.php' => 1, | |
| 'eactivefinder.php' => 1, | |
| 'build.maintenance.xml' => 1, | |
| 'clay.php' => 1, | |
| 'iptoamazon.data' => 1, | |
| 'fhpostcodeapinubundle.php' => 1, | |
| 'elinkcolumn.php' => 1, | |
| 'egridcolumn.php' => 1, | |
| 'eeditablecolumn.php' => 1, | |
| 'joschi127doctrineentityoverridebundle.php' => 1, | |
| 'edatatables.php' => 1, | |
| 'phptimer.php' => 1, | |
| 'scrapermorefaster.php' => 1, | |
| 'smf_tester.php' => 1, | |
| 'edatacolumn.php' => 1, | |
| 'amazonstatic.php' => 1, | |
| 'iframeresizer.php' => 1, | |
| 'edtpagination.php' => 1, | |
| 'phplint' => 1, | |
| 'mogilefs.php' => 1, | |
| 'linkpagesizer.php' => 1, | |
| 'userinfointerface.php' => 1, | |
| 'consoleerrorhandler.php' => 1, | |
| 'localeconverter.php' => 1, | |
| 'yiiwhoopsinspector.php' => 1, | |
| 'behat.example.yml' => 1, | |
| 'dbsteward.php' => 1, | |
| 'vhost.conf' => 1, | |
| '.config.properties' => 1, | |
| 'phpspecgen.php' => 1, | |
| 'iframeresizerasset.php' => 1, | |
| 'doap.php' => 1, | |
| 'sass.php' => 1, | |
| 'less.php' => 1, | |
| 'nixillaapiloggerbundle.php' => 1, | |
| 'mailrustrategy.php' => 1, | |
| 'nwlog.php' => 1, | |
| 'nwfileoperations.php' => 1, | |
| 'nwdatabase.php' => 1, | |
| 'nitrathemebundle.php' => 1, | |
| 'prettyphotoasset.php' => 1, | |
| 'prettyphoto.php' => 1, | |
| 'edtsort.php' => 1, | |
| 'echeckboxcolumn.php' => 1, | |
| 'createtables.sql' => 1, | |
| 'minion.example.yml' => 1, | |
| 'adminserviceprovider.php' => 1, | |
| 'twbs3serviceprovider.php' => 1, | |
| 'twbs3jumbonarrowserviceprovider.php' => 1, | |
| 'seed.csv' => 1, | |
| 'docs.pdf' => 1, | |
| 'adminlteserviceprovider.php' => 1, | |
| 'snapshot.php' => 1, | |
| 'notifyasset.php' => 1, | |
| 'bugtracker.php' => 1, | |
| 'ryzom_extra.php' => 1, | |
| 'runit.php' => 1, | |
| 'packagelist.php' => 1, | |
| 'views_logs.php' => 1, | |
| 'views_logs.load.php' => 1, | |
| 'views_database.php' => 1, | |
| 'views_database.load.php' => 1, | |
| 'views.load.php' => 1, | |
| 'users.load.php' => 1, | |
| 'suggestion.php' => 1, | |
| 'suggestion.load.php' => 1, | |
| 'cron' => 1, | |
| 'roles.load.php' => 1, | |
| 'dotenvstore.php' => 1, | |
| 'readme_sample' => 1, | |
| 'ebuttoncolumn.php' => 1, | |
| 'logserviceprovider.php' => 1, | |
| 'diceware.wordlist' => 1, | |
| 'diceware.pl.wordlist' => 1, | |
| 'diceware.php' => 1, | |
| 'jjbformutilsbundle.php' => 1, | |
| 'qqfileuploader.php' => 1, | |
| 'uploadsaveaction.php' => 1, | |
| 'uploaddeleteaction.php' => 1, | |
| 'eajaxuploadaction.php' => 1, | |
| 'eajaxupload.php' => 1, | |
| 'togglecomposer' => 1, | |
| 'wikiserviceprovider.php' => 1, | |
| 'codemitteforcetoolkitbundle.php' => 1, | |
| 'meerkat.php' => 1, | |
| 'mysqlidb.php' => 1, | |
| 'simpleboardserviceprovider.php' => 1, | |
| 'shopserviceprovider.php' => 1, | |
| 'dbobject' => 1, | |
| 'qnaserviceprovider.php' => 1, | |
| 'pageserviceprovider.php' => 1, | |
| 'productflatchangelogtest.php' => 1, | |
| 'classrewriter.php' => 1, | |
| 'pathresolver.php' => 1, | |
| 'mage-includes.php' => 1, | |
| 'flatten-0030-in.jsonld' => 1, | |
| 'abstracteloquentstatisticsprovider.php' => 1, | |
| 'rabbit-setup' => 1, | |
| 'select2_locale_cs.js' => 1, | |
| 'select2_locale_et.js' => 1, | |
| 'application_form.png' => 1, | |
| 'select2_locale_es.js' => 1, | |
| 'select2_locale_en.js.template' => 1, | |
| 'application_form_add.png' => 1, | |
| 'application_form_delete.png' => 1, | |
| 'select2_locale_el.js' => 1, | |
| 'select2_locale_de.js' => 1, | |
| 'select2_locale_da.js' => 1, | |
| 'application_form_edit.png' => 1, | |
| 'application_form_magnify.png' => 1, | |
| 'select2_locale_fa.js' => 1, | |
| 'select2_locale_ca.js' => 1, | |
| 'select2_locale_bg.js' => 1, | |
| 'select2_locale_az.js' => 1, | |
| 'select2_locale_ar.js' => 1, | |
| 'select2.png' => 1, | |
| 'select2.min.js' => 1, | |
| 'select2.js' => 1, | |
| 'select2.jquery.json' => 1, | |
| 'select2.css' => 1, | |
| 'application_get.png' => 1, | |
| 'select2_locale_eu.js' => 1, | |
| 'select2_locale_fi.js' => 1, | |
| 'application_go.png' => 1, | |
| 'select2_locale_he.js' => 1, | |
| 'select2_locale_ka.js' => 1, | |
| 'densa-lang-en.js' => 1, | |
| 'extensible-lang-en.js' => 1, | |
| 'select2_locale_ja.js' => 1, | |
| 'error.js' => 1, | |
| 'select2_locale_it.js' => 1, | |
| 'select2_locale_is.js' => 1, | |
| 'select2_locale_id.js' => 1, | |
| 'select2_locale_hu.js' => 1, | |
| 'select2_locale_hr.js' => 1, | |
| 'select2_locale_gl.js' => 1, | |
| 'application_error.png' => 1, | |
| 'ext-lang-en.js' => 1, | |
| 'pie.htc' => 1, | |
| 'accept.png' => 1, | |
| 'anchor.png' => 1, | |
| 'application.png' => 1, | |
| 'application_add.png' => 1, | |
| 'application_cascade.png' => 1, | |
| 'select2_locale_fr.js' => 1, | |
| 'application_delete.png' => 1, | |
| 'application_double.png' => 1, | |
| 'application_edit.png' => 1, | |
| 'select2-spinner.gif' => 1, | |
| 'select2-bootstrap.css' => 1, | |
| 'select2_locale_lt.js' => 1, | |
| 'kernelexceptionlistener.php' => 1, | |
| '2014-08-01-15.json' => 1, | |
| 'application_view_list.png' => 1, | |
| 'example-user-config.yml' => 1, | |
| 'kwattroneo4jbundle.php' => 1, | |
| 'application_view_tile.png' => 1, | |
| 'application_xp.png' => 1, | |
| 'application_xp_terminal.png' => 1, | |
| 'arrow_branch.png' => 1, | |
| 'kutnytracybundle.php' => 1, | |
| 'arrow_divide.png' => 1, | |
| 'templateresolver.php' => 1, | |
| 'routerserviceprovider.php' => 1, | |
| 'kutnynobundlecontrollersbundle.php' => 1, | |
| 'arrow_down.png' => 1, | |
| 'findcontrollerservicescompilerpass.php' => 1, | |
| 'arrow_in.png' => 1, | |
| 'arrow_inout.png' => 1, | |
| 'arrow_join.png' => 1, | |
| 'kutnyfixturesbundle.php' => 1, | |
| 'kutnyautowiringbundle.php' => 1, | |
| 'autowiringcompilerpass.php' => 1, | |
| 'kustovvitalikmaintenancebundle.php' => 1, | |
| 'httpserviceprovider.php' => 1, | |
| 'arc2_testhandler.php' => 1, | |
| 'application_key.png' => 1, | |
| 'highmaps.js' => 1, | |
| 'application_lightning.png' => 1, | |
| 'application_link.png' => 1, | |
| 'application_osx.png' => 1, | |
| 'kwizerpdfbundle.php' => 1, | |
| 'highstock.src.js' => 1, | |
| 'highstock.js' => 1, | |
| 'application_osx_terminal.png' => 1, | |
| 'application_put.png' => 1, | |
| 'highstock-all.js' => 1, | |
| 'highmaps.src.js' => 1, | |
| 'application_side_boxes.png' => 1, | |
| 'application_view_icons.png' => 1, | |
| 'application_side_contract.png' => 1, | |
| 'application_side_expand.png' => 1, | |
| 'application_side_list.png' => 1, | |
| 'application_side_tree.png' => 1, | |
| 'application_split.png' => 1, | |
| 'application_tile_horizontal.png' => 1, | |
| 'todo.mkd' => 1, | |
| 'application_tile_vertical.png' => 1, | |
| 'application_view_columns.png' => 1, | |
| 'application_view_detail.png' => 1, | |
| 'application_view_gallery.png' => 1, | |
| 'select2_locale_ko.js' => 1, | |
| 'select2_locale_lv.js' => 1, | |
| 'arrow_merge.png' => 1, | |
| 'rgraphrose.php' => 1, | |
| 'naturaltime.php' => 1, | |
| 'logclient.php' => 1, | |
| 'phpunitawaretrait.php' => 1, | |
| 'phpunitawareinterface.php' => 1, | |
| 'phpunitaware.php' => 1, | |
| 'transmissionbundle.php' => 1, | |
| 'lifetime.php' => 1, | |
| 'labzonegitbundle.php' => 1, | |
| 'rgraphrscatter.php' => 1, | |
| 'rgraphradar.php' => 1, | |
| 'rgraphwaterfall.php' => 1, | |
| 'l10nbundle.php' => 1, | |
| 'rgraphwidget.php' => 1, | |
| 'package_builder.php' => 1, | |
| 'seosacommentbundle.php' => 1, | |
| 'seosafeedbackbundle.php' => 1, | |
| 'phpfastimage' => 1, | |
| 'seosaimaginebundle.php' => 1, | |
| 'kasonataadminjmstranslationbundle.php' => 1, | |
| 'doctrineprefixrbundle.php' => 1, | |
| 'feedreader.php' => 1, | |
| 'phpsesame.php' => 1, | |
| 'adobecampaignclientbundle.php' => 1, | |
| 'rgraphpie.php' => 1, | |
| 'jquery.jsplumb.min.js' => 1, | |
| 'rgraphgantt.php' => 1, | |
| 'wizresquebundle.php' => 1, | |
| 'constant.php' => 1, | |
| 'wizpaymentgatewaybundle.php' => 1, | |
| 'settingslib.php' => 1, | |
| 'rgraphbar.php' => 1, | |
| 'block_mhaairs_util.php' => 1, | |
| 'block_mhaairs_info.php' => 1, | |
| 'block_mhaairs_action.php' => 1, | |
| 'block_mhaairs.php' => 1, | |
| 'robot' => 1, | |
| 'fr_fr.script.csv' => 1, | |
| 'lafourchettebreadcrumbsbundle.php' => 1, | |
| 'rgraphhbar.php' => 1, | |
| 'fr_fr.missing.csv' => 1, | |
| 'rgraphhprogress.php' => 1, | |
| 'rgraphled.php' => 1, | |
| 'transpile' => 1, | |
| 'hack_test_bootstrap.php' => 1, | |
| 'talendclientbundle.php' => 1, | |
| 'rgraphline.php' => 1, | |
| 'switchuserstatelessbundle.php' => 1, | |
| 'pagerdutybundleexception.php' => 1, | |
| 'lafourchettepagerdutybundle.php' => 1, | |
| 'limitedtextarea.php' => 1, | |
| 'jquery.jsplumb.js' => 1, | |
| 'select2_locale_mk.js' => 1, | |
| 'select2_locale_ru.js' => 1, | |
| 'select2_locale_zh-tw.js' => 1, | |
| 'select2_locale_zh-cn.js' => 1, | |
| 'select2_locale_vi.js' => 1, | |
| 'select2_locale_uk.js' => 1, | |
| 'select2_locale_tr.js' => 1, | |
| 'select2_locale_th.js' => 1, | |
| 'compress.bat' => 1, | |
| 'select2_locale_sv.js' => 1, | |
| 'dump.bat' => 1, | |
| 'select2_locale_sk.js' => 1, | |
| 'select2_locale_rs.js' => 1, | |
| 'kwnrecognizeimbundle.php' => 1, | |
| 'select2_locale_ro.js' => 1, | |
| 'select2_locale_pt-pt.js' => 1, | |
| 'select2_locale_pt-br.js' => 1, | |
| 'yamato' => 1, | |
| 'hlp.xml' => 1, | |
| 'select2_locale_pl.js' => 1, | |
| 'field.js' => 1, | |
| 'select2_locale_no.js' => 1, | |
| 'select2_locale_nl.js' => 1, | |
| 'select2_locale_ms.js' => 1, | |
| 'select2x2.png' => 1, | |
| 'smssendercomponent.php' => 1, | |
| 'dom.jsplumb.min.js' => 1, | |
| 'sbp.php' => 1, | |
| 'hateoasbundle.php' => 1, | |
| 'dom.jsplumb.js' => 1, | |
| 'php-cg' => 1, | |
| 'slowdb' => 1, | |
| 'slowdb.jpg' => 1, | |
| 'markdown-spec.html' => 1, | |
| 'readme.skel' => 1, | |
| 'unknownformatexception.php' => 1, | |
| 'testcases' => 1, | |
| 'magelink.py' => 1, | |
| 'sbp' => 1, | |
| 'phpunit.xml.report' => 1, | |
| 'backendltebundle.php' => 1, | |
| 'cmd.bat' => 1, | |
| 'kcmediabundle.php' => 1, | |
| 'symfony-console' => 1, | |
| 'knorthfieldspresssass.php' => 1, | |
| 'sassminify.php' => 1, | |
| 'knorthfieldspressslugify.php' => 1, | |
| 'knoxgurunsbundle.php' => 1, | |
| 'knpuguardbundle.php' => 1, | |
| 'knpuoauth2clientbundle.php' => 1, | |
| 'kmap.php' => 1, | |
| 'arrow_left.png' => 1, | |
| 'arrow_out.png' => 1, | |
| 'jsnapcommander.php' => 1, | |
| 'building_add.png' => 1, | |
| 'bug_add.png' => 1, | |
| 'bug_delete.png' => 1, | |
| 'bug_edit.png' => 1, | |
| 'bug_error.png' => 1, | |
| 'bug_go.png' => 1, | |
| 'bug_link.png' => 1, | |
| 'building.png' => 1, | |
| 'ioniconsasset.php' => 1, | |
| 'adminltewidgettrait.php' => 1, | |
| 'kotiktestbundle.php' => 1, | |
| 'building_delete.png' => 1, | |
| 'briefcase.png' => 1, | |
| 'yiifotoramawidget.php' => 1, | |
| 'shortid.php' => 1, | |
| 'smartersalesforcebundle.php' => 1, | |
| 'labelwidget.php' => 1, | |
| 'info.jpg' => 1, | |
| 'building_edit.png' => 1, | |
| 'korneiljtmpasseticfilterbundle.php' => 1, | |
| 'building_error.png' => 1, | |
| 'logentriestarget.php' => 1, | |
| 'conditionalvalidator.php' => 1, | |
| 'bug.png' => 1, | |
| 'bricks.png' => 1, | |
| 'building_go.png' => 1, | |
| 'jquery.nivo.slider.js' => 1, | |
| 'box.png' => 1, | |
| 'kreaitfirebasebundle.php' => 1, | |
| 'permissions.jpg' => 1, | |
| 'brick.png' => 1, | |
| 'brick_add.png' => 1, | |
| 'play.html' => 1, | |
| 'cinemr.php' => 1, | |
| 'nivoslider.jquery.json' => 1, | |
| 'nivo-slider.css' => 1, | |
| 'jquery.nivo.slider.pack.js' => 1, | |
| 'stpredactorbundle.php' => 1, | |
| 'brick_link.png' => 1, | |
| 'stubs.php' => 1, | |
| 'brick_delete.png' => 1, | |
| 'brick_edit.png' => 1, | |
| 'brick_error.png' => 1, | |
| 'php_jitfu.h' => 1, | |
| 'jitfu.c' => 1, | |
| 'brick_go.png' => 1, | |
| 'renderer' => 1, | |
| 'relcopyasset.php' => 1, | |
| 'kpicazagoogleanalyticsbundle.php' => 1, | |
| 'codehighlightbundle.php' => 1, | |
| 'k1.php' => 1, | |
| 'k1.bat' => 1, | |
| 'kretacorebundle.php' => 1, | |
| 'bullet_error.png' => 1, | |
| 'bullet_black.png' => 1, | |
| 'eee' => 1, | |
| 'ddd' => 1, | |
| 'bullet_blue.png' => 1, | |
| 'ccc' => 1, | |
| 'bbb' => 1, | |
| 'altax.phar' => 1, | |
| 'bullet_delete.png' => 1, | |
| 'adminer.png' => 1, | |
| 'bullet_disk.png' => 1, | |
| 'kodifysimplecrudbundle.php' => 1, | |
| 'skcmsadminbundle.php' => 1, | |
| 'kodifydownloaderbundle.php' => 1, | |
| 'kodazzi' => 1, | |
| 'bullet_feed.png' => 1, | |
| 'ys' => 1, | |
| 'bullet_go.png' => 1, | |
| 'example-mailhide.php' => 1, | |
| 'example-captcha.php' => 1, | |
| 'swfupload.js' => 1, | |
| 'swfupload license' => 1, | |
| 'core changelog' => 1, | |
| 'http' => 1, | |
| 'bullet_arrow_up.png' => 1, | |
| 'k1' => 1, | |
| 'unteist.services.yml' => 1, | |
| 'building_key.png' => 1, | |
| 'konkretnyphpnewsletter.class.php' => 1, | |
| 'sendpush.php' => 1, | |
| 'building_link.png' => 1, | |
| 'bullet_add.png' => 1, | |
| 'bullet_arrow_bottom.png' => 1, | |
| 'konkretnygcm.class.php' => 1, | |
| 'konduto.php' => 1, | |
| 'bullet_arrow_down.png' => 1, | |
| 'unteist.yml' => 1, | |
| 'config-sample.yml' => 1, | |
| 'skcmsckfinderbundle.php' => 1, | |
| 'auth' => 1, | |
| 'kolbaassetsinstallextendedbundle.php' => 1, | |
| 'bullet_arrow_top.png' => 1, | |
| 'skcmsuserbundle.php' => 1, | |
| 'skcmstrashbinbundle.php' => 1, | |
| 'skcmstrackingbundle.php' => 1, | |
| 'skcmsshopbundle.php' => 1, | |
| 'skcmslocalebundle.php' => 1, | |
| 'skcmsfrontbundle.php' => 1, | |
| 'skcmscorebundle.php' => 1, | |
| 'skcmscontactbundle.php' => 1, | |
| 'checkboxtree.php' => 1, | |
| 'kretaissuebundle.php' => 1, | |
| 'arrow_redo.png' => 1, | |
| 'award_star_silver_1.png' => 1, | |
| 'smartmenusasset.php' => 1, | |
| 'award_star_bronze_1.png' => 1, | |
| 'award_star_bronze_2.png' => 1, | |
| 'award_star_bronze_3.png' => 1, | |
| 'award_star_delete.png' => 1, | |
| 'materializeinitasset.php' => 1, | |
| 'award_star_gold_1.png' => 1, | |
| 'upload.htaccess' => 1, | |
| 'award_star_gold_2.png' => 1, | |
| 'award_star_gold_3.png' => 1, | |
| 'award_star_silver_2.png' => 1, | |
| 'kuborghcsvbundle.php' => 1, | |
| 'award_star_silver_3.png' => 1, | |
| 'kcfindertextinput.php' => 1, | |
| 'kt_init.inc.php' => 1, | |
| 'basket.png' => 1, | |
| 'basket_add.png' => 1, | |
| 'rfcvalidator.php' => 1, | |
| 'curpvalidator.php' => 1, | |
| 'agilezenapi.php' => 1, | |
| 'numeroaletra.php' => 1, | |
| 'acknowledgements' => 1, | |
| 'award_star_add.png' => 1, | |
| 'datatransferbundle.php' => 1, | |
| 'phcompile.min.js' => 1, | |
| 'arrow_turn_right.png' => 1, | |
| 'taginputasset.php' => 1, | |
| 'taginput.php' => 1, | |
| 'arrow_refresh.png' => 1, | |
| 'followersocial.php' => 1, | |
| 'arrow_refresh_small.png' => 1, | |
| 'arrow_right.png' => 1, | |
| 'arrow_rotate_anticlockwise.png' => 1, | |
| 'arrow_rotate_clockwise.png' => 1, | |
| 'arrow_switch.png' => 1, | |
| 'arrow_turn_left.png' => 1, | |
| 'arrow_undo.png' => 1, | |
| 'kuborghqueuebundle.php' => 1, | |
| 'arrow_up.png' => 1, | |
| 'asterisk_orange.png' => 1, | |
| 'crear_phps.sh' => 1, | |
| 'asterisk_yellow.png' => 1, | |
| 'attach.png' => 1, | |
| 'doc_php_beautifier.ini' => 1, | |
| 'beautifier.php' => 1, | |
| 'kukulililabsfeaturetogglebundle.php' => 1, | |
| 'menu-icons-icomoon.php' => 1, | |
| 'icomoon.php' => 1, | |
| 'icomoon-ip.php' => 1, | |
| 'ksn135htpasswdbundle.php' => 1, | |
| 'basket_edit.png' => 1, | |
| 'kretamediabundle.php' => 1, | |
| 'gridviewassets.php' => 1, | |
| 'book_edit.png' => 1, | |
| 'book_error.png' => 1, | |
| 'book_go.png' => 1, | |
| 'book_key.png' => 1, | |
| 'book_link.png' => 1, | |
| 'skinasset.php' => 1, | |
| 'beyondasset.php' => 1, | |
| 'mageboy.png' => 1, | |
| 'book_next.png' => 1, | |
| 'blade-foundation.sublime-project' => 1, | |
| 'activetreeprovider.php' => 1, | |
| 'book_delete.png' => 1, | |
| 'referencebuilder.php' => 1, | |
| 'outputparser.php' => 1, | |
| 'diatheke.php' => 1, | |
| 'cogstupidmqbundle.php' => 1, | |
| 'kretaworkflowbundle.php' => 1, | |
| 'kretauserbundle.php' => 1, | |
| 'kretaprojectbundle.php' => 1, | |
| 'kretanotificationbundle.php' => 1, | |
| 'book_open.png' => 1, | |
| 'book_previous.png' => 1, | |
| 'kristofvclistbundle.php' => 1, | |
| 'book_addresses.png' => 1, | |
| 'phcompile.js' => 1, | |
| 'bell_go.png' => 1, | |
| 'basket_error.png' => 1, | |
| 'basket_go.png' => 1, | |
| 'tests_config.php' => 1, | |
| 'basket_put.png' => 1, | |
| 'basket_remove.png' => 1, | |
| 'bell.png' => 1, | |
| 'bell_add.png' => 1, | |
| 'bell_delete.png' => 1, | |
| 'bell_error.png' => 1, | |
| 'db_latest.sql' => 1, | |
| 'bell_link.png' => 1, | |
| 'book_add.png' => 1, | |
| 'bin.png' => 1, | |
| 'bin_closed.png' => 1, | |
| 'api-key.php.enc' => 1, | |
| 'bin_empty.png' => 1, | |
| 'api-key.php' => 1, | |
| 'smpp.php' => 1, | |
| 'kronassmppclientbundle.php' => 1, | |
| 'kronasrollbarbundle.php' => 1, | |
| 'krocosfileuploadbundle.php' => 1, | |
| 'bomb.png' => 1, | |
| 'book.png' => 1, | |
| 'hostnameseek.php' => 1, | |
| 'jsnaphelpers.php' => 1, | |
| 'swfobject.js' => 1, | |
| 'breadcrumbspanel.php' => 1, | |
| 'external.json.dist' => 1, | |
| '256colors.php' => 1, | |
| 'ktwdatabasemenubundle.php' => 1, | |
| 'fvd.php' => 1, | |
| 'readme.mt' => 1, | |
| 'filetest.php' => 1, | |
| 'baseplugin.php' => 1, | |
| 'changelogsplugin.php' => 1, | |
| 'uploads3.php' => 1, | |
| 'amazonses.php' => 1, | |
| 'imageajax.php' => 1, | |
| 'parserconstants.php' => 1, | |
| 'jsonform.php' => 1, | |
| 'lastpage.php' => 1, | |
| 'panelcount.php' => 1, | |
| 'pluploadjuiasset.php' => 1, | |
| 'verticalmenu.php' => 1, | |
| 'basegateway.php' => 1, | |
| 'zclipbtn.php' => 1, | |
| 'jsonattributebehavior.php' => 1, | |
| 'flintlabsh5bpbundle.php' => 1, | |
| 'generatorasset.php' => 1, | |
| 'composer copy.json' => 1, | |
| 'xhubsignature.php' => 1, | |
| 'uspsratepackage.php' => 1, | |
| 'leapti18nbundle.php' => 1, | |
| 'leekgitdebugbundle.php' => 1, | |
| '.scrutinizer-ci.phpunit.xml.dist' => 1, | |
| 'phptutorialslib.php' => 1, | |
| 'lazy_vs_strict.php' => 1, | |
| 'services_openstreetmap-0.0.1.tgz' => 1, | |
| 'tpsutilbundle.php' => 1, | |
| 'tpspaypalbundle.php' => 1, | |
| 'dndfileuploadbundle.php' => 1, | |
| 'errorvalidationpicker.php' => 1, | |
| 'leaptimbundle.php' => 1, | |
| 'leaptelasticabundle.php' => 1, | |
| 'jqueryajaxbundle.php' => 1, | |
| 'leaptcorebundle.php' => 1, | |
| 'leaptcachebundle.php' => 1, | |
| 'leaptbootstrapbundle.php' => 1, | |
| 'leaptadminbundle.php' => 1, | |
| 'taggablequerybehavior.php' => 1, | |
| 'csp-report.php' => 1, | |
| 'php_cs' => 1, | |
| 'brench.php' => 1, | |
| 'plug.php' => 1, | |
| 'classicmodels.dump' => 1, | |
| 'sagittarius.zip' => 1, | |
| 'ziparchivefilesystem.php' => 1, | |
| 'uspsxmlparser.php' => 1, | |
| 'dump_r.php' => 1, | |
| 'mysqldatetimebehavior.php' => 1, | |
| 'crisistextlineuserprofilebundle.php' => 1, | |
| 'beaver.php' => 1, | |
| 'readme.ko' => 1, | |
| 'imgtext.php' => 1, | |
| 'ooapc.php' => 1, | |
| 'imagetest.php' => 1, | |
| 'phprandom.php' => 1, | |
| 'pinboard-api.php' => 1, | |
| 'ary.php' => 1, | |
| 'arytest.php' => 1, | |
| 'rackspacefilesystem.php' => 1, | |
| 'nodetype_piwik.png' => 1, | |
| 'qiniufilesystem.php' => 1, | |
| 'nullfilesystem.php' => 1, | |
| 'localfilesystem.php' => 1, | |
| 'leapscache.php' => 1, | |
| 'gridfsfilesystem.php' => 1, | |
| 'ftpfilesystem.php' => 1, | |
| 'dropboxfilesystem.php' => 1, | |
| 'relatedbehavior.php' => 1, | |
| 'copyfilesystem.php' => 1, | |
| 'azurefilesystem.php' => 1, | |
| 'multilanguageserviceprovider.php' => 1, | |
| 'module_piwik.png' => 1, | |
| 'potx.admin.inc' => 1, | |
| 'eyecare' => 1, | |
| 'potx.drush.inc' => 1, | |
| 'potx.inc' => 1, | |
| 'potx.info.yml' => 1, | |
| 'potx.local.inc' => 1, | |
| 'potx.module' => 1, | |
| 'kgpagerbundle.php' => 1, | |
| 'kgweinrebundle.php' => 1, | |
| 'divlooperinboxbundle.php' => 1, | |
| 'cashnpay.php' => 1, | |
| 'cashnpaygatewayfactory.php' => 1, | |
| 'interactiveconsolebundle.php' => 1, | |
| 'nodetype_calendar_list.png' => 1, | |
| 'khepindrupaltransliteratorbundle.php' => 1, | |
| 'transliterator.php' => 1, | |
| 'khepinyamlfixturesbundle.php' => 1, | |
| 'runkit.php' => 1, | |
| 'khergeuuidbundle.php' => 1, | |
| 'redsysapi.php' => 1, | |
| 'redsyswdg.php' => 1, | |
| 'wp-vc-template-manager.php' => 1, | |
| 'webdavfilesystem.php' => 1, | |
| 'module_calendar.png' => 1, | |
| 'sftpfilesystem.php' => 1, | |
| 'route66.php' => 1, | |
| 'font_delete.png' => 1, | |
| 'aliossfilesystem.php' => 1, | |
| 'llssqsbundle.php' => 1, | |
| 'zenstruckobjectroutingbundle.php' => 1, | |
| 'zenstruckresourcebundle.php' => 1, | |
| 'multicraftapi.php' => 1, | |
| 'imperaviassets.php' => 1, | |
| 'fileapiadvanced.php' => 1, | |
| 'fileapi.php' => 1, | |
| 'barcodevalidator.php' => 1, | |
| 'barcodechecksum.php' => 1, | |
| 'barcodeasset.php' => 1, | |
| 'barcodeabstracttype.php' => 1, | |
| 'llsmonologextrabundle.php' => 1, | |
| 'zenstruckmobilebundle.php' => 1, | |
| 'llsdynamodbbundle.php' => 1, | |
| 'zenstruckslugifybundle.php' => 1, | |
| 'llsawsbundle.php' => 1, | |
| 'l3yincubatorsearchbundle.php' => 1, | |
| 'zenstruckversionbundle.php' => 1, | |
| 'webhookbundle.php' => 1, | |
| 'kdconsolealiasbundle.php' => 1, | |
| 'cronworker.php' => 1, | |
| 'webcroncontroller.php' => 1, | |
| 'webcronserviceprovider.php' => 1, | |
| 'routecontext.php' => 1, | |
| 'zenstruckmigrationsbundle.php' => 1, | |
| 'dotenvfillerserviceprovider.php' => 1, | |
| 'leohtajaxsearchbundle.php' => 1, | |
| 'gelfconfig.php' => 1, | |
| 'beanstalklr.php' => 1, | |
| 'opcoes.php' => 1, | |
| 'metodos.php' => 1, | |
| 'manutencao.php' => 1, | |
| 'historia' => 1, | |
| 'gera.php' => 1, | |
| 'creditos.php' => 1, | |
| 'classgenerator_2013-02-25.sql' => 1, | |
| 'zippy.inc.php' => 1, | |
| 'zenstruckdashboardbundle.php' => 1, | |
| 'zenstruckmediabundle.php' => 1, | |
| 'paginatedgrid.php' => 1, | |
| 'leogoutpaginatorbundle.php' => 1, | |
| 'zenstruckdatagridbundle.php' => 1, | |
| 'leogoutgallerybundle.php' => 1, | |
| 'leogoutbasebundle.php' => 1, | |
| 'unit.xml' => 1, | |
| 'integration.xml' => 1, | |
| 'bb.jpg' => 1, | |
| 'zenstruckformbundle.php' => 1, | |
| 'zenstruckimagineextrabundle.php' => 1, | |
| 'botdetectorinterface.php' => 1, | |
| 'dotenvfillercommand.php' => 1, | |
| 'encryptable.php' => 1, | |
| 'daterange.php' => 1, | |
| 'make_currencies.php' => 1, | |
| 'todayrange.php' => 1, | |
| 'statisticsproviderinterface.php' => 1, | |
| 'statisticsprovidercollection.php' => 1, | |
| 'logo2-96.png' => 1, | |
| 'statisticshelper.php' => 1, | |
| 'rangehelper.php' => 1, | |
| 'providershelper.php' => 1, | |
| 'monthrange.php' => 1, | |
| 'logo2.png' => 1, | |
| 'keesscheperspostcodenlapibundle.php' => 1, | |
| 'octoberplugintestcase.php' => 1, | |
| 'logo2-48.png' => 1, | |
| 'sipdoctrineextensionsbundle.php' => 1, | |
| 'kejwmenwhoopsbundle.php' => 1, | |
| 'kinwaebootstrapbundle.php' => 1, | |
| 'kinwaeuserbundle.php' => 1, | |
| 'lastyearrange.php' => 1, | |
| 'lastweekrange.php' => 1, | |
| 'lastmonthrange.php' => 1, | |
| 'kndradbundle.php' => 1, | |
| 'kjpaymentstripebundle.php' => 1, | |
| 'dayrange.php' => 1, | |
| 'logo2-64.png' => 1, | |
| 'logo2-32.png' => 1, | |
| 'guidable.php' => 1, | |
| 'logo-48.png' => 1, | |
| 'slugabble.php' => 1, | |
| 'permissionsserviceprovider.php' => 1, | |
| 'protecttrait.php' => 1, | |
| 'polishvalidatorrulesserviceprovider.php' => 1, | |
| 'keboolagoogleclientbundle.php' => 1, | |
| 'syrupcomponentbundle.php' => 1, | |
| 'changelog-id' => 1, | |
| 'logo-128.png' => 1, | |
| 'logo-256.png' => 1, | |
| 'logo-32.png' => 1, | |
| 'logo-64.png' => 1, | |
| 'weekrange.php' => 1, | |
| 'logo-96.png' => 1, | |
| 'logo2-128.png' => 1, | |
| 'logo2-256.png' => 1, | |
| 'lmlphp_logo_200.png' => 1, | |
| 'lml.php' => 1, | |
| 'lml.min.php' => 1, | |
| 4 => 1, | |
| 2 => 1, | |
| 'er_formatters.info.yml' => 1, | |
| 'yesterdayrange.php' => 1, | |
| 'yearrange.php' => 1, | |
| 'awss3filesystem.php' => 1, | |
| 'dialogpluginasset.php' => 1, | |
| 'junosspace.php' => 1, | |
| 'miniquery.php' => 1, | |
| 'kitpagesutilbundle.php' => 1, | |
| 'divisions_zh_cn.php' => 1, | |
| 'divisions_extra_zh_cn.php' => 1, | |
| 'worldquery.php' => 1, | |
| 'taobaoquery.php' => 1, | |
| 'sinaquery.php' => 1, | |
| 'kitpagesworkflowbundle.php' => 1, | |
| 'qqwryquery.php' => 1, | |
| 'kitpagesworkflowevents.php' => 1, | |
| 'monipdbquery.php' => 1, | |
| 'fullquery.php' => 1, | |
| 'guess_college.php' => 1, | |
| 'freeipipquery.php' => 1, | |
| 'filequery.php' => 1, | |
| 'databasequery.php' => 1, | |
| 'chinaquery.php' => 1, | |
| 'baidumapquery.php' => 1, | |
| 'kixstaticpagesbundle.php' => 1, | |
| 'liquidmetal.php' => 1, | |
| 'ipv4.yaml' => 1, | |
| 'ipv4' => 1, | |
| 'kjdatranslationbundle.php' => 1, | |
| 'guess_china.php' => 1, | |
| 'guess_world.php' => 1, | |
| 'light.php' => 1, | |
| 'lassomailparserbundle.php' => 1, | |
| 'kitpagesshopevents.php' => 1, | |
| 'lassomultilogbundle.php' => 1, | |
| 'jsonlogobject.php' => 1, | |
| 'partfactory.php' => 1, | |
| 'parsedmail.php' => 1, | |
| 'kitpagesshopcmsbundle.php' => 1, | |
| 'kitpagessimplecachebundle.php' => 1, | |
| 'kitpagessimpleedmbundle.php' => 1, | |
| 'kitpagessimpleedmevents.php' => 1, | |
| 'parsehelper.php' => 1, | |
| 'simpleedmexception.php' => 1, | |
| 'kitpagesusergeneratedevents.php' => 1, | |
| 'kitpagesstepbundle.php' => 1, | |
| 'registration' => 1, | |
| 'kitpagesstepevents.php' => 1, | |
| 'readme-regular-admin-forms' => 1, | |
| 'readme-lookup-tables' => 1, | |
| 'attila_tutoriel.docx' => 1, | |
| 'apollina_tutoriel.docx' => 1, | |
| 'stepexception.php' => 1, | |
| 'kitpagesusergeneratedbundle.php' => 1, | |
| 'moves.php' => 1, | |
| '说昞' => 1, | |
| 'kkuetnetprestashopwebservicebundle.php' => 1, | |
| 'xpresion.png' => 1, | |
| 'kitpagesshopbundle.php' => 1, | |
| 'configuration.json' => 1, | |
| 'facebookextensiontrait.php' => 1, | |
| 'klesksliderbundle.php' => 1, | |
| 'headerparser.php' => 1, | |
| 'fgchttpclient.php' => 1, | |
| 'proxylib.php' => 1, | |
| 'neo4jclientbundle.php' => 1, | |
| 'jsonldresponse.php' => 1, | |
| 'hydrabundle.php' => 1, | |
| 'kickstart.sh' => 1, | |
| 'hydraapi.php' => 1, | |
| 'gitsynchronizer.php' => 1, | |
| 'lara' => 1, | |
| 'swoole_doc.php' => 1, | |
| 'nginx.tmpl' => 1, | |
| 'laravelserviceprovider.php' => 1, | |
| 'landingilogglybundle.php' => 1, | |
| 'framework.sql' => 1, | |
| 'adsb_raw.dat' => 1, | |
| 'lamosty-blog-helper.php' => 1, | |
| 'bedrock-plugin-control.php' => 1, | |
| 'markupbuilder.php' => 1, | |
| 'junosnetconf.php' => 1, | |
| 'facebookextensioninterface.php' => 1, | |
| 'composer.json.stub' => 1, | |
| 'lagdoctrinerepositorybundle.php' => 1, | |
| 'envoy' => 1, | |
| 'lagadminbundle.php' => 1, | |
| 'mongodbauthadapter.php' => 1, | |
| 'facebookauthenticationbundle.php' => 1, | |
| 'img.png' => 1, | |
| 'lissandra.png' => 1, | |
| 'ekko.jpg' => 1, | |
| 'example.gif' => 1, | |
| 'flare' => 1, | |
| 'facebookloginurlredirectresponse.php' => 1, | |
| 'lumen' => 1, | |
| 'facebookadapter.php' => 1, | |
| 'laraedit-v0.0.1.png' => 1, | |
| 'facebookadapteraware.php' => 1, | |
| 'lj-blog.php' => 1, | |
| 'trans_lang_lines.json' => 1, | |
| 'trans_comments.json' => 1, | |
| 'bladed.wiki' => 1, | |
| 'facebookadapterawareinterface.php' => 1, | |
| 'laravelcn' => 1, | |
| 'facebookadapterawaretrait.php' => 1, | |
| 'ordinationtrait.php' => 1, | |
| 'ordinationserviceprovider.php' => 1, | |
| 'laraedit-v0.0.2.png' => 1, | |
| 'multilogfactory.php' => 1, | |
| 'onlymessageformatter.php' => 1, | |
| 'fileobject.php' => 1, | |
| 'arraydiffhtml.php' => 1, | |
| 'wizard2.php' => 1, | |
| 'kimai.json' => 1, | |
| 'vinsearch.php' => 1, | |
| 'vehicles.php' => 1, | |
| 'vehicle.php' => 1, | |
| 'unit.php' => 1, | |
| 'unifilter.php' => 1, | |
| 'thanatosdigitaloceanbundle.php' => 1, | |
| 'nemesis.php' => 1, | |
| 'forker' => 1, | |
| 'readme-tests' => 1, | |
| 'wizardsearch.php' => 1, | |
| 'qgroups.php' => 1, | |
| 'qdetails.php' => 1, | |
| 'prag.php' => 1, | |
| 'localization_ru.php' => 1, | |
| 'localization_en.php' => 1, | |
| 'codecov' => 1, | |
| 'dependency.yml' => 1, | |
| 'framesearch.php' => 1, | |
| 'detailfilter.php' => 1, | |
| 'km.pm' => 1, | |
| 'wizard2bystep.php' => 1, | |
| 'wizardsearch2.php' => 1, | |
| 'applicability.php' => 1, | |
| 'ldaptoolsbundle.php' => 1, | |
| 'supercachebundle.php' => 1, | |
| 'h4md1jsqueezebundle.php' => 1, | |
| 'leaphlycartbundle.php' => 1, | |
| '.realsync' => 1, | |
| 'treegridasset.php' => 1, | |
| 'treegrid.php' => 1, | |
| 'treecolumn.php' => 1, | |
| 'phpunit.xml.dist | |
| ' => 1, | |
| 'lepharemenubundle.php' => 1, | |
| 'lephareadmingeneratorbundle.php' => 1, | |
| 'killerwolfjcdecauxcyclocitybundle.php' => 1, | |
| 'procfile_dev' => 1, | |
| 'server-livereload.php' => 1, | |
| 'server-livereload.js' => 1, | |
| 'composer.jso' => 1, | |
| 'gatekeeperpropelbundle.php' => 1, | |
| 'lazyantsworkflowbundle.php' => 1, | |
| 'lazyantstoolkitbundle.php' => 1, | |
| 'lazyantsdynatreebundle.php' => 1, | |
| 'test-module-guestbook.yml' => 1, | |
| 'module-guestbook.yml' => 1, | |
| 'cody' => 1, | |
| 'code.yml' => 1, | |
| 'catalogs.php' => 1, | |
| 'am_searchpanel.php' => 1, | |
| 'clientfactory.php' => 1, | |
| 'kitpagesdatagridbundle.php' => 1, | |
| 'mu.php' => 1, | |
| 'ev.php' => 1, | |
| 'mess.php' => 1, | |
| '.gitignore_global' => 1, | |
| 'mailboxmanager.php' => 1, | |
| 'kitpageschainevents.php' => 1, | |
| 'kitpagescommonstepbundle.php' => 1, | |
| 'lassovmailbundle.php' => 1, | |
| 'kitpagescompanybundle.php' => 1, | |
| 'kitpagescompanyevents.php' => 1, | |
| 'aliasmanager.php' => 1, | |
| 'chainexception.php' => 1, | |
| 'kitpagesdatagridevents.php' => 1, | |
| 'tokenfactory.php' => 1, | |
| 'lassooauth2clientbundle.php' => 1, | |
| 'kitpagesfilebundle.php' => 1, | |
| 'kitpagesfileevents.php' => 1, | |
| 'kitpagesfilesystembundle.php' => 1, | |
| 'kitpagesfilesystemevents.php' => 1, | |
| 'kitpagesmobileappbuilderbundle.php' => 1, | |
| 'kitpagespdfbundle.php' => 1, | |
| 'kitpagesredirectbundle.php' => 1, | |
| 'kitpagessemaphorebundle.php' => 1, | |
| 'kitpageschainbundle.php' => 1, | |
| 'kitpagescachecontrolbundle.php' => 1, | |
| 'am_manufacturerinfo.php' => 1, | |
| 'crunz' => 1, | |
| 'am_listmanufacturer.php' => 1, | |
| 'am_findoem.php' => 1, | |
| 'am_finddetail.php' => 1, | |
| 'aftermarket.php' => 1, | |
| 'lavoiesljquerybundle.php' => 1, | |
| 'jquery.resetform.js' => 1, | |
| 'polyfill.php' => 1, | |
| 'jquery.autocollapser.min.js' => 1, | |
| 'jquery.autocollapser.js' => 1, | |
| 'sked' => 1, | |
| 'endroidqrcodebundle.php' => 1, | |
| 'kitpagesactivityevents.php' => 1, | |
| 'lopipusherbundle.php' => 1, | |
| 'latyshababundle.php' => 1, | |
| 'example.zip' => 1, | |
| 'murmurhash3.php' => 1, | |
| 'km.php' => 1, | |
| 'km.py' => 1, | |
| 'km.rb' => 1, | |
| 'webuipopover.php' => 1, | |
| 'webuipopoverasset.php' => 1, | |
| 'activityexception.php' => 1, | |
| 'kitpagesactivitybundle.php' => 1, | |
| '2.2.0.1.kdev4' => 1, | |
| 'xhtml_valid.png' => 1, | |
| 'moipbundle.php' => 1, | |
| 'page_white_coldfusion.png' => 1, | |
| 'drive_edit.png' => 1, | |
| 'drive_error.png' => 1, | |
| 'page_white_cup.png' => 1, | |
| 'drive_go.png' => 1, | |
| 'page_white_csharp.png' => 1, | |
| 'page_white_cplusplus.png' => 1, | |
| 'page_white_copy.png' => 1, | |
| 'drive_key.png' => 1, | |
| 'page_white_compressed.png' => 1, | |
| 'drive_link.png' => 1, | |
| 'page_white_code_red.png' => 1, | |
| 'page_white_delete.png' => 1, | |
| 'drive_magnify.png' => 1, | |
| 'drive_network.png' => 1, | |
| 'drive_rename.png' => 1, | |
| 'drive_user.png' => 1, | |
| 'page_white_code.png' => 1, | |
| 'drive_web.png' => 1, | |
| 'dvd.png' => 1, | |
| 'page_white_cd.png' => 1, | |
| 'page_white_camera.png' => 1, | |
| 'page_white_c.png' => 1, | |
| 'page_white_database.png' => 1, | |
| 'drive_disk.png' => 1, | |
| 'page_white_actionscript.png' => 1, | |
| 'page_white_horizontal.png' => 1, | |
| 'drink_empty.png' => 1, | |
| 'page_white_medal.png' => 1, | |
| 'drive.png' => 1, | |
| 'drive_add.png' => 1, | |
| 'page_white_magnify.png' => 1, | |
| 'page_white_link.png' => 1, | |
| 'drive_burn.png' => 1, | |
| 'page_white_lightning.png' => 1, | |
| 'drive_cd.png' => 1, | |
| 'page_white_key.png' => 1, | |
| 'page_white_h.png' => 1, | |
| 'drive_delete.png' => 1, | |
| 'page_white_go.png' => 1, | |
| 'page_white_get.png' => 1, | |
| 'page_white_gear.png' => 1, | |
| 'page_white_freehand.png' => 1, | |
| 'page_white_flash.png' => 1, | |
| 'page_white_find.png' => 1, | |
| 'page_white_excel.png' => 1, | |
| 'page_white_error.png' => 1, | |
| 'page_white_edit.png' => 1, | |
| 'drive_cd_empty.png' => 1, | |
| 'page_white_dvd.png' => 1, | |
| 'page_white_add.png' => 1, | |
| 'page_white_acrobat.png' => 1, | |
| 'page_white_office.png' => 1, | |
| 'overlays.png' => 1, | |
| 'page_attach.png' => 1, | |
| 'page_add.png' => 1, | |
| 'page.png' => 1, | |
| 'package_link.png' => 1, | |
| 'package_green.png' => 1, | |
| 'package_go.png' => 1, | |
| 'package_delete.png' => 1, | |
| 'package_add.png' => 1, | |
| 'email_delete.png' => 1, | |
| 'email_edit.png' => 1, | |
| 'email_error.png' => 1, | |
| 'page_copy.png' => 1, | |
| 'email_go.png' => 1, | |
| 'note_go.png' => 1, | |
| 'email_link.png' => 1, | |
| 'email_open.png' => 1, | |
| 'note_error.png' => 1, | |
| 'note_edit.png' => 1, | |
| 'note_delete.png' => 1, | |
| 'email_open_image.png' => 1, | |
| 'emoticon_evilgrin.png' => 1, | |
| 'note_add.png' => 1, | |
| 'page_code.png' => 1, | |
| 'page_delete.png' => 1, | |
| 'page_white.png' => 1, | |
| 'page_key.png' => 1, | |
| 'page_save.png' => 1, | |
| 'page_refresh.png' => 1, | |
| 'page_red.png' => 1, | |
| 'page_paste.png' => 1, | |
| 'dvd_add.png' => 1, | |
| 'page_paintbrush.png' => 1, | |
| 'dvd_delete.png' => 1, | |
| 'page_link.png' => 1, | |
| 'dvd_edit.png' => 1, | |
| 'page_lightning.png' => 1, | |
| 'page_green.png' => 1, | |
| 'page_error.png' => 1, | |
| 'dvd_error.png' => 1, | |
| 'dvd_go.png' => 1, | |
| 'dvd_key.png' => 1, | |
| 'dvd_link.png' => 1, | |
| 'page_go.png' => 1, | |
| 'email.png' => 1, | |
| 'page_gear.png' => 1, | |
| 'email_add.png' => 1, | |
| 'email_attach.png' => 1, | |
| 'page_find.png' => 1, | |
| 'page_excel.png' => 1, | |
| 'drink.png' => 1, | |
| 'page_white_paint.png' => 1, | |
| 'emoticon_happy.png' => 1, | |
| 'database_gear.png' => 1, | |
| 'picture_save.png' => 1, | |
| 'picture_link.png' => 1, | |
| 'picture_key.png' => 1, | |
| 'database_error.png' => 1, | |
| 'picture_go.png' => 1, | |
| 'picture_error.png' => 1, | |
| 'picture_empty.png' => 1, | |
| 'picture_edit.png' => 1, | |
| 'picture_delete.png' => 1, | |
| 'picture_add.png' => 1, | |
| 'database_go.png' => 1, | |
| 'pilcrow.png' => 1, | |
| 'database_key.png' => 1, | |
| 'database_lightning.png' => 1, | |
| 'photos.png' => 1, | |
| 'photo_link.png' => 1, | |
| 'photo_delete.png' => 1, | |
| 'database_link.png' => 1, | |
| 'photo_add.png' => 1, | |
| 'photo.png' => 1, | |
| 'phone_sound.png' => 1, | |
| 'database_refresh.png' => 1, | |
| 'pictures.png' => 1, | |
| 'pill.png' => 1, | |
| 'database_table.png' => 1, | |
| 'cut_red.png' => 1, | |
| 'cup_go.png' => 1, | |
| 'printer_empty.png' => 1, | |
| 'printer_delete.png' => 1, | |
| 'printer_add.png' => 1, | |
| 'cup_key.png' => 1, | |
| 'printer.png' => 1, | |
| 'plugin_link.png' => 1, | |
| 'cup_link.png' => 1, | |
| 'cursor.png' => 1, | |
| 'cut.png' => 1, | |
| 'plugin_go.png' => 1, | |
| 'pill_add.png' => 1, | |
| 'plugin_error.png' => 1, | |
| 'database_add.png' => 1, | |
| 'plugin_edit.png' => 1, | |
| 'plugin_disabled.png' => 1, | |
| 'plugin_delete.png' => 1, | |
| 'database_connect.png' => 1, | |
| 'plugin_add.png' => 1, | |
| 'database_delete.png' => 1, | |
| 'pill_go.png' => 1, | |
| 'pill_delete.png' => 1, | |
| 'database_edit.png' => 1, | |
| 'database_save.png' => 1, | |
| 'date.png' => 1, | |
| 'page_white_paintbrush.png' => 1, | |
| 'page_white_text.png' => 1, | |
| 'page_white_word.png' => 1, | |
| 'page_white_width.png' => 1, | |
| 'page_white_visualstudio.png' => 1, | |
| 'disk.png' => 1, | |
| 'page_white_vector.png' => 1, | |
| 'page_white_tux.png' => 1, | |
| 'page_white_text_width.png' => 1, | |
| 'disk_multiple.png' => 1, | |
| 'door.png' => 1, | |
| 'door_in.png' => 1, | |
| 'page_white_swoosh.png' => 1, | |
| 'page_white_wrench.png' => 1, | |
| 'door_open.png' => 1, | |
| 'door_out.png' => 1, | |
| 'page_white_star.png' => 1, | |
| 'page_white_stack.png' => 1, | |
| 'page_white_ruby.png' => 1, | |
| 'page_white_put.png' => 1, | |
| 'page_white_powerpoint.png' => 1, | |
| 'page_white_picture.png' => 1, | |
| 'page_white_php.png' => 1, | |
| 'page_white_paste.png' => 1, | |
| 'page_white_world.png' => 1, | |
| 'disconnect.png' => 1, | |
| 'date_add.png' => 1, | |
| 'pencil_add.png' => 1, | |
| 'date_delete.png' => 1, | |
| 'date_edit.png' => 1, | |
| 'date_error.png' => 1, | |
| 'date_go.png' => 1, | |
| 'phone_delete.png' => 1, | |
| 'phone_add.png' => 1, | |
| 'phone.png' => 1, | |
| 'pencil_go.png' => 1, | |
| 'date_link.png' => 1, | |
| 'pencil_delete.png' => 1, | |
| 'date_magnify.png' => 1, | |
| 'delete.png' => 1, | |
| 'date_next.png' => 1, | |
| 'pencil.png' => 1, | |
| 'paste_word.png' => 1, | |
| 'paste_plain.png' => 1, | |
| 'palette.png' => 1, | |
| 'paintcan.png' => 1, | |
| 'paintbrush.png' => 1, | |
| 'page_world.png' => 1, | |
| 'page_word.png' => 1, | |
| 'page_white_zip.png' => 1, | |
| 'date_previous.png' => 1, | |
| 'emoticon_grin.png' => 1, | |
| 'note.png' => 1, | |
| 'printer_error.png' => 1, | |
| 'ipod_sound.png' => 1, | |
| 'key.png' => 1, | |
| 'flag_yellow.png' => 1, | |
| 'joystick_error.png' => 1, | |
| 'folder.png' => 1, | |
| 'folder_add.png' => 1, | |
| 'joystick_delete.png' => 1, | |
| 'joystick_add.png' => 1, | |
| 'folder_bell.png' => 1, | |
| 'folder_brick.png' => 1, | |
| 'joystick.png' => 1, | |
| 'folder_bug.png' => 1, | |
| 'key_delete.png' => 1, | |
| 'ipod_cast_delete.png' => 1, | |
| 'folder_camera.png' => 1, | |
| 'folder_database.png' => 1, | |
| 'folder_delete.png' => 1, | |
| 'folder_edit.png' => 1, | |
| 'folder_error.png' => 1, | |
| 'ipod_cast_add.png' => 1, | |
| 'ipod_cast.png' => 1, | |
| 'ipod.png' => 1, | |
| 'information.png' => 1, | |
| 'key_add.png' => 1, | |
| 'key_go.png' => 1, | |
| 'image_link.png' => 1, | |
| 'layout_edit.png' => 1, | |
| 'lightbulb_off.png' => 1, | |
| 'lightbulb_delete.png' => 1, | |
| 'lightbulb_add.png' => 1, | |
| 'lightbulb.png' => 1, | |
| 'flag_blue.png' => 1, | |
| 'flag_green.png' => 1, | |
| 'layout_sidebar.png' => 1, | |
| 'layout_link.png' => 1, | |
| 'layout_header.png' => 1, | |
| 'layout_error.png' => 1, | |
| 'flag_orange.png' => 1, | |
| 'flag_red.png' => 1, | |
| 'layout_delete.png' => 1, | |
| 'layout_content.png' => 1, | |
| 'layout_add.png' => 1, | |
| 'flag_pink.png' => 1, | |
| 'flag_purple.png' => 1, | |
| 'layout.png' => 1, | |
| 'layers.png' => 1, | |
| 'keyboard_magnify.png' => 1, | |
| 'keyboard_delete.png' => 1, | |
| 'keyboard_add.png' => 1, | |
| 'keyboard.png' => 1, | |
| 'images.png' => 1, | |
| 'folder_explore.png' => 1, | |
| 'lightning_add.png' => 1, | |
| 'folder_user.png' => 1, | |
| 'heart_delete.png' => 1, | |
| 'heart_add.png' => 1, | |
| 'heart.png' => 1, | |
| 'group_link.png' => 1, | |
| 'group_key.png' => 1, | |
| 'folder_page_white.png' => 1, | |
| 'folder_palette.png' => 1, | |
| 'folder_picture.png' => 1, | |
| 'folder_star.png' => 1, | |
| 'folder_table.png' => 1, | |
| 'folder_wrench.png' => 1, | |
| 'hourglass.png' => 1, | |
| 'font.png' => 1, | |
| 'group_go.png' => 1, | |
| 'group_gear.png' => 1, | |
| 'group_error.png' => 1, | |
| 'font_add.png' => 1, | |
| 'group_edit.png' => 1, | |
| 'group_delete.png' => 1, | |
| 'group_add.png' => 1, | |
| 'group.png' => 1, | |
| 'font_go.png' => 1, | |
| 'help.png' => 1, | |
| 'hourglass_add.png' => 1, | |
| 'image_edit.png' => 1, | |
| 'folder_image.png' => 1, | |
| 'image_delete.png' => 1, | |
| 'folder_feed.png' => 1, | |
| 'folder_find.png' => 1, | |
| 'image_add.png' => 1, | |
| 'image.png' => 1, | |
| 'html_valid.png' => 1, | |
| 'html_go.png' => 1, | |
| 'folder_go.png' => 1, | |
| 'html_delete.png' => 1, | |
| 'folder_heart.png' => 1, | |
| 'html_add.png' => 1, | |
| 'hourglass_delete.png' => 1, | |
| 'html.png' => 1, | |
| 'house_link.png' => 1, | |
| 'house_go.png' => 1, | |
| 'house.png' => 1, | |
| 'folder_key.png' => 1, | |
| 'folder_lightbulb.png' => 1, | |
| 'folder_link.png' => 1, | |
| 'hourglass_link.png' => 1, | |
| 'hourglass_go.png' => 1, | |
| 'folder_magnify.png' => 1, | |
| 'folder_page.png' => 1, | |
| 'lightning.png' => 1, | |
| 'lightning_delete.png' => 1, | |
| 'emoticon_smile.png' => 1, | |
| 'money_delete.png' => 1, | |
| 'monitor_edit.png' => 1, | |
| 'monitor_delete.png' => 1, | |
| 'monitor_add.png' => 1, | |
| 'monitor.png' => 1, | |
| 'money_yen.png' => 1, | |
| 'feed_delete.png' => 1, | |
| 'money_pound.png' => 1, | |
| 'feed_disk.png' => 1, | |
| 'money_euro.png' => 1, | |
| 'money_dollar.png' => 1, | |
| 'money_add.png' => 1, | |
| 'feed_add.png' => 1, | |
| 'money.png' => 1, | |
| 'medal_silver_delete.png' => 1, | |
| 'medal_silver_add.png' => 1, | |
| 'medal_silver_3.png' => 1, | |
| 'medal_silver_2.png' => 1, | |
| 'medal_silver_1.png' => 1, | |
| 'medal_gold_delete.png' => 1, | |
| 'feed_edit.png' => 1, | |
| 'feed_error.png' => 1, | |
| 'feed_go.png' => 1, | |
| 'monitor_error.png' => 1, | |
| 'feed.png' => 1, | |
| 'medal_gold_add.png' => 1, | |
| 'music.png' => 1, | |
| 'emoticon_surprised.png' => 1, | |
| 'newspaper_link.png' => 1, | |
| 'emoticon_tongue.png' => 1, | |
| 'newspaper_go.png' => 1, | |
| 'newspaper_delete.png' => 1, | |
| 'newspaper_add.png' => 1, | |
| 'emoticon_unhappy.png' => 1, | |
| 'newspaper.png' => 1, | |
| 'new.png' => 1, | |
| 'emoticon_waii.png' => 1, | |
| 'emoticon_wink.png' => 1, | |
| 'monitor_go.png' => 1, | |
| 'error_add.png' => 1, | |
| 'mouse_error.png' => 1, | |
| 'error_delete.png' => 1, | |
| 'mouse_delete.png' => 1, | |
| 'mouse_add.png' => 1, | |
| 'error_go.png' => 1, | |
| 'mouse.png' => 1, | |
| 'exclamation.png' => 1, | |
| 'monitor_link.png' => 1, | |
| 'eye.png' => 1, | |
| 'monitor_lightning.png' => 1, | |
| 'feed_key.png' => 1, | |
| 'medal_gold_3.png' => 1, | |
| 'find.png' => 1, | |
| 'lock_break.png' => 1, | |
| 'lorry_go.png' => 1, | |
| 'lorry_flatbed.png' => 1, | |
| 'lorry_error.png' => 1, | |
| 'lorry_delete.png' => 1, | |
| 'lorry_add.png' => 1, | |
| 'lorry.png' => 1, | |
| 'lock_open.png' => 1, | |
| 'lock_go.png' => 1, | |
| 'lock_edit.png' => 1, | |
| 'lock_delete.png' => 1, | |
| 'lock_add.png' => 1, | |
| 'magifier_zoom_out.png' => 1, | |
| 'film_link.png' => 1, | |
| 'link_go.png' => 1, | |
| 'link_error.png' => 1, | |
| 'link_edit.png' => 1, | |
| 'link_delete.png' => 1, | |
| 'link_break.png' => 1, | |
| 'link_add.png' => 1, | |
| 'link.png' => 1, | |
| 'lightning_go.png' => 1, | |
| 'film_save.png' => 1, | |
| 'lorry_link.png' => 1, | |
| 'magnifier.png' => 1, | |
| 'medal_gold_2.png' => 1, | |
| 'film_delete.png' => 1, | |
| 'medal_gold_1.png' => 1, | |
| 'feed_link.png' => 1, | |
| 'medal_bronze_delete.png' => 1, | |
| 'medal_bronze_add.png' => 1, | |
| 'medal_bronze_3.png' => 1, | |
| 'medal_bronze_2.png' => 1, | |
| 'feed_magnify.png' => 1, | |
| 'female.png' => 1, | |
| 'film.png' => 1, | |
| 'film_add.png' => 1, | |
| 'medal_bronze_1.png' => 1, | |
| 'magnifier_zoom_in.png' => 1, | |
| 'map_magnify.png' => 1, | |
| 'film_edit.png' => 1, | |
| 'map_go.png' => 1, | |
| 'map_edit.png' => 1, | |
| 'map_delete.png' => 1, | |
| 'map_add.png' => 1, | |
| 'film_error.png' => 1, | |
| 'map.png' => 1, | |
| 'film_go.png' => 1, | |
| 'male.png' => 1, | |
| 'film_key.png' => 1, | |
| 'cup_error.png' => 1, | |
| 'rainbow.png' => 1, | |
| 'xhtml_go.png' => 1, | |
| 'text_indent_remove.png' => 1, | |
| 'text_lowercase.png' => 1, | |
| 'chart_bar_link.png' => 1, | |
| 'text_list_numbers.png' => 1, | |
| 'chart_curve.png' => 1, | |
| 'text_list_bullets.png' => 1, | |
| 'text_linespacing.png' => 1, | |
| 'text_letterspacing.png' => 1, | |
| 'text_letter_omega.png' => 1, | |
| 'text_kerning.png' => 1, | |
| 'text_italic.png' => 1, | |
| 'chart_curve_add.png' => 1, | |
| 'chart_bar_error.png' => 1, | |
| 'text_indent.png' => 1, | |
| 'text_horizontalrule.png' => 1, | |
| 'text_heading_6.png' => 1, | |
| 'text_heading_5.png' => 1, | |
| 'text_heading_4.png' => 1, | |
| 'text_heading_3.png' => 1, | |
| 'text_heading_2.png' => 1, | |
| 'text_heading_1.png' => 1, | |
| 'text_dropcaps.png' => 1, | |
| 'text_columns.png' => 1, | |
| 'text_padding_bottom.png' => 1, | |
| 'chart_bar_edit.png' => 1, | |
| 'chart_curve_delete.png' => 1, | |
| 'cart_put.png' => 1, | |
| 'text_underline.png' => 1, | |
| 'text_superscript.png' => 1, | |
| 'cart_error.png' => 1, | |
| 'cart_go.png' => 1, | |
| 'text_subscript.png' => 1, | |
| 'text_strikethrough.png' => 1, | |
| 'text_smallcaps.png' => 1, | |
| 'text_signature.png' => 1, | |
| 'text_replace.png' => 1, | |
| 'text_padding_top.png' => 1, | |
| 'cart_remove.png' => 1, | |
| 'chart_bar_delete.png' => 1, | |
| 'cd.png' => 1, | |
| 'cd_add.png' => 1, | |
| 'cd_burn.png' => 1, | |
| 'cd_delete.png' => 1, | |
| 'cd_edit.png' => 1, | |
| 'cd_eject.png' => 1, | |
| 'cd_go.png' => 1, | |
| 'chart_bar.png' => 1, | |
| 'text_padding_right.png' => 1, | |
| 'chart_bar_add.png' => 1, | |
| 'text_padding_left.png' => 1, | |
| 'text_bold.png' => 1, | |
| 'chart_curve_edit.png' => 1, | |
| 'textfield.png' => 1, | |
| 'clock_add.png' => 1, | |
| 'chart_pie_add.png' => 1, | |
| 'chart_pie_delete.png' => 1, | |
| 'chart_pie_edit.png' => 1, | |
| 'chart_pie_error.png' => 1, | |
| 'telephone.png' => 1, | |
| 'chart_pie_link.png' => 1, | |
| 'clock.png' => 1, | |
| 'tag_yellow.png' => 1, | |
| 'tag_red.png' => 1, | |
| 'tag_purple.png' => 1, | |
| 'clock_delete.png' => 1, | |
| 'chart_organisation_delete.png' => 1, | |
| 'clock_edit.png' => 1, | |
| 'tag_pink.png' => 1, | |
| 'tag_orange.png' => 1, | |
| 'clock_error.png' => 1, | |
| 'clock_go.png' => 1, | |
| 'clock_link.png' => 1, | |
| 'clock_pause.png' => 1, | |
| 'clock_play.png' => 1, | |
| 'tag_green.png' => 1, | |
| 'clock_red.png' => 1, | |
| 'chart_pie.png' => 1, | |
| 'chart_organisation_add.png' => 1, | |
| 'text_allcaps.png' => 1, | |
| 'chart_line_delete.png' => 1, | |
| 'text_align_right.png' => 1, | |
| 'chart_curve_error.png' => 1, | |
| 'text_align_left.png' => 1, | |
| 'text_align_justify.png' => 1, | |
| 'text_align_center.png' => 1, | |
| 'chart_curve_go.png' => 1, | |
| 'chart_curve_link.png' => 1, | |
| 'television_delete.png' => 1, | |
| 'chart_line.png' => 1, | |
| 'chart_line_add.png' => 1, | |
| 'chart_line_edit.png' => 1, | |
| 'chart_organisation.png' => 1, | |
| 'television_add.png' => 1, | |
| 'chart_line_error.png' => 1, | |
| 'chart_line_link.png' => 1, | |
| 'television.png' => 1, | |
| 'telephone_link.png' => 1, | |
| 'telephone_key.png' => 1, | |
| 'telephone_go.png' => 1, | |
| 'telephone_error.png' => 1, | |
| 'telephone_edit.png' => 1, | |
| 'telephone_delete.png' => 1, | |
| 'telephone_add.png' => 1, | |
| 'text_uppercase.png' => 1, | |
| 'cart_edit.png' => 1, | |
| 'tag_blue_delete.png' => 1, | |
| 'calendar_edit.png' => 1, | |
| 'calculator_delete.png' => 1, | |
| 'calculator_edit.png' => 1, | |
| 'calculator_error.png' => 1, | |
| 'calculator_link.png' => 1, | |
| 'calendar_add.png' => 1, | |
| 'webcam_error.png' => 1, | |
| 'webcam_delete.png' => 1, | |
| 'webcam_add.png' => 1, | |
| 'calendar_delete.png' => 1, | |
| 'webcam.png' => 1, | |
| 'weather_sun.png' => 1, | |
| 'world.png' => 1, | |
| 'weather_snow.png' => 1, | |
| 'weather_rain.png' => 1, | |
| 'weather_lightning.png' => 1, | |
| 'weather_cloudy.png' => 1, | |
| 'weather_clouds.png' => 1, | |
| 'wand.png' => 1, | |
| 'vector_delete.png' => 1, | |
| 'vector_add.png' => 1, | |
| 'vector.png' => 1, | |
| 'vcard_edit.png' => 1, | |
| 'calculator_add.png' => 1, | |
| 'calculator.png' => 1, | |
| 'calendar_view_day.png' => 1, | |
| 'world_go.png' => 1, | |
| 'xhtml_delete.png' => 1, | |
| 'bullet_green.png' => 1, | |
| 'xhtml_add.png' => 1, | |
| 'bullet_key.png' => 1, | |
| 'bullet_orange.png' => 1, | |
| 'xhtml.png' => 1, | |
| 'bullet_picture.png' => 1, | |
| 'wrench_orange.png' => 1, | |
| 'wrench.png' => 1, | |
| 'world_link.png' => 1, | |
| 'bullet_pink.png' => 1, | |
| 'cake.png' => 1, | |
| 'bullet_purple.png' => 1, | |
| 'bullet_red.png' => 1, | |
| 'bullet_star.png' => 1, | |
| 'bullet_toggle_minus.png' => 1, | |
| 'bullet_toggle_plus.png' => 1, | |
| 'bullet_white.png' => 1, | |
| 'bullet_wrench.png' => 1, | |
| 'bullet_yellow.png' => 1, | |
| 'world_edit.png' => 1, | |
| 'world_delete.png' => 1, | |
| 'world_add.png' => 1, | |
| 'calendar_link.png' => 1, | |
| 'calendar_view_month.png' => 1, | |
| 'textfield_add.png' => 1, | |
| 'cart_add.png' => 1, | |
| 'camera_small.png' => 1, | |
| 'transmit_blue.png' => 1, | |
| 'cancel.png' => 1, | |
| 'car.png' => 1, | |
| 'transmit_add.png' => 1, | |
| 'transmit.png' => 1, | |
| 'car_add.png' => 1, | |
| 'car_delete.png' => 1, | |
| 'cart.png' => 1, | |
| 'timeline_marker.png' => 1, | |
| 'time_go.png' => 1, | |
| 'camera_go.png' => 1, | |
| 'time_delete.png' => 1, | |
| 'time_add.png' => 1, | |
| 'time.png' => 1, | |
| 'tick.png' => 1, | |
| 'thumb_up.png' => 1, | |
| 'thumb_down.png' => 1, | |
| 'textfield_rename.png' => 1, | |
| 'textfield_key.png' => 1, | |
| 'cart_delete.png' => 1, | |
| 'textfield_delete.png' => 1, | |
| 'camera_link.png' => 1, | |
| 'camera_error.png' => 1, | |
| 'calendar_view_week.png' => 1, | |
| 'user_go.png' => 1, | |
| 'camera.png' => 1, | |
| 'vcard_delete.png' => 1, | |
| 'camera_add.png' => 1, | |
| 'vcard_add.png' => 1, | |
| 'vcard.png' => 1, | |
| 'user_suit.png' => 1, | |
| 'user_red.png' => 1, | |
| 'user_orange.png' => 1, | |
| 'user_green.png' => 1, | |
| 'user_gray.png' => 1, | |
| 'user_female.png' => 1, | |
| 'transmit_delete.png' => 1, | |
| 'user_edit.png' => 1, | |
| 'user_delete.png' => 1, | |
| 'user_comment.png' => 1, | |
| 'camera_delete.png' => 1, | |
| 'user_add.png' => 1, | |
| 'camera_edit.png' => 1, | |
| 'user.png' => 1, | |
| 'tux.png' => 1, | |
| 'transmit_go.png' => 1, | |
| 'transmit_error.png' => 1, | |
| 'transmit_edit.png' => 1, | |
| 'tag_blue_edit.png' => 1, | |
| 'tag_blue_add.png' => 1, | |
| 'report.png' => 1, | |
| 'controller.png' => 1, | |
| 'control_stop_blue.png' => 1, | |
| 'shading.png' => 1, | |
| 'server_uncompressed.png' => 1, | |
| 'server_link.png' => 1, | |
| 'server_lightning.png' => 1, | |
| 'server_key.png' => 1, | |
| 'server_go.png' => 1, | |
| 'server_error.png' => 1, | |
| 'server_edit.png' => 1, | |
| 'server_delete.png' => 1, | |
| 'server_database.png' => 1, | |
| 'control_stop.png' => 1, | |
| 'server_connect.png' => 1, | |
| 'server_compressed.png' => 1, | |
| 'server_chart.png' => 1, | |
| 'server_add.png' => 1, | |
| 'controller_add.png' => 1, | |
| 'server.png' => 1, | |
| 'script_save.png' => 1, | |
| 'script_palette.png' => 1, | |
| 'script_link.png' => 1, | |
| 'script_lightning.png' => 1, | |
| 'shape_align_bottom.png' => 1, | |
| 'shape_align_center.png' => 1, | |
| 'controller_delete.png' => 1, | |
| 'shape_move_backwards.png' => 1, | |
| 'shape_square_edit.png' => 1, | |
| 'shape_square_delete.png' => 1, | |
| 'shape_square_add.png' => 1, | |
| 'shape_square.png' => 1, | |
| 'shape_rotate_clockwise.png' => 1, | |
| 'control_repeat.png' => 1, | |
| 'control_repeat_blue.png' => 1, | |
| 'shape_rotate_anticlockwise.png' => 1, | |
| 'shape_move_front.png' => 1, | |
| 'shape_move_forwards.png' => 1, | |
| 'shape_move_back.png' => 1, | |
| 'shape_align_left.png' => 1, | |
| 'control_rewind.png' => 1, | |
| 'control_rewind_blue.png' => 1, | |
| 'shape_handles.png' => 1, | |
| 'shape_group.png' => 1, | |
| 'shape_flip_vertical.png' => 1, | |
| 'control_start.png' => 1, | |
| 'shape_flip_horizontal.png' => 1, | |
| 'control_start_blue.png' => 1, | |
| 'shape_align_top.png' => 1, | |
| 'shape_align_right.png' => 1, | |
| 'shape_align_middle.png' => 1, | |
| 'script_key.png' => 1, | |
| 'script_go.png' => 1, | |
| 'shape_square_go.png' => 1, | |
| 'cup.png' => 1, | |
| 'rss_add.png' => 1, | |
| 'rss.png' => 1, | |
| 'rosette.png' => 1, | |
| 'resultset_previous.png' => 1, | |
| 'resultset_next.png' => 1, | |
| 'resultset_last.png' => 1, | |
| 'resultset_first.png' => 1, | |
| 'report_word.png' => 1, | |
| 'report_user.png' => 1, | |
| 'report_picture.png' => 1, | |
| 'report_magnify.png' => 1, | |
| 'rss_delete.png' => 1, | |
| 'cup_add.png' => 1, | |
| 'report_link.png' => 1, | |
| 'report_key.png' => 1, | |
| 'report_go.png' => 1, | |
| 'report_edit.png' => 1, | |
| 'report_disk.png' => 1, | |
| 'report_delete.png' => 1, | |
| 'cup_delete.png' => 1, | |
| 'report_add.png' => 1, | |
| 'cup_edit.png' => 1, | |
| 'css_valid.png' => 1, | |
| 'rss_go.png' => 1, | |
| 'controller_error.png' => 1, | |
| 'css_add.png' => 1, | |
| 'script_gear.png' => 1, | |
| 'creditcards.png' => 1, | |
| 'script_error.png' => 1, | |
| 'script_edit.png' => 1, | |
| 'cross.png' => 1, | |
| 'script_delete.png' => 1, | |
| 'css.png' => 1, | |
| 'script_code_red.png' => 1, | |
| 'script_code.png' => 1, | |
| 'script_add.png' => 1, | |
| 'script.png' => 1, | |
| 'rss_valid.png' => 1, | |
| 'ruby_put.png' => 1, | |
| 'ruby_link.png' => 1, | |
| 'ruby_key.png' => 1, | |
| 'ruby_go.png' => 1, | |
| 'css_delete.png' => 1, | |
| 'css_go.png' => 1, | |
| 'ruby_get.png' => 1, | |
| 'ruby_gear.png' => 1, | |
| 'ruby_delete.png' => 1, | |
| 'ruby_add.png' => 1, | |
| 'ruby.png' => 1, | |
| 'shape_square_error.png' => 1, | |
| 'shape_square_key.png' => 1, | |
| 'tag_blue.png' => 1, | |
| 'sum.png' => 1, | |
| 'color_swatch.png' => 1, | |
| 'table.png' => 1, | |
| 'tab_go.png' => 1, | |
| 'tab_edit.png' => 1, | |
| 'tab_delete.png' => 1, | |
| 'color_wheel.png' => 1, | |
| 'comment.png' => 1, | |
| 'comment_add.png' => 1, | |
| 'tab_add.png' => 1, | |
| 'tab.png' => 1, | |
| 'style_go.png' => 1, | |
| 'table_delete.png' => 1, | |
| 'style_edit.png' => 1, | |
| 'style_delete.png' => 1, | |
| 'style_add.png' => 1, | |
| 'style.png' => 1, | |
| 'stop.png' => 1, | |
| 'status_online.png' => 1, | |
| 'comment_delete.png' => 1, | |
| 'comment_edit.png' => 1, | |
| 'status_offline.png' => 1, | |
| 'status_busy.png' => 1, | |
| 'table_add.png' => 1, | |
| 'coins_delete.png' => 1, | |
| 'star.png' => 1, | |
| 'table_row_insert.png' => 1, | |
| 'tag.png' => 1, | |
| 'clock_stop.png' => 1, | |
| 'table_sort.png' => 1, | |
| 'cog.png' => 1, | |
| 'cog_add.png' => 1, | |
| 'cog_delete.png' => 1, | |
| 'cog_edit.png' => 1, | |
| 'cog_error.png' => 1, | |
| 'table_save.png' => 1, | |
| 'cog_go.png' => 1, | |
| 'table_row_delete.png' => 1, | |
| 'table_edit.png' => 1, | |
| 'table_relationship.png' => 1, | |
| 'table_refresh.png' => 1, | |
| 'table_multiple.png' => 1, | |
| 'table_link.png' => 1, | |
| 'coins.png' => 1, | |
| 'table_lightning.png' => 1, | |
| 'table_key.png' => 1, | |
| 'table_go.png' => 1, | |
| 'coins_add.png' => 1, | |
| 'table_gear.png' => 1, | |
| 'table_error.png' => 1, | |
| 'status_away.png' => 1, | |
| 'sport_tennis.png' => 1, | |
| 'shape_square_link.png' => 1, | |
| 'control_play.png' => 1, | |
| 'control_equalizer_blue.png' => 1, | |
| 'control_fastforward.png' => 1, | |
| 'control_fastforward_blue.png' => 1, | |
| 'sport_basketball.png' => 1, | |
| 'control_pause.png' => 1, | |
| 'sport_8ball.png' => 1, | |
| 'spellcheck.png' => 1, | |
| 'sound_none.png' => 1, | |
| 'sound_mute.png' => 1, | |
| 'control_pause_blue.png' => 1, | |
| 'sound_low.png' => 1, | |
| 'control_end_blue.png' => 1, | |
| 'sound_delete.png' => 1, | |
| 'sound_add.png' => 1, | |
| 'sound.png' => 1, | |
| 'sitemap_color.png' => 1, | |
| 'sitemap.png' => 1, | |
| 'control_play_blue.png' => 1, | |
| 'shield_go.png' => 1, | |
| 'shield_delete.png' => 1, | |
| 'shield_add.png' => 1, | |
| 'shield.png' => 1, | |
| 'shape_ungroup.png' => 1, | |
| 'control_equalizer.png' => 1, | |
| 'control_end.png' => 1, | |
| 'sport_soccer.png' => 1, | |
| 'computer_edit.png' => 1, | |
| 'comments.png' => 1, | |
| 'comments_add.png' => 1, | |
| 'sport_shuttlecock.png' => 1, | |
| 'comments_delete.png' => 1, | |
| 'sport_raquet.png' => 1, | |
| 'compress.png' => 1, | |
| 'sport_golf.png' => 1, | |
| 'computer.png' => 1, | |
| 'computer_add.png' => 1, | |
| 'computer_delete.png' => 1, | |
| 'computer_error.png' => 1, | |
| 'control_eject_blue.png' => 1, | |
| 'computer_go.png' => 1, | |
| 'computer_key.png' => 1, | |
| 'sport_football.png' => 1, | |
| 'computer_link.png' => 1, | |
| 'connect.png' => 1, | |
| 'contrast.png' => 1, | |
| 'contrast_decrease.png' => 1, | |
| 'contrast_high.png' => 1, | |
| 'contrast_increase.png' => 1, | |
| 'contrast_low.png' => 1, | |
| 'control_eject.png' => 1, | |
| 'gelfgl.php' => 1, | |
| 'tearrespectvalidationbundle.php' => 1, | |
| 'sync-install.sh' => 1, | |
| 'doc-parser' => 1, | |
| 'pdfmanager.php' => 1, | |
| 'ddpdfbundle.php' => 1, | |
| 'elementbuilder.php' => 1, | |
| 'phpclasseditor.php' => 1, | |
| 'phpirt.php' => 1, | |
| 'curl' => 1, | |
| 'tokenparser.php' => 1, | |
| 'dduserbundle.php' => 1, | |
| 'doc-parser.php' => 1, | |
| 'layoutmanager.php' => 1, | |
| 'tv' => 1, | |
| 'emadsystem.php' => 1, | |
| 'licence.bsd' => 1, | |
| 'divine.php' => 1, | |
| 'example-output.jpg' => 1, | |
| 'typoscript-lint' => 1, | |
| 'tslint.yml' => 1, | |
| 'tslint.dist.yml' => 1, | |
| 'go-pear.php' => 1, | |
| 'graphizer' => 1, | |
| '.graphpizer.json' => 1, | |
| 'scrclubcmsbundle.php' => 1, | |
| 'ddfiltertypeguesserbundle.php' => 1, | |
| 'do' => 1, | |
| 'idnmacros.php' => 1, | |
| 'edemyeventbundle.php' => 1, | |
| 'readme_l4' => 1, | |
| 'edemythemebundle.php' => 1, | |
| 'edemyproductbundle.php' => 1, | |
| 'edemymathbundle.php' => 1, | |
| 'cmb2-related-links.php' => 1, | |
| 'ju1iuswebpackassetsbundle.php' => 1, | |
| 'edemymainbundle.php' => 1, | |
| 'juanber84profilercommandbundle.php' => 1, | |
| 'edemylinkbundle.php' => 1, | |
| 'edemyfbbundle.php' => 1, | |
| 'edemydesignbundle.php' => 1, | |
| 'csstestmatrix.html' => 1, | |
| 'juanber84simplei18nbundle.php' => 1, | |
| 'edemycustomerbundle.php' => 1, | |
| 'monologplugin.php' => 1, | |
| 'edemycrawlerbundle.php' => 1, | |
| 'ddcdnbundle.php' => 1, | |
| 'edemycartbundle.php' => 1, | |
| 'edemycarruselbundle.php' => 1, | |
| 'edemybookingbundle.php' => 1, | |
| 'edemybackupbundle.php' => 1, | |
| 'edemybackgroundbundle.php' => 1, | |
| 'edemyagendabundle.php' => 1, | |
| 'debugwrapper.php' => 1, | |
| 'hoathisresourcelocatorbundle.php' => 1, | |
| 'edemywikibundle.php' => 1, | |
| 'class-tlc-transient-update-server.php' => 1, | |
| 'travis_config.ini' => 1, | |
| '.stickler.yml' => 1, | |
| 'markpavlitskiconstraintextrabundle.php' => 1, | |
| 'pluploadwidget.php' => 1, | |
| 'phpunit-teardown.php' => 1, | |
| 'phpunit-config.php' => 1, | |
| 'ensurecoverage.sh' => 1, | |
| 'mlphp-ghpages.ini' => 1, | |
| 'tlc-transients.php' => 1, | |
| 'class-tlc-transient.php' => 1, | |
| 'server_time.php' => 1, | |
| 'package.py' => 1, | |
| '_sync_types.php' => 1, | |
| 'testloop.sh' => 1, | |
| 'xxammailclientbundle.php' => 1, | |
| 'composerfuture.json' => 1, | |
| 'layoutfuture.php' => 1, | |
| 'breakfast.xml' => 1, | |
| 'imgbuilder.php' => 1, | |
| 'accounts-woocommerce-plugin.php' => 1, | |
| '__condorcetautoload.php' => 1, | |
| 'condorcet-logo.png' => 1, | |
| 'luminous' => 1, | |
| 'supported.php' => 1, | |
| 'catcha.php' => 1, | |
| 'initial_document' => 1, | |
| 'jucevejuflowchartbundle.php' => 1, | |
| 'tab.phtml' => 1, | |
| 'supportedmutations' => 1, | |
| 'jusimplesearchbundle.php' => 1, | |
| 'ieditable.php' => 1, | |
| 'babelfish.php' => 1, | |
| 'cmssettings.php' => 1, | |
| 'push-server.php' => 1, | |
| 'dokumentacja.html' => 1, | |
| 'pushconnection.php' => 1, | |
| 'marshmninkbundle.php' => 1, | |
| 'versioncheck.php' => 1, | |
| 'savegridpaginationbehavior.php' => 1, | |
| 'savegridfiltersbehavior.php' => 1, | |
| 'videothumb.php' => 1, | |
| 'marquesbehavior.php' => 1, | |
| 'jackalope.db' => 1, | |
| 'updgrade-2.0-dev' => 1, | |
| 'marmelabsonataelasticabundle.php' => 1, | |
| 'marmelabngadmingeneratorbundle.php' => 1, | |
| 'slim.php' => 1, | |
| 'wp-on-routes.php' => 1, | |
| 'awesomeheader.php' => 1, | |
| 'sample.log' => 1, | |
| 'dynamodbwrapper.php' => 1, | |
| 'mabaoauthcommerceproxybundle.php' => 1, | |
| 'asdadmbundle.php' => 1, | |
| 'teocorebundle.php' => 1, | |
| 'ginny.dist.yml' => 1, | |
| 'advemail.php' => 1, | |
| 'tordf-0111-in.jsonld' => 1, | |
| 'cjsdeliverybundle.php' => 1, | |
| 'cjsdelivery.php' => 1, | |
| 'itsdangerous.php' => 1, | |
| 'iptools.php' => 1, | |
| 'developer_detection.php' => 1, | |
| 'debugging.php' => 1, | |
| 'tordf-0111-out.nq' => 1, | |
| 'sluggenerator.php' => 1, | |
| 'categorieswidget.ss' => 1, | |
| 'categorieswidget.php' => 1, | |
| '.travis_redis.sh' => 1, | |
| 'xlproc.php' => 1, | |
| 'examples-config.json.template' => 1, | |
| 'php-makeup' => 1, | |
| 'php-make-up.php' => 1, | |
| 'gitspam.sh' => 1, | |
| 'tordf-0112-in.jsonld' => 1, | |
| 'tordf-0112-out.nq' => 1, | |
| 'teodb18nbundle.php' => 1, | |
| 'teoproductbundle.php' => 1, | |
| 'gitspam.php' => 1, | |
| 'cypresslesselephantbundle.php' => 1, | |
| 'magic_forms.info' => 1, | |
| 'tordf-0105-in.jsonld' => 1, | |
| 'tordf-0105-out.nq' => 1, | |
| 'tordf-0106-in.jsonld' => 1, | |
| 'examples.inc' => 1, | |
| 'gulpfile.coffee' => 1, | |
| 'cypressdidebuggerbundle.php' => 1, | |
| 'cypresspygmentselephantbundle.php' => 1, | |
| 'tordf-0106-out.nq' => 1, | |
| 'tordf-0107-in.jsonld' => 1, | |
| 'tordf-0107-out.nq' => 1, | |
| 'teoboilerplatebundle.php' => 1, | |
| 'tordf-0108-in.jsonld' => 1, | |
| 'cypressgitelephantbundle.php' => 1, | |
| 'cypresstreebundle.php' => 1, | |
| 'cypressfixturesbundle.php' => 1, | |
| 'tordf-0108-out.nq' => 1, | |
| 'tordf-0109-in.jsonld' => 1, | |
| 'tordf-0109-out.nq' => 1, | |
| 'tordf-0110-in.jsonld' => 1, | |
| 'tordf-0110-out.nq' => 1, | |
| 'cypressconsoledefaultsbundle.php' => 1, | |
| 'cypresscompasselephantbundle.php' => 1, | |
| 'tordf-0113-in.jsonld' => 1, | |
| 'behat.ci.yml' => 1, | |
| 'tordf-manifest.jsonld' => 1, | |
| 'tordf-0118-in.jsonld' => 1, | |
| 'crud.class.php' => 1, | |
| 'function.script.php' => 1, | |
| 'function.css.php' => 1, | |
| 'velikonjalabbybundle.php' => 1, | |
| 'nb-configuration.xml' => 1, | |
| 'mumscrum-db-bak-latest.sql' => 1, | |
| 'tordf-0117-in.jsonld' => 1, | |
| 'tordf-0117-out.nq' => 1, | |
| 'insur-leav-type.sql' => 1, | |
| '.springbeans' => 1, | |
| 'tordf-0118-out.nq' => 1, | |
| 'otbsbundle.php' => 1, | |
| 'tordf-0119-in.jsonld' => 1, | |
| 'massivesearchbundle.php' => 1, | |
| 'massivebuildbundle.php' => 1, | |
| 'epnumberstowordsbundle.php' => 1, | |
| 'massilmultiuserbundle.php' => 1, | |
| 'phptube.php' => 1, | |
| 'phpman.php' => 1, | |
| 'phpman.phar' => 1, | |
| 'tordf-0119-out.nq' => 1, | |
| 'asmmarkdowncontentbundle.php' => 1, | |
| 'routes.class.php' => 1, | |
| 'non-production-robots-ignore.php' => 1, | |
| 'customersupportbundle.php' => 1, | |
| 'customnavblocks.php' => 1, | |
| 'debug' => 1, | |
| 'axiolabbootstrapselectbundle.php' => 1, | |
| 'tordf-0113-out.nq' => 1, | |
| 'tordf-0114-in.jsonld' => 1, | |
| 'tordf-0114-out.nq' => 1, | |
| 'tordf-0115-in.jsonld' => 1, | |
| 'tordf-0115-out.nq' => 1, | |
| 'uml.class.violet' => 1, | |
| 'glue.class.violet.html' => 1, | |
| 'mathielenimportenginebundle.php' => 1, | |
| 'matheouserbundle.php' => 1, | |
| 'gorgcasbundle.php' => 1, | |
| 'migrant' => 1, | |
| 'docker.sh' => 1, | |
| 'gorguserbundle.php' => 1, | |
| 'gorgreplicationtriggerbundle.php' => 1, | |
| 'pdepend.xsl' => 1, | |
| 'cpd.xsl' => 1, | |
| 'gorgldapormbundle.php' => 1, | |
| 'tordf-0116-in.jsonld' => 1, | |
| 'gorgjirabundle.php' => 1, | |
| 'gorggramapiclientbundle.php' => 1, | |
| 'tordf-0116-out.nq' => 1, | |
| 'condorcet-logo.psd' => 1, | |
| 'mabaoauthcommerceencryptedcredentialsbundle.php' => 1, | |
| 'magic_forms.module' => 1, | |
| 'sync.ini.example' => 1, | |
| 'bootstrapnotifyalertasset.php' => 1, | |
| 'flashalert.php' => 1, | |
| 'mapadotwigextensionsbundle.php' => 1, | |
| 'taggingasset.php' => 1, | |
| 'taggingquery.php' => 1, | |
| 'taggingwidget.php' => 1, | |
| 'manyrussmsbundle.php' => 1, | |
| 'logomb.jpg' => 1, | |
| 'itplogo.png' => 1, | |
| 'flow' => 1, | |
| 'wssepassworddigestcreator.php' => 1, | |
| 'message-board.php' => 1, | |
| 'addons' => 1, | |
| 'options' => 1, | |
| 'wsseheadersfactory.php' => 1, | |
| 'wsseserverbundle.php' => 1, | |
| 'kusf2utilsbundle.php' => 1, | |
| 'date-picker-cs.js' => 1, | |
| 'ventasconfig.php' => 1, | |
| 'uploaddatabundle.php' => 1, | |
| 'configprovider.php' => 1, | |
| 'ssoserverbundle' => 1, | |
| 'mapadotypeaheadjsbundle.php' => 1, | |
| 'hybrid.php' => 1, | |
| 'kussoserverbundle.php' => 1, | |
| 'polylang-translate-rewrite-slugs.php' => 1, | |
| 'oxrun.phar' => 1, | |
| 'test_mysql.php' => 1, | |
| 'test_mysql_timeout.php' => 1, | |
| 'gizlabdoctrinebundle.php' => 1, | |
| 'readme.1.3.x' => 1, | |
| 'hooker.yml.dist' => 1, | |
| 'obhighchartsbundle.php' => 1, | |
| 'obcmsbundle.php' => 1, | |
| 'obcachenukebundle.php' => 1, | |
| 'oauth-server.php' => 1, | |
| 'readme.src' => 1, | |
| 'mockingjconsole' => 1, | |
| 'important' => 1, | |
| 'asanastrategy.php' => 1, | |
| 'documentation.pdf' => 1, | |
| 'consoler.php' => 1, | |
| 'mapbenderfeatureinfobundle.php' => 1, | |
| 'mapbenderdigitizerbundle.php' => 1, | |
| 'mapbendermaptoolbundle.php' => 1, | |
| 'vice.php' => 1, | |
| 'openuserbundle.php' => 1, | |
| 'mapbendergeotransporterbundle.php' => 1, | |
| 'mapbenderdatasourcebundle.php' => 1, | |
| 'ssoevents.php' => 1, | |
| 'kussoclientbundle.php' => 1, | |
| 'epilog' => 1, | |
| 'mb_str_replace_license' => 1, | |
| 'base-files.zip' => 1, | |
| 'jhomepermissionsbundle.php' => 1, | |
| 'supervisor.conf.example' => 1, | |
| 'htme.php' => 1, | |
| 'web_tester.sh' => 1, | |
| 'web_tester.json' => 1, | |
| 'datatext.php' => 1, | |
| 'emma_config.php' => 1, | |
| 'repositoryasaservicebundle.php' => 1, | |
| 'admin.crt' => 1, | |
| 'safety.png' => 1, | |
| 'jhvuserevents.php' => 1, | |
| 'fa' => 1, | |
| 'rest.sql' => 1, | |
| 'orm_validation.php' => 1, | |
| 'orm_table.php' => 1, | |
| 'orm_primary_key.php' => 1, | |
| 'orm_model.php' => 1, | |
| 'holiday_jp' => 1, | |
| 'imgin.php' => 1, | |
| 'orm_field.php' => 1, | |
| 'orm_association.php' => 1, | |
| 'mangatibasebundle.php' => 1, | |
| 'comingsoon' => 1, | |
| 'presupuestobundle.php' => 1, | |
| 'saveprice.php' => 1, | |
| 'manueltranslationbundle.php' => 1, | |
| 'manuelajaxflashbundle.php' => 1, | |
| 'kuajaxbundle.php' => 1, | |
| 'ajaxhandler.php' => 1, | |
| 'labobundle.php' => 1, | |
| 'labotestmanubundle.php' => 1, | |
| 'ajaxcontentmixed.html' => 1, | |
| 'uploadlink.php' => 1, | |
| 'date-picker.js' => 1, | |
| 'uploadfile.php' => 1, | |
| 'template.phtml' => 1, | |
| 'jhvuserbundle.php' => 1, | |
| 'jhveasyinheritancemappingbundle.php' => 1, | |
| 'parseryml.php' => 1, | |
| 'parserjson.php' => 1, | |
| 'parserexcel.php' => 1, | |
| 'parsefileinterface.php' => 1, | |
| 'jhvpaymentcorebundle.php' => 1, | |
| 'jhvpaymentplugincobrebembundle.php' => 1, | |
| 'jhvpaymentservicebundle.php' => 1, | |
| 'jhvseobundle.php' => 1, | |
| 'readme-old' => 1, | |
| 'manager.sql' => 1, | |
| 'settingsindbbundle.php' => 1, | |
| 'bootstrap-phar.php' => 1, | |
| 'atys.png' => 1, | |
| 'jumalepagemetabundle.php' => 1, | |
| 'marduke182twigbundle.php' => 1, | |
| 'marcwserversideanalyticsbundle.php' => 1, | |
| 'jumaleattachmentbundle.php' => 1, | |
| 'countries.aggregate.php' => 1, | |
| 'cccn.php' => 1, | |
| 'marcwwurstbundle.php' => 1, | |
| 'marcvsqldumpbundle.php' => 1, | |
| 'lerconfig.php' => 1, | |
| 'inutilizar.php' => 1, | |
| 'imprimircce.php' => 1, | |
| 'openidconnectclient.php' => 1, | |
| 'opaqueencoder.php' => 1, | |
| 'danfe.php' => 1, | |
| 'cancelar.php' => 1, | |
| 'nfefacade.php' => 1, | |
| 'ping.php' => 1, | |
| 'dmrbundle.php' => 1, | |
| 'marcoshoyaboletophpbundle.php' => 1, | |
| 'sphinxbundle.php' => 1, | |
| 'class.smushit.php' => 1, | |
| 'client_example.php' => 1, | |
| 'mlbdagbundle.php' => 1, | |
| 'kurzor_config.php.sample' => 1, | |
| 'opaque.py' => 1, | |
| 'jsonbehavior.php' => 1, | |
| 'latestblogs.php' => 1, | |
| 'simpleresize.php' => 1, | |
| 'tubular.php' => 1, | |
| 'tubularasset.php' => 1, | |
| 'mabaoauthcommercecommonbundle.php' => 1, | |
| 'wake.php' => 1, | |
| 'animate.php' => 1, | |
| '702.gif' => 1, | |
| 'review.php' => 1, | |
| 'latestblogs.ss' => 1, | |
| 'buzzbundle.php' => 1, | |
| 'blogeventdates.php' => 1, | |
| 'jumaleadminbundle.php' => 1, | |
| 'blogarchivemenuwidget.ss' => 1, | |
| 'buzzprofilerbundle.php' => 1, | |
| 'blogarchivemenuwidget.php' => 1, | |
| 'my_opml_file.xml' => 1, | |
| 'simpleitclaireexercisebundle.php' => 1, | |
| 'gearman.php' => 1, | |
| 'embedded.php' => 1, | |
| 'jdformbundle.php' => 1, | |
| 'butterweedsf1embedderbundle.php' => 1, | |
| 'fastrelibravatarbundle.php' => 1, | |
| 'testvectors' => 1, | |
| 'attributebehavior.php' => 1, | |
| 'dbad.license' => 1, | |
| '__functions.php' => 1, | |
| 'payments.php' => 1, | |
| 'xeditableasset.php' => 1, | |
| 'chartpluginasset.php' => 1, | |
| 'xeditableaction.php' => 1, | |
| 'xeditable.php' => 1, | |
| 'test_dns_strings.php' => 1, | |
| 'wysihtml5asset.php' => 1, | |
| 'typeaheadnewasset.php' => 1, | |
| 'combodateasset.php' => 1, | |
| 'yii2_readme' => 1, | |
| 'yii2_license' => 1, | |
| 'menu.sql' => 1, | |
| 'all_tests.html' => 1, | |
| 'nestedsortableaction.php' => 1, | |
| 'tks.php' => 1, | |
| 'sample_config.php' => 1, | |
| 'jsonfcts.php' => 1, | |
| 'bd_field.php' => 1, | |
| 'auto-bd-class.php' => 1, | |
| '540.php' => 1, | |
| 'yay_pretty.php' => 1, | |
| 'yay_parse.php' => 1, | |
| 'yay_compile.php' => 1, | |
| 'alltests.js' => 1, | |
| 'xeditablechecklist.php' => 1, | |
| 'wp_serve_file.php' => 1, | |
| 'configglobal.php' => 1, | |
| 'ð¡allablebehavior.php' => 1, | |
| 'captchainterface.php' => 1, | |
| 'vkbase.php' => 1, | |
| 'mjstwigapplyfilterbundle.php' => 1, | |
| 'workspacebehaviorpeer.php' => 1, | |
| 'workspacebehaviorclass.php' => 1, | |
| 'workspacebehavior.php' => 1, | |
| 'ramblerwebdriver.php' => 1, | |
| 'vkwebdriver.php' => 1, | |
| 'webdriverbase.php' => 1, | |
| 'gitlog' => 1, | |
| 'xeditablecolumn.php' => 1, | |
| 'frontcontroler.php' => 1, | |
| 'pch' => 1, | |
| 'xeditablewysihtml5.php' => 1, | |
| 'xeditabletextarea.php' => 1, | |
| 'xeditabletext.php' => 1, | |
| 'xeditableselect.php' => 1, | |
| 'xeditabledatetime.php' => 1, | |
| 'xeditabledate.php' => 1, | |
| 'doctrinedumpfixturesbundle.php' => 1, | |
| 'xeditableconfig.php' => 1, | |
| 'xeditablecombodate.php' => 1, | |
| 'magic_forms.install' => 1, | |
| 'logcounter' => 1, | |
| 'origami.sql' => 1, | |
| 'nodenotfoundexception.php' => 1, | |
| 'class.messages.php' => 1, | |
| 'envato_marketplaces.php' => 1, | |
| 'melifarobookingbundle.php' => 1, | |
| 'tordf-0057-in.jsonld' => 1, | |
| 'console_table.php' => 1, | |
| 'stringbuilder.php' => 1, | |
| 'tordf-0057-out.nq' => 1, | |
| 'quickaccesstrait.php' => 1, | |
| 'queryableexception.php' => 1, | |
| 'queryable.php' => 1, | |
| 'invalidexpressionexception.php' => 1, | |
| 'tordf-0056-in.jsonld' => 1, | |
| 'badtypeexception.php' => 1, | |
| 'tordf-0058-in.jsonld' => 1, | |
| 'tordf-0058-out.nq' => 1, | |
| 'tordf-0059-in.jsonld' => 1, | |
| 'rawexample.php' => 1, | |
| 'resamplr.php' => 1, | |
| 'spell_it.gemspec' => 1, | |
| 'recordlogger.php' => 1, | |
| 'serializeconverter.php' => 1, | |
| 'relatedconverter.php' => 1, | |
| 'tordf-0056-out.nq' => 1, | |
| 'tordf-0055-out.nq' => 1, | |
| 'tordf-0059-out.nq' => 1, | |
| 'sample.ini' => 1, | |
| 'meedivideobundle.php' => 1, | |
| 'lesspls.php' => 1, | |
| 'lesspls' => 1, | |
| 'emojiformat.php' => 1, | |
| 'online_check.php' => 1, | |
| 'tordf-0052-out.nq' => 1, | |
| 'tordf-0053-in.jsonld' => 1, | |
| 'tordf-0053-out.nq' => 1, | |
| 'cleancache.php' => 1, | |
| 'mlpostmasterbundle.php' => 1, | |
| 'yazquery.php' => 1, | |
| 'config.testing.php' => 1, | |
| 'parserini.php' => 1, | |
| 'parsequery.php' => 1, | |
| 'tordf-0054-in.jsonld' => 1, | |
| 'tordf-0054-out.nq' => 1, | |
| 'parserserviceprovider.php' => 1, | |
| 'marcxml.php' => 1, | |
| 'tordf-0055-in.jsonld' => 1, | |
| 'skoap-build.sublime-project' => 1, | |
| 'travs-config.ini' => 1, | |
| 'queueing-example.php' => 1, | |
| 'example-worker.php' => 1, | |
| 'numeralconverter.php' => 1, | |
| 'enumtrait.php' => 1, | |
| 'class.javascriptpacker.php4' => 1, | |
| 'tordf-0069-in.jsonld' => 1, | |
| 'tordf-0067-in.jsonld' => 1, | |
| 'mcwebbnormalizeddatabundle.php' => 1, | |
| 'phiremock.phar' => 1, | |
| 'example.yaml' => 1, | |
| 'regression.phar' => 1, | |
| 'tordf-0067-out.nq' => 1, | |
| 'money.phar' => 1, | |
| 'linear-algebra.phar' => 1, | |
| 'tordf-0068-in.jsonld' => 1, | |
| 'tordf-0068-out.nq' => 1, | |
| 'debug.inc.php' => 1, | |
| 'relatedsearchbehavior.php' => 1, | |
| 'glyphicons.png' => 1, | |
| 'libphonenumber.php' => 1, | |
| 'tordf-0069-out.nq' => 1, | |
| 'tordf-0070-in.jsonld' => 1, | |
| 'tordf-0070-out.nq' => 1, | |
| 'tordf-0071-in.jsonld' => 1, | |
| 'tordf-0071-out.nq' => 1, | |
| 'tordf-0072-in.jsonld' => 1, | |
| 'tordf-0072-out.nq' => 1, | |
| 'tordf-0073-in.jsonld' => 1, | |
| 'keenactivedataprovider.php' => 1, | |
| 'symfonypersiajalalidatebundle.php' => 1, | |
| 'enumconverter.php' => 1, | |
| 'tordf-0062-in.jsonld' => 1, | |
| 'tordf-0060-in.jsonld' => 1, | |
| 'dateconverter.php' => 1, | |
| 'clientbehavior.php' => 1, | |
| 'tordf-0060-out.nq' => 1, | |
| 'checkreload.php' => 1, | |
| 'appcache.php' => 1, | |
| 'tordf-0061-in.jsonld' => 1, | |
| 'tordf-0061-out.nq' => 1, | |
| 'autonumbervalidator.php' => 1, | |
| 'autonumber.php' => 1, | |
| 'tordf-0062-out.nq' => 1, | |
| 'tordf-0066-out.nq' => 1, | |
| 'tordf-0063-in.jsonld' => 1, | |
| 'relationuniquevalidator.php' => 1, | |
| 'tordf-0063-out.nq' => 1, | |
| 'tordf-0064-in.jsonld' => 1, | |
| 'queryscopebehavior.php' => 1, | |
| 'tordf-0064-out.nq' => 1, | |
| 'verifycontroller.php' => 1, | |
| 'tordf-0065-in.jsonld' => 1, | |
| 'entercode.php' => 1, | |
| 'tordf-0065-out.nq' => 1, | |
| 'tordf-0066-in.jsonld' => 1, | |
| 'tordf-0052-in.jsonld' => 1, | |
| 'example-file.php' => 1, | |
| 'tordf-0074-in.jsonld' => 1, | |
| 'tordf-0036-in.jsonld' => 1, | |
| 'mespronos.info.yml' => 1, | |
| 'mespronos_website.profile' => 1, | |
| 'mespronos_website.install' => 1, | |
| 'mespronos_website.info.yml' => 1, | |
| 'mespronos_front.theme' => 1, | |
| 'mespronos_front.libraries.yml' => 1, | |
| 'mespronos_front.info.yml' => 1, | |
| 'tordf-0035-in.jsonld' => 1, | |
| 'tordf-0035-out.nq' => 1, | |
| 'langselector.php' => 1, | |
| 'md.php' => 1, | |
| 'mespronos.libraries.yml' => 1, | |
| 'tordf-0036-out.nq' => 1, | |
| 'emojioneasset.php' => 1, | |
| 'manymanybehavior.php' => 1, | |
| 'aaencoder.php' => 1, | |
| 'aadecoder.php' => 1, | |
| 'curlhelper.php' => 1, | |
| 'tordf-0041-in.jsonld' => 1, | |
| 'tordf-0041-out.nq' => 1, | |
| 'smarttest.php' => 1, | |
| 'merobasebundle.php' => 1, | |
| 'mespronos.install' => 1, | |
| 'mespronos.links.action.yml' => 1, | |
| 'tordf-0042-out.nq' => 1, | |
| 'metalvarezcommentsbundle.php' => 1, | |
| 'tordf-0029-in.jsonld' => 1, | |
| 'tordf-0029-out.nq' => 1, | |
| 'tordf-0030-in.jsonld' => 1, | |
| 'tordf-0030-out.nq' => 1, | |
| 'metator' => 1, | |
| 'rdap.php' => 1, | |
| 'retro.php' => 1, | |
| 'metalvarezvotingbundle.php' => 1, | |
| 'tordf-0031-in.jsonld' => 1, | |
| 'tordf-0031-out.nq' => 1, | |
| 'tordf-0032-in.jsonld' => 1, | |
| 'tordf-0034-out.nq' => 1, | |
| 'metaclassauthenticationguardbundle.php' => 1, | |
| 'mespronos.services.yml' => 1, | |
| 'mespronos.routing.yml' => 1, | |
| 'tordf-0032-out.nq' => 1, | |
| 'tordf-0033-in.jsonld' => 1, | |
| 'mespronos.permissions.yml' => 1, | |
| 'mespronos.module' => 1, | |
| 'tordf-0033-out.nq' => 1, | |
| 'tordf-0034-in.jsonld' => 1, | |
| 'mespronos.links.task.yml' => 1, | |
| 'mespronos.links.menu.yml' => 1, | |
| 'tordf-0042-in.jsonld' => 1, | |
| 'testsimpletemplate.php' => 1, | |
| 'example-inline.php' => 1, | |
| 'tordf-0047-out.nq' => 1, | |
| 'cli-composer-config.json' => 1, | |
| 'sellsyapibundle.php' => 1, | |
| 'multipleinheritancebundle.php' => 1, | |
| 'mefdcontaofoundationbundle.php' => 1, | |
| 'tordf-0044-out.nq' => 1, | |
| 'tordf-0045-in.jsonld' => 1, | |
| 'tordf-0045-out.nq' => 1, | |
| 'tordf-0046-in.jsonld' => 1, | |
| 'tordf-0046-out.nq' => 1, | |
| 'tordf-0047-in.jsonld' => 1, | |
| 'tordf-0048-in.jsonld' => 1, | |
| 'access.xml' => 1, | |
| 'tordf-0048-out.nq' => 1, | |
| 'tordf-0049-in.jsonld' => 1, | |
| 'tordf-0049-out.nq' => 1, | |
| 'tordf-0050-in.jsonld' => 1, | |
| 'tordf-0050-out.nq' => 1, | |
| 'tordf-0051-in.jsonld' => 1, | |
| 'tordf-0051-out.nq' => 1, | |
| 'mefdcommonbundle.php' => 1, | |
| 'testshipment.php' => 1, | |
| 'testparcelstatus.php' => 1, | |
| 'test_services.dist.json' => 1, | |
| 'lang.xml' => 1, | |
| 'testheadlinks.php' => 1, | |
| 'currentinstallation.png' => 1, | |
| 'phartest.php' => 1, | |
| 'envmap.php' => 1, | |
| 'merkdoughbundle.php' => 1, | |
| 'phpunit.jenkins.xml' => 1, | |
| 'merchiumclient.php' => 1, | |
| 'insomniamaxmindgeoipbundle.php' => 1, | |
| 'tordf-0043-in.jsonld' => 1, | |
| 'ctocommunication.php' => 1, | |
| 'move.psd' => 1, | |
| 'frontendcheckboxmenu.png' => 1, | |
| 'clipboard.psd' => 1, | |
| 'parsers.xml' => 1, | |
| 'puphpet.json' => 1, | |
| 'memeoirspaymillbundle.php' => 1, | |
| 'tordf-0043-out.nq' => 1, | |
| 'tordf-0044-in.jsonld' => 1, | |
| 'dbase.php' => 1, | |
| 'memaw-phpcs.php.dist' => 1, | |
| 'melnikovedpopplerbundle.php' => 1, | |
| 'mekrasoberegbundle.php' => 1, | |
| 'xmlserver.php' => 1, | |
| 'urlhandler.php' => 1, | |
| 'router.xml' => 1, | |
| 'tordf-0073-out.nq' => 1, | |
| 'tordf-0074-out.nq' => 1, | |
| 'mysql2pdoexception.php' => 1, | |
| 'tordf-0092-out.nq' => 1, | |
| 'cartasi.php' => 1, | |
| 'tordf-0091-out.nq' => 1, | |
| 'laravel-installer' => 1, | |
| 'darkwoodgeneratorbundle.php' => 1, | |
| 'torfeed.php' => 1, | |
| 'tpbtorfeedhandler.php' => 1, | |
| 'standardtorfeedhandler.php' => 1, | |
| 'matuckmenubundle.php' => 1, | |
| 'kickasstorfeedhandler.php' => 1, | |
| 'tordf-0092-in.jsonld' => 1, | |
| 'matuckaliasbundle.php' => 1, | |
| 'appwebuser.php' => 1, | |
| 'mattwellss_magentocomposerautoloader.xml' => 1, | |
| 'mahangosignupbundle.php' => 1, | |
| 'tordf-0093-in.jsonld' => 1, | |
| 'tordf-0093-out.nq' => 1, | |
| 'tordf-0094-in.jsonld' => 1, | |
| 'tordf-0094-out.nq' => 1, | |
| 'mattvickharvestappbundle.php' => 1, | |
| 'tordf-0095-in.jsonld' => 1, | |
| 'mattschesvulnerabilitiesbundle.php' => 1, | |
| 'mattschesversioneyebundle.php' => 1, | |
| 'ajaxreturnobject.php' => 1, | |
| 'tordf-0091-in.jsonld' => 1, | |
| 'servicedefinitionvalidatorinterface.php' => 1, | |
| 'tordf-0088-out.nq' => 1, | |
| 'parsedownconverter.php' => 1, | |
| 'sculpineditorbundle.php' => 1, | |
| 'phpcs.conf.dist' => 1, | |
| '.pairs' => 1, | |
| 'findbundle.php' => 1, | |
| 'twitterwidget.php' => 1, | |
| 'tordf-0087-out.nq' => 1, | |
| 'tordf-0088-in.jsonld' => 1, | |
| 'twittertweet.php' => 1, | |
| 'twitterreader.php' => 1, | |
| 'updatewidget.php' => 1, | |
| 'tordf-0090-out.nq' => 1, | |
| 'telegrambot.php' => 1, | |
| 'photosize.php' => 1, | |
| 'tordf-0089-in.jsonld' => 1, | |
| 'rpslswidget.php' => 1, | |
| 'rpslsasset.php' => 1, | |
| 'workinprogresswidget.php' => 1, | |
| 'tordf-0089-out.nq' => 1, | |
| 'passwordhelper.php' => 1, | |
| 'namedactiverecord.php' => 1, | |
| 'emailvalidator.php' => 1, | |
| 'tordf-0090-in.jsonld' => 1, | |
| 'tordf-0095-out.nq' => 1, | |
| 'servicedefinitionvalidatorfactoryinterface.php' => 1, | |
| 'projects.php' => 1, | |
| 'tordf-0103-in.jsonld' => 1, | |
| 'servicecontainerinterface.php' => 1, | |
| 'tordf-0102-in.jsonld' => 1, | |
| 'refactoring' => 1, | |
| 'nobackdoctrineormvalueobjectbundle.php' => 1, | |
| 'matthiaslazyservicesbundle.php' => 1, | |
| 'matthiasconsolecommandgeneratorbundle.php' => 1, | |
| '.cauditor.yml' => 1, | |
| 'ogone.php' => 1, | |
| 'bayerjsonapibundle.php' => 1, | |
| 'tordf-0102-out.nq' => 1, | |
| 'test_v11.php' => 1, | |
| 'argumentvalidatorinterface.php' => 1, | |
| 'tordf-0103-out.nq' => 1, | |
| 'mysql_test_schema.sql' => 1, | |
| 'mysql_test_results' => 1, | |
| 'mysql_test_after.php' => 1, | |
| 'mysql_test.php' => 1, | |
| 'mysql_functions.php' => 1, | |
| 'tordf-0104-in.jsonld' => 1, | |
| 'mysql_example.php' => 1, | |
| 'mysql_definitions.php' => 1, | |
| 'tordf-0104-out.nq' => 1, | |
| 'argumentvalidator.php' => 1, | |
| 'argumentsvalidator.php' => 1, | |
| 'tordf-0096-in.jsonld' => 1, | |
| 'tordf-0098-out.nq' => 1, | |
| 'tordf-0096-out.nq' => 1, | |
| 'tordf-0097-in.jsonld' => 1, | |
| 'servicedefinitionvalidatorfactory.php' => 1, | |
| 'tordf-0097-out.nq' => 1, | |
| 'servicedefinitionvalidator.php' => 1, | |
| 'resultingclassresolverinterface.php' => 1, | |
| 'resultingclassresolver.php' => 1, | |
| 'methodcallsvalidatorinterface.php' => 1, | |
| 'tordf-0098-in.jsonld' => 1, | |
| 'methodcallsvalidator.php' => 1, | |
| 'tordf-0099-in.jsonld' => 1, | |
| 'argumentsvalidatorinterface.php' => 1, | |
| 'definitionargumentsvalidatorinterface.php' => 1, | |
| 'tordf-0099-out.nq' => 1, | |
| 'tordf-0100-in.jsonld' => 1, | |
| 'tordf-0100-out.nq' => 1, | |
| 'tordf-0101-in.jsonld' => 1, | |
| 'tordf-0101-out.nq' => 1, | |
| 'definitionargumentsvalidator.php' => 1, | |
| 'constructorresolverinterface.php' => 1, | |
| 'constructorresolver.php' => 1, | |
| 'batchservicedefinitionvalidatorinterface.php' => 1, | |
| 'batchservicedefinitionvalidator.php' => 1, | |
| 'tordf-0087-in.jsonld' => 1, | |
| 'sculpinprojectsbundle.php' => 1, | |
| 'tordf-0075-in.jsonld' => 1, | |
| 'mazuploadclass.php' => 1, | |
| 'varnishpurger.php' => 1, | |
| 'varnishpurgeprovider.php' => 1, | |
| 'livephpmonitor.php' => 1, | |
| 'livephp.js' => 1, | |
| 'livephpbundle.php' => 1, | |
| 'phpinteractorbundle.php' => 1, | |
| 'mboptimizationbundle.php' => 1, | |
| 'mbdashboardbundle.php' => 1, | |
| 'menumodules.php' => 1, | |
| 'hartija.html' => 1, | |
| 'processingbundle.php' => 1, | |
| 'tordf-0080-out.nq' => 1, | |
| 'mazarinisluggerbundle.php' => 1, | |
| 'redisenablebundle.php' => 1, | |
| 'responseevent.php' => 1, | |
| 'notificationerrorevent.php' => 1, | |
| 'mayeconotificationsbundle.php' => 1, | |
| 'mayecoinvoicesbundle.php' => 1, | |
| 'mayecogooglebundle.php' => 1, | |
| 'tordf-0081-out.nq' => 1, | |
| 'easyannotationbundle.php' => 1, | |
| 'tinymcewidget.php' => 1, | |
| 'tordf-0081-in.jsonld' => 1, | |
| 'tordf-0080-in.jsonld' => 1, | |
| 'owlcarouselwidget.php' => 1, | |
| 'dataparserapplication.php' => 1, | |
| 'tordf-0075-out.nq' => 1, | |
| 'tordf-0076-in.jsonld' => 1, | |
| 'tordf-0076-out.nq' => 1, | |
| 'tordf-0077-in.jsonld' => 1, | |
| 'tordf-0077-out.nq' => 1, | |
| 'tordf-0078-in.jsonld' => 1, | |
| 'tordf-0078-out.nq' => 1, | |
| 'mch0licopenflashchartbundle.php' => 1, | |
| 'wp-recaptcha-integration.php' => 1, | |
| 'mkzip.sh' => 1, | |
| 'softwaredeskbiketraderapibundle.php' => 1, | |
| 'ffixture.php' => 1, | |
| 'contact-process.php' => 1, | |
| 'flashmessagehandlerbundle.php' => 1, | |
| 'tordf-0079-in.jsonld' => 1, | |
| 'eventhubbundle.php' => 1, | |
| 'cleanvendorscontroller.php' => 1, | |
| 'cleanassetscontroller.php' => 1, | |
| 'zf2base.sql' => 1, | |
| 'zf2base-workflow.jpg' => 1, | |
| 'makutaclientbundle.php' => 1, | |
| 'ffixtureseed.php' => 1, | |
| 'tordf-0079-out.nq' => 1, | |
| 'tinymcecustomasset.php' => 1, | |
| 'owlcarouselasset.php' => 1, | |
| 'redirectgenerator.php' => 1, | |
| 'tordf-0085-out.nq' => 1, | |
| 'tordf-0083-out.nq' => 1, | |
| 'testit' => 1, | |
| 'tordf-0084-in.jsonld' => 1, | |
| 'build_archive.sh' => 1, | |
| 'tordf-0084-out.nq' => 1, | |
| 'harvester.php' => 1, | |
| 'tordf-0085-in.jsonld' => 1, | |
| 'githubapibundle.php' => 1, | |
| 'navbar.tpl' => 1, | |
| 'materialize.yml' => 1, | |
| 'blog_post.tpl' => 1, | |
| 'imagefilevalidator.php' => 1, | |
| 'blog.tpl' => 1, | |
| 'keyword-generator.php' => 1, | |
| 'common-words-ru_ru.php' => 1, | |
| 'tordf-0086-in.jsonld' => 1, | |
| 'twigpress.php' => 1, | |
| 'tordf-0086-out.nq' => 1, | |
| 'phpunit.dist' => 1, | |
| 'nginx-conf-parser' => 1, | |
| 'mawiajaxautocompletebundle.php' => 1, | |
| 'console.config.php' => 1, | |
| 'sculpinredirectbundle.php' => 1, | |
| 'testit.config.yml' => 1, | |
| 'imageprocessor.php' => 1, | |
| 'minifymanager.php' => 1, | |
| 'angularmainasset.php' => 1, | |
| 'minifyhelper.php' => 1, | |
| 'searchtrait.php' => 1, | |
| 'processfilterevent.php' => 1, | |
| 'additionstrait.php' => 1, | |
| 'fullpagejswidget.php' => 1, | |
| 'fullpagejsasset.php' => 1, | |
| 'tordf-0082-in.jsonld' => 1, | |
| 'appbootstrap.php' => 1, | |
| 'angularsanitizeasset.php' => 1, | |
| 'tordf-0082-out.nq' => 1, | |
| 'angulari18nasset.php' => 1, | |
| 'imageprocessorcontroller.php' => 1, | |
| 'angularuirouterasset.php' => 1, | |
| 'gc-example.php' => 1, | |
| 'maxmodegeneratorbundle.php' => 1, | |
| '.travis-test.sh' => 1, | |
| '.travis-install-prereqs.sh' => 1, | |
| '.coveralls-phpunit.xml.dist' => 1, | |
| 'maxmind-db' => 1, | |
| 'readme.dev' => 1, | |
| 'jsviewsasset.php' => 1, | |
| 'tordf-0083-in.jsonld' => 1, | |
| 'imagevalidator.php' => 1, | |
| 'po.png' => 1, | |
| 'my_form_validation.php' => 1, | |
| 'demo-general.php' => 1, | |
| 'whhgasset.php' => 1, | |
| 'openiconicasset.php' => 1, | |
| 'multisitelanguageswitcher.php' => 1, | |
| 'sociconasset.php' => 1, | |
| 'phpct.yml' => 1, | |
| 'typiconsasset.php' => 1, | |
| 'mylogphp.class.php' => 1, | |
| 'uniasset.php' => 1, | |
| 'crudbundle.php' => 1, | |
| 'codekit-config.json' => 1, | |
| 'lanewechat.php' => 1, | |
| 'ipinfo.php' => 1, | |
| 'tweetercorebundle.php' => 1, | |
| 'agentdetect.php' => 1, | |
| 'livsisdtoolsbundle.php' => 1, | |
| 'ipinfoasset.php' => 1, | |
| 'dosuserbundle.php' => 1, | |
| 'html5input.php' => 1, | |
| 'html5inputasset.php' => 1, | |
| 'pluginassetbundle.php' => 1, | |
| 'translationtrait.php' => 1, | |
| 'dossmsbundle.php' => 1, | |
| 'dossettingsbundle.php' => 1, | |
| 'octiconsasset.php' => 1, | |
| 'cubebundle.php' => 1, | |
| 'syliusmediabundle.php' => 1, | |
| 'cache-clear' => 1, | |
| 'db-login' => 1, | |
| 'db-credentials' => 1, | |
| 'db-backup' => 1, | |
| 'coverage-report' => 1, | |
| 'coverage-ensure' => 1, | |
| 'composer-reinstall' => 1, | |
| 'composer-install' => 1, | |
| 'composer-binaries' => 1, | |
| 'codesniffer-run' => 1, | |
| 'gridresizestoreasset.php' => 1, | |
| 'baremetal-bootstrap' => 1, | |
| 'efoundationbundle.php' => 1, | |
| 'radiocolumn.php' => 1, | |
| 'radiocolumnasset.php' => 1, | |
| 'elusiveasset.php' => 1, | |
| 'smirikquizbundle.php' => 1, | |
| 'smirikexambundle.php' => 1, | |
| 'smirikcoursebundle.php' => 1, | |
| 'smirikcontentbundle.php' => 1, | |
| 'smirikadminbundle.php' => 1, | |
| 'lms2migrationbundle.php' => 1, | |
| 'flagiconasset.php' => 1, | |
| 'html.tpl.php' => 1, | |
| 'dosresourcebundle.php' => 1, | |
| 'dosmailerbundle.php' => 1, | |
| 'gridresizecolumnsasset.php' => 1, | |
| 'depdropasset.php' => 1, | |
| 'twitterplugin.php' => 1, | |
| 'vkplugin.php' => 1, | |
| 'sortableinput.php' => 1, | |
| 'sortableinputasset.php' => 1, | |
| 'stickytabsasset.php' => 1, | |
| 'tabsx.php' => 1, | |
| 'tabsxasset.php' => 1, | |
| 'affixasset.php' => 1, | |
| 'colorinputasset.php' => 1, | |
| 'depdropaction.php' => 1, | |
| 'depdropextasset.php' => 1, | |
| 'githubxplugin.php' => 1, | |
| 'starratingthemeasset.php' => 1, | |
| 'blazon.yml' => 1, | |
| 'render.inc.php' => 1, | |
| 'c2g_listvhosts.php' => 1, | |
| 'c2g_listbackups.php' => 1, | |
| 'c2g_functions.php' => 1, | |
| 'dataexchange.php' => 1, | |
| 'pharmaintelligencegstandaardbundle.php' => 1, | |
| 'foundationassets.php' => 1, | |
| 'datetimepickerassets.php' => 1, | |
| 'googleplugin.php' => 1, | |
| 'githubplugin.php' => 1, | |
| 'sdfaefeafe' => 1, | |
| 'init_aspect.php' => 1, | |
| 'biz_sub_apis.php' => 1, | |
| 'biz_apis.php' => 1, | |
| 'fastest' => 1, | |
| 'liuggiostatsdclientbundle.php' => 1, | |
| 'labelinplace.php' => 1, | |
| 'labelinplaceasset.php' => 1, | |
| 'navxasset.php' => 1, | |
| 'jdexception.php' => 1, | |
| 'jdclient.php' => 1, | |
| 'sweetcaptchabundle.php' => 1, | |
| 'stormapi.class.php' => 1, | |
| 'facebookplugin.php' => 1, | |
| 'lioshiwondercachebundle.php' => 1, | |
| 'popoverx.php' => 1, | |
| 'prophet' => 1, | |
| 'make_test_environment.sh' => 1, | |
| 'magicdoc' => 1, | |
| 'advancedconnectorbundle.php' => 1, | |
| 'transmogrifier.sublime-project' => 1, | |
| 'screenshot.json.dist' => 1, | |
| 'objectstorage.conf.dist' => 1, | |
| 'filelist.conf.dist' => 1, | |
| 'popoverxasset.php' => 1, | |
| 'db-sample-data' => 1, | |
| 'docs-generate' => 1, | |
| 'backstrech.php' => 1, | |
| 'index.tp.php' => 1, | |
| 'losodiannotationsbundle.php' => 1, | |
| 'how to install' => 1, | |
| 'faq and docs' => 1, | |
| 'dbtable.php' => 1, | |
| 'ult.php' => 1, | |
| 'initinterface.php' => 1, | |
| 'http_cache.php' => 1, | |
| 'muzijk.php' => 1, | |
| 'libslize.php.tp' => 1, | |
| 'libslize' => 1, | |
| 'libslize.php' => 1, | |
| 'superbanner.php' => 1, | |
| 'hunter.js' => 1, | |
| 'spaces.css' => 1, | |
| 'bootstrapvalidator.min.js' => 1, | |
| 'detailviewasset.php' => 1, | |
| 'dialogbootstrapasset.php' => 1, | |
| 'dropdownxasset.php' => 1, | |
| 'dynagrid.php' => 1, | |
| 'dynagridasset.php' => 1, | |
| 'dynagriddetail.php' => 1, | |
| 'bootstrapvalidator.min.css' => 1, | |
| 'contextmenu.php' => 1, | |
| 'ezpublishcoreextrabundle.php' => 1, | |
| 'phpunit.php52.xml.dist' => 1, | |
| 'demo1.html' => 1, | |
| 'antdeb.xml' => 1, | |
| 'ant-deb.jar' => 1, | |
| 'antcontrib.xml' => 1, | |
| 'tabularform.php' => 1, | |
| 'tabularformasset.php' => 1, | |
| 'postal_resolver.js' => 1, | |
| 'cleanup' => 1, | |
| 'spefilesizeextensionbundle.php' => 1, | |
| 'flot' => 1, | |
| 'checkboxx.php' => 1, | |
| 'yunxin.php' => 1, | |
| 'krajeeflatbluethemeasset.php' => 1, | |
| 'yuntongxun.php' => 1, | |
| 'yunpian.php' => 1, | |
| 'webchinese.php' => 1, | |
| 'sxt.php' => 1, | |
| 'smsbao.php' => 1, | |
| 'chuanglan.php' => 1, | |
| 'checkboxxasset.php' => 1, | |
| 'tetranslationbundle.php' => 1, | |
| 'tesearchifybundle.php' => 1, | |
| 'tedoctrinebehaviorsbundle.php' => 1, | |
| 'lolautruchepaylinebundle.php' => 1, | |
| 'callbackassets.php' => 1, | |
| 'dynagriddetailasset.php' => 1, | |
| 'gridperfectscrollbarasset.php' => 1, | |
| 'gridexportasset.php' => 1, | |
| 'checkboxcolumnasset.php' => 1, | |
| 'rename-empty' => 1, | |
| 'owner-set' => 1, | |
| 'columntrait.php' => 1, | |
| 'nfsexports-setsudoaccess' => 1, | |
| 'editablecolumnaction.php' => 1, | |
| 'expandrowcolumn.php' => 1, | |
| 'migrations' => 1, | |
| 'expandrowcolumnasset.php' => 1, | |
| 'formulacolumn.php' => 1, | |
| 'metrics-generate' => 1, | |
| 'booleancolumn.php' => 1, | |
| 'logs-clear' => 1, | |
| 'git-remotechanges' => 1, | |
| 'git-localchanges' => 1, | |
| 'git-hook-workingcopychange' => 1, | |
| 'git-currentbranch' => 1, | |
| 'folder-delete-items-older-than-days' => 1, | |
| 'email' => 1, | |
| 'docs-post' => 1, | |
| 'gridfloatheadasset.php' => 1, | |
| 'gridgroupasset.php' => 1, | |
| 'tests-run' => 1, | |
| 'exportmenuasset.php' => 1, | |
| 'dynagridstore.php' => 1, | |
| 'constantsarray.php' => 1, | |
| 'migration-doctrine-cli.php' => 1, | |
| 'migration-create.php' => 1, | |
| 'migrate-to-version.php' => 1, | |
| 'migrate-to-latest.php' => 1, | |
| 'migrate-init.php' => 1, | |
| 'editableasset.php' => 1, | |
| 'migrate-init-config.php' => 1, | |
| 'gls online api.pdf' => 1, | |
| 'dpd-api.pdf' => 1, | |
| 'api-test.php' => 1, | |
| 'editablepjaxasset.php' => 1, | |
| 'vagrant-exec' => 1, | |
| 'exportcolumnasset.php' => 1, | |
| 'exportmenu.php' => 1, | |
| 'phpunix.xml.dist' => 1, | |
| 'locastictcompaywaypayumbundle.php' => 1, | |
| 'github-changelog' => 1, | |
| 'loamoksubformsmadeeasybundle.php' => 1, | |
| 'loamokjquerysliderbundle.php' => 1, | |
| 'phpdoc.dist.xml.template' => 1, | |
| 'composer.json.template' => 1, | |
| 'readme.md.template' => 1, | |
| '.travis.yml.template' => 1, | |
| 'backstrechassets.php' => 1, | |
| 'example_url.php' => 1, | |
| 'updaterepositorytask.php' => 1, | |
| 'css_browser_selector.min.js' => 1, | |
| 'kyticketpost.php' => 1, | |
| 'kyticketpriority.php' => 1, | |
| 'kyticketstatus.php' => 1, | |
| 'arraytoxml.php' => 1, | |
| 'kytickettimetrack.php' => 1, | |
| 'kytickettype.php' => 1, | |
| 'clsms.php' => 1, | |
| 'kytroubleshooterattachment.php' => 1, | |
| 'kytroubleshootercategory.php' => 1, | |
| 'bitcoin.php' => 1, | |
| 'css_browser_selector.js' => 1, | |
| 'kyticketcustomfieldgroup.php' => 1, | |
| 'css_browser_selector.class.php' => 1, | |
| 'rawhttpmethod.php' => 1, | |
| 'vim.tar.gz' => 1, | |
| 'lhpalaciobackupmanagerbundle.php' => 1, | |
| 'kytroubleshootercomment.php' => 1, | |
| 'kytroubleshooterstep.php' => 1, | |
| 'lexxpavlovpagebundle.php' => 1, | |
| 'lexxpavlovsettingsbundle.php' => 1, | |
| 'lexikworkflowbundle.php' => 1, | |
| 'kyuser.php' => 1, | |
| 'kyticketnote.php' => 1, | |
| 'cookiehelper.php' => 1, | |
| 'lexikpayboxbundle.php' => 1, | |
| 'librinfobaseentitiesbundle.php' => 1, | |
| 'notormpanel.php' => 1, | |
| 'librinfovarietiesbundle.php' => 1, | |
| 'librinfouserbundle.php' => 1, | |
| 'librinfouibundle.php' => 1, | |
| 'librinfosecuritybundle.php' => 1, | |
| 'librinfodoctrinepgsqlbundle.php' => 1, | |
| 'librinfodoctrinebundle.php' => 1, | |
| 'librinfodecoratorbundle.php' => 1, | |
| 'librinfocorebundle.php' => 1, | |
| 'librinfocrmbundle.php' => 1, | |
| 'readme-from-scratch' => 1, | |
| 'simplearraytoxml.php' => 1, | |
| 'links' => 1, | |
| 'dev.sh' => 1, | |
| 'dev-cleanstart.sh' => 1, | |
| 'dev-check.sh' => 1, | |
| 'kyresultset.php' => 1, | |
| 'kystaff.php' => 1, | |
| 'kystaffgroup.php' => 1, | |
| 'gravitonvcapbundle.php' => 1, | |
| 'qy.php' => 1, | |
| 'kyticket.php' => 1, | |
| 'kyticketattachment.php' => 1, | |
| 'kyusergroup.php' => 1, | |
| 'lexikmonologbrowserbundle.php' => 1, | |
| 'weixinapi' => 1, | |
| 'post-test.bat' => 1, | |
| 'kayueessencebundle.php' => 1, | |
| 'kayuewordpressbundle.php' => 1, | |
| 'db.bat' => 1, | |
| 'wordpressevents.php' => 1, | |
| 'favicon' => 1, | |
| 'kwparserbundle.php' => 1, | |
| 'zenstruckcontentbundle.php' => 1, | |
| 'sws.php' => 1, | |
| 'zenstruckcontrollerutilbundle.php' => 1, | |
| 'serve.bat' => 1, | |
| 'config.integration.example.json' => 1, | |
| 'recreate_test_db.sh' => 1, | |
| 'coding_standard.xml' => 1, | |
| 'dployer' => 1, | |
| 'tisql.php' => 1, | |
| 'leozaentitiesbundle.php' => 1, | |
| 'entitymanagerexception.php' => 1, | |
| 'entitygeneratorexception.php' => 1, | |
| 'entitygenerator.php' => 1, | |
| 'leozaapiserverbundle.php' => 1, | |
| 'leozaapiclientbundle.php' => 1, | |
| 'demo-mysql.php' => 1, | |
| 'ruckusing.conf.php' => 1, | |
| 'yammer.php' => 1, | |
| 'lexikjwtauthenticationbundle.php' => 1, | |
| 'mongodbmanager.php' => 1, | |
| 'lexikframeworkacceleratorbundle.php' => 1, | |
| 'lexikformfilterbundle.php' => 1, | |
| 'lexikdatalayerbundle.php' => 1, | |
| 'lexikcurrencybundle.php' => 1, | |
| 'lexikcolissimobundle.php' => 1, | |
| 'eyandexmetrikawidget.php' => 1, | |
| 'tuner' => 1, | |
| 'chords.yml' => 1, | |
| 'fminorrepertoire.php' => 1, | |
| 'repertoireinterface.php' => 1, | |
| 'kyuserorganization.php' => 1, | |
| 'jstreeinput.php' => 1, | |
| 'rbaccached.php' => 1, | |
| 'angellist.php' => 1, | |
| 'deviantart.php' => 1, | |
| 'flattr.php' => 1, | |
| 'formstack.php' => 1, | |
| 'mixcloud.php' => 1, | |
| 'nestedsetsquerybehavior.php' => 1, | |
| 'msn.php' => 1, | |
| 'snapr.php' => 1, | |
| 'socialmedia_oauth_connect.php' => 1, | |
| 'stocktwits.php' => 1, | |
| 'panel.latte' => 1, | |
| 'php-wechat.wiki' => 1, | |
| 'avatar.php' => 1, | |
| 'kycustomfield.php' => 1, | |
| 'kycommentbase.php' => 1, | |
| 'searchfactoryinterface.php' => 1, | |
| 'kycommentablebase.php' => 1, | |
| 'liipsearchbundle.php' => 1, | |
| 'pidfile.php' => 1, | |
| 'kyconfig.php' => 1, | |
| 'lockexception.php' => 1, | |
| 'liiponeallbundle.php' => 1, | |
| 'liipmultiplexbundle.php' => 1, | |
| 'liipmonitorbundle.php' => 1, | |
| 'imagineevents.php' => 1, | |
| 'exceptional.php' => 1, | |
| 'liiphyphenatorbundle.php' => 1, | |
| 'hyphenatorfactory.php' => 1, | |
| 'kycustomfielddate.php' => 1, | |
| 'kycustomfielddefinition.php' => 1, | |
| 'liiphellobundle.php' => 1, | |
| 'paratest' => 1, | |
| 'liipfoxycartbundle.php' => 1, | |
| 'cartvalidation.php' => 1, | |
| 'kycustomfieldfile.php' => 1, | |
| 'liipformtranslationchoicebundle.php' => 1, | |
| 'liipsoaprecorderbundle.php' => 1, | |
| 'example-vejnavn.php' => 1, | |
| 'drupaltranslationmodule.module' => 1, | |
| 'tojsonldinterface.php' => 1, | |
| 'limitlandldapbundle.php' => 1, | |
| 'switchinputasset.php' => 1, | |
| 'ormdfixerbundle.php' => 1, | |
| 'bootstrapmedialightboxasset.php' => 1, | |
| 'instantconfigurationplugin.php' => 1, | |
| 'lilwebextrabundle.php' => 1, | |
| 'lilwebcoffeescriptbundle.php' => 1, | |
| 'lilwebldapbundle.php' => 1, | |
| 'lilwebjobbundle.php' => 1, | |
| 'lilwebevolutionbundle.php' => 1, | |
| 'liipviebundle.php' => 1, | |
| 'activetheme.php' => 1, | |
| 'fromjsonldinterface.php' => 1, | |
| 'typeaheadbasicasset.php' => 1, | |
| 'typeaheadhbasset.php' => 1, | |
| 'karudevproductbundle.php' => 1, | |
| 'liipurlautoconverterbundle.php' => 1, | |
| 'sinlinebundle.php' => 1, | |
| 'envato-plugin-update.php' => 1, | |
| 'liiptranslationbundle.php' => 1, | |
| 'example.build.xml' => 1, | |
| 'liipthemebundle.php' => 1, | |
| 'dyndns.php' => 1, | |
| 'vm.drush.inc' => 1, | |
| 'drupaltranslationmodule.info' => 1, | |
| '.gitattributes.dist' => 1, | |
| 'lcmbrightcovebundle.php' => 1, | |
| 'kynewscomment.php' => 1, | |
| 'liipcachecontrolbundle.php' => 1, | |
| 'readme.developers' => 1, | |
| 'liilomangopaybundle.php' => 1, | |
| 'kynewsitem.php' => 1, | |
| 'kynewssubscriber.php' => 1, | |
| 'w2ui.jquery.json' => 1, | |
| 'kyobjectbase.php' => 1, | |
| 'brainstorm' => 1, | |
| 'kyobjectwithcustomfieldsbase.php' => 1, | |
| 'lighthartgridbundle.php' => 1, | |
| 'migrate_fos' => 1, | |
| 'schedules' => 1, | |
| 'cocarbundle.php' => 1, | |
| 'kyrestclient.php' => 1, | |
| 'kyrestclientinterface.php' => 1, | |
| 'example-module.php' => 1, | |
| 'lifotypeaheadbundle.php' => 1, | |
| 'lidaatwigbundle.php' => 1, | |
| 'lidaatransbundle.php' => 1, | |
| 'lockformasset.php' => 1, | |
| 'lockbsformasset.php' => 1, | |
| 'layermobileasset.php' => 1, | |
| 'kynewscategory.php' => 1, | |
| 'liipcodebundle.php' => 1, | |
| 'drupalregistrymodule.module' => 1, | |
| 'kyhelpers.php' => 1, | |
| 'kycustomfieldgroupbase.php' => 1, | |
| 'drupalregistrymodule.info' => 1, | |
| 'drupaleventmanagermodule.module' => 1, | |
| 'drupaleventmanagermodule.info' => 1, | |
| 'kycustomfieldlinkedselect.php' => 1, | |
| 'kycustomfieldmultiselect.php' => 1, | |
| 'drupalcrudadminmodule.module' => 1, | |
| 'kycustomfieldoption.php' => 1, | |
| 'kycustomfieldselect.php' => 1, | |
| 'kydepartment.php' => 1, | |
| 'kyincludes.php' => 1, | |
| 'liipcontainerwrapperbundle.php' => 1, | |
| 'kyknowledgebasearticle.php' => 1, | |
| 'kyknowledgebaseattachment.php' => 1, | |
| 'kyknowledgebasecategory.php' => 1, | |
| 'kyknowledgebasecomment.php' => 1, | |
| 'drupalcrudadminmodule.install' => 1, | |
| 'drupalcrudadminmodule.info' => 1, | |
| 'drupalcrudadminmodule.helper.inc' => 1, | |
| 'drupalcrudadminmodule.admin.inc' => 1, | |
| 'drupalconnectormodule.module' => 1, | |
| 'drupalconnectormodule.info' => 1, | |
| 'liipdoctrinecachebundle.php' => 1, | |
| 'installtask.php' => 1, | |
| 'debpkg.phing.xml' => 1, | |
| 'star.php' => 1, | |
| 'maciaddressbundle.php' => 1, | |
| 'maciorderbundle.php' => 1, | |
| 'macimediabundle.php' => 1, | |
| 'macimailerbundle.php' => 1, | |
| 'macilistbundle.php' => 1, | |
| 'macicorebundle.php' => 1, | |
| 'macicontactbundle.php' => 1, | |
| 'kairosgoogleanalyticsclientbundle.php' => 1, | |
| 'kairosgoogleanalyticsserversidebundle.php' => 1, | |
| 'maciblogbundle.php' => 1, | |
| 'maciadminbundle.php' => 1, | |
| 'swaggeruiasset.php' => 1, | |
| 'macitranslatorbundle.php' => 1, | |
| 'apiresponse.php' => 1, | |
| 'apimodel.php' => 1, | |
| 'apigenerator.php' => 1, | |
| 'sparkline.php' => 1, | |
| 'softdeletetrait.php' => 1, | |
| 'notificationsmodule.php' => 1, | |
| 'flot.php' => 1, | |
| 'boxtrait.php' => 1, | |
| '.php-version' => 1, | |
| 'yiimailmessage.php' => 1, | |
| 'maciproductbundle.php' => 1, | |
| 'http_build_url.php' => 1, | |
| 'wrepidealbundle.php' => 1, | |
| 'stringplural.php' => 1, | |
| 'datetimerangepicker.php' => 1, | |
| 'socketserver.php' => 1, | |
| 'socketserverclient.php' => 1, | |
| 'multiloader.php' => 1, | |
| 'xmldeserializer.php' => 1, | |
| 'xmlserializable.php' => 1, | |
| 'xmlserializer.php' => 1, | |
| 'hicri.php' => 1, | |
| 'hilal.php' => 1, | |
| 'parse_netscape_bookmarks.php' => 1, | |
| 'kaguxsilexintegrationbundle.php' => 1, | |
| 'metadatabehavior.php' => 1, | |
| 'backendmodule.php' => 1, | |
| 'mrsectionwidgetasset.php' => 1, | |
| 'imagecropsection.php' => 1, | |
| 'us.stackdump' => 1, | |
| 'tmdbapi.php' => 1, | |
| 'www' => 1, | |
| 'simplequeuemessage.php' => 1, | |
| 'simplequeuecontroller.php' => 1, | |
| 'simplequeueaction.php' => 1, | |
| 'simplequeue.php' => 1, | |
| 'googleanalyticsbundle.php' => 1, | |
| 'yiimail.php' => 1, | |
| 'paragraph.php' => 1, | |
| 'fakeuploadedfile.php' => 1, | |
| 'm4griosepomexbundle.php' => 1, | |
| 'mandrillmailer.php' => 1, | |
| 'quicky.class.php' => 1, | |
| 'quicky.form.class.php' => 1, | |
| 'mrocarequestlogbundle.php' => 1, | |
| 'mczolkoherokuschedulerbundle.php' => 1, | |
| 'quicky_bbcode.class.php' => 1, | |
| 'rsentrylog.php' => 1, | |
| 'rsentrycomponent.php' => 1, | |
| 'alternativemail.php' => 1, | |
| 'foppdfbundle.php' => 1, | |
| 'quicky_compiler.class.php' => 1, | |
| 'localstorage.class.php' => 1, | |
| 'xppaut' => 1, | |
| 'mophugbearbundle.php' => 1, | |
| 'moparangodbbundle.php' => 1, | |
| 'datacollector.php' => 1, | |
| 'newscooptageswochewidgetspluginbundle.php' => 1, | |
| 'blitz.class.php' => 1, | |
| 'newscoopingestparsersuperdeskcontentapibundle.php' => 1, | |
| 'jskasset.php' => 1, | |
| 'jsk.php' => 1, | |
| 'terminatur.bootstrap.inc' => 1, | |
| 'wbxcommunesdefrancebundle.php' => 1, | |
| 'wbxfilebundle.php' => 1, | |
| 'measuretextresult.php' => 1, | |
| 'about.png' => 1, | |
| 'measuretextcounts.php' => 1, | |
| 'measuretext.php' => 1, | |
| 'linesbreaker.php' => 1, | |
| 'linesbreakpointresult.php' => 1, | |
| 'uaparserbundle.php' => 1, | |
| 'linesbreakpoint.php' => 1, | |
| 'linesbreakcharresult.php' => 1, | |
| 'linesbreakchar.php' => 1, | |
| 'translatethis' => 1, | |
| 'seo.png' => 1, | |
| 'character optimization for translation service.xlsx' => 1, | |
| 'redcodeflowbundle.php' => 1, | |
| 'kalista' => 1, | |
| 'mmwhoisbundle.php' => 1, | |
| 'dojobundle.php' => 1, | |
| 'googlesearchengineplugin.php' => 1, | |
| 'duckduckgosearchengineplugin.php' => 1, | |
| 'bingsearchengineplugin.php' => 1, | |
| 'zohoinvoiceapiclient.php' => 1, | |
| 'twitterapi.php' => 1, | |
| 'oauthhmacsha1.php' => 1, | |
| 'kairoszohoinvoiceconnectorbundle.php' => 1, | |
| 'redcodetransactionmanagerbundle.php' => 1, | |
| 'socketclient.php' => 1, | |
| 'networkexception.php' => 1, | |
| 'terminatur.code.inc' => 1, | |
| 'acumulusbundle.php' => 1, | |
| 'sf_dic.module' => 1, | |
| 'sf_dic.install' => 1, | |
| 'sf_dic.info' => 1, | |
| 'sf_dic.container.php' => 1, | |
| 'env.sample.json' => 1, | |
| 'env.json' => 1, | |
| 'dumpcontent.php' => 1, | |
| 'mdmtranslatorcheckerbundle.php' => 1, | |
| 'mapperinterface.php' => 1, | |
| 'broadwayrethinkdbbundle.php' => 1, | |
| 'zf1wrapperbundle.php' => 1, | |
| 'sf_dic.services.yml' => 1, | |
| 'requests' => 1, | |
| 'setup.cfg' => 1, | |
| 'gtm.php' => 1, | |
| 'newemailwatcherdump.php' => 1, | |
| 'newemailwatcherinterface.php' => 1, | |
| 'servercustom.php' => 1, | |
| 'sendinblueapibundle.php' => 1, | |
| 'mailxpertapibundle.php' => 1, | |
| 'cffie.png' => 1, | |
| 'dataresponse.php' => 1, | |
| 'sf_dic.path.inc' => 1, | |
| 'makingwavesezaddthisbundle.php' => 1, | |
| 'mongod.conf' => 1, | |
| 'autoloadwidget.php' => 1, | |
| 'eventstore.config.php' => 1, | |
| 'autoloader.ini' => 1, | |
| 'readme.md.old' => 1, | |
| 'phantastic' => 1, | |
| 'config.yaml.sample' => 1, | |
| 'rgba-server.php' => 1, | |
| 'rgba-cli' => 1, | |
| 'ajarloader.php' => 1, | |
| 'ajar.php' => 1, | |
| 'mediaasset.php' => 1, | |
| 'yak.png' => 1, | |
| 'makingwavesezstarratingbundle.php' => 1, | |
| '\\com\\iesebre\\dam2\\max\\persons\\person.uml' => 1, | |
| '\\com\\iesebre\\dam2\\max\\curriculum\\study.uml' => 1, | |
| 'diagrampersons.png' => 1, | |
| 'diagramcurriculum.png' => 1, | |
| 'icalendar.php' => 1, | |
| 'icalperson.php' => 1, | |
| 'icalevent.php' => 1, | |
| 'icalattendee.php' => 1, | |
| 'icalalarm.php' => 1, | |
| 'frontendbundle.php' => 1, | |
| 'mapperbuilder.php' => 1, | |
| 'psxbundle.php' => 1, | |
| 'test_form.php' => 1, | |
| 'abstractserverclient.php' => 1, | |
| 'madesstdoctrinegenerationbundle.php' => 1, | |
| 'db_init.php' => 1, | |
| 'cookie2' => 1, | |
| 'cookie' => 1, | |
| 'dropboxuploader.php' => 1, | |
| 'clientmessagedtos.proto' => 1, | |
| 'kachkaevdropboxbackupbundle.php' => 1, | |
| '.bookignore' => 1, | |
| 'kachkaevphprbundle.php' => 1, | |
| 'install-elasticsearch.sh' => 1, | |
| 'madesstsecurityextrabundle.php' => 1, | |
| 'madesstapidebugbundle.php' => 1, | |
| 'contributor-readme' => 1, | |
| 'keylighter.php' => 1, | |
| 'staging.jpg' => 1, | |
| 'development.jpg' => 1, | |
| 'backendauthasset.php' => 1, | |
| 'textformatsbehavior.php' => 1, | |
| 'selectizetextinput.php' => 1, | |
| 'selectizedropdownlist.php' => 1, | |
| 'selectizebase.php' => 1, | |
| 'abstractserver.php' => 1, | |
| 'autocompletestyleasset.php' => 1, | |
| 'pagee.php' => 1, | |
| 'ssbuilderscrack' => 1, | |
| 'preview.gif' => 1, | |
| 'jarlssen_cmsfiles.xml' => 1, | |
| '.arty.example.yml' => 1, | |
| 'math_captcha.php' => 1, | |
| 'magican' => 1, | |
| 'run_tests' => 1, | |
| 'imagicreativityjqueryknobbundle.php' => 1, | |
| 'magallanes.sublime-project' => 1, | |
| 'isolation.php' => 1, | |
| 'package.json.sample' => 1, | |
| 'gruntfile.js.sample' => 1, | |
| 'report.full' => 1, | |
| 'mgf.php' => 1, | |
| 'sandbox.html' => 1, | |
| 'mgf.bat' => 1, | |
| 'magento-finder.php' => 1, | |
| 'magento-finder.bat' => 1, | |
| 'synctranslitbehavior.php' => 1, | |
| 'synctranslit.php' => 1, | |
| 'font.php' => 1, | |
| 'phatic.yml.dist' => 1, | |
| 'magaritestbundle.php' => 1, | |
| 'maestrano.png' => 1, | |
| 'kachkaevcountersbundle.php' => 1, | |
| 'kachkaevdafbundle.php' => 1, | |
| 'treeviewassets.php' => 1, | |
| 'tinymcefilemanagerasset.php' => 1, | |
| 'debpkg.xml' => 1, | |
| 'update-locales.sh' => 1, | |
| '.travisload.sh' => 1, | |
| 'kamranxmlformbundle.php' => 1, | |
| '.phpunit.dist.xml' => 1, | |
| '.magmierrors' => 1, | |
| '.localtest.sh' => 1, | |
| 'config.dist.yml' => 1, | |
| 'phpunit-unit.xml.dist' => 1, | |
| 'lsroudiclassifiedadsevents.php' => 1, | |
| 'lsroudiclassifiedadsbundle.php' => 1, | |
| 'update-pot.sh' => 1, | |
| 'run-phpdoc.sh' => 1, | |
| 'athens.php' => 1, | |
| 'makepackagexml.php' => 1, | |
| 'make-release.sh' => 1, | |
| 'ixr_library.php' => 1, | |
| 'radiofilter.php' => 1, | |
| 'dropdownfilter.php' => 1, | |
| 'datefilter.php' => 1, | |
| 'checkboxfilter.php' => 1, | |
| 'lpwebpaymentevents.php' => 1, | |
| 'lpwebpaymentbundle.php' => 1, | |
| 'reflection_php4.php' => 1, | |
| 'baseaccount.php' => 1, | |
| 'facerepository.php' => 1, | |
| 'service.json' => 1, | |
| 'wechatshakearound.php' => 1, | |
| 'notificationhandler.php' => 1, | |
| 'googledrivebundle.php' => 1, | |
| 'drivemodifier.php' => 1, | |
| 'drivefinder.php' => 1, | |
| 'driveconnector.php' => 1, | |
| 'channelmanager.php' => 1, | |
| 'start-selenium-server.bat' => 1, | |
| 'screenshot-simpletest-gui.png' => 1, | |
| 'wechatuser.php' => 1, | |
| 'wechatstat.php' => 1, | |
| 'wechatsemantic.php' => 1, | |
| 'photorepository.php' => 1, | |
| 'wechatqrcode.php' => 1, | |
| 'wechatoauth2.php' => 1, | |
| 'migrations.xml' => 1, | |
| 'wechatmessage.php' => 1, | |
| 'wechatmenu.php' => 1, | |
| 'wechatkf.php' => 1, | |
| 'wechatcard.php' => 1, | |
| 'b2backblazebundle.php' => 1, | |
| 'kamrangroupchoicelistbundle.php' => 1, | |
| 'kamransettingbundle.php' => 1, | |
| 'payserver.php' => 1, | |
| 'phpup' => 1, | |
| 'documentasset.php' => 1, | |
| 'pdfparserbundle.php' => 1, | |
| 'karserrobokassabundle.php' => 1, | |
| 'easytest.php' => 1, | |
| 'symvirins' => 1, | |
| 'symvirins.phar' => 1, | |
| 'kahorimagethumbnailbundle.php' => 1, | |
| 'binarythinkinglastfmbundle.php' => 1, | |
| 'openmiddlewarebundle.php' => 1, | |
| 'ussd.php' => 1, | |
| 'phpunit_ci.xml' => 1, | |
| 'karsergoogletranslatebundle.php' => 1, | |
| 'karsermainsmsbundle.php' => 1, | |
| 'karsersmsbundle.php' => 1, | |
| 'richerrortest.php' => 1, | |
| 'karsersmsvestibundle.php' => 1, | |
| 'activeformevent.php' => 1, | |
| 'gemaadminbundle.php' => 1, | |
| 'puzzle' => 1, | |
| 'svn.xml' => 1, | |
| 'phplint.xml' => 1, | |
| 'formgrid.php' => 1, | |
| 'formtrait.php' => 1, | |
| 'git.xml' => 1, | |
| 'exec.xml' => 1, | |
| 'default.yaml' => 1, | |
| 'richerror.php' => 1, | |
| 'wubookapibundle.php' => 1, | |
| 'ajaxq.php' => 1, | |
| 'config_merge.php' => 1, | |
| 'greek_vat_validator.php' => 1, | |
| 'events.test.php' => 1, | |
| 'transelot.php' => 1, | |
| 'reversepagination.php' => 1, | |
| 'reverselinkpager.php' => 1, | |
| 'ajaxqasset.php' => 1, | |
| 'bvcmsbundle.php' => 1, | |
| 'bvitemplatebundle.php' => 1, | |
| 'bvrolebundle.php' => 1, | |
| 'kapcontactbundle.php' => 1, | |
| 'restfulparser.php' => 1, | |
| 'try_catch.php' => 1, | |
| 'notify_url.php' => 1, | |
| 'alipayapi.php' => 1, | |
| 'alipay.config.php' => 1, | |
| 'ophir.php' => 1, | |
| 'file_upload.php' => 1, | |
| 'propelmodelparserbundle.php' => 1, | |
| 'propertycollection.php' => 1, | |
| 'sample_config.inc.php' => 1, | |
| 'create_database.sql' => 1, | |
| 'rsparsertest.php' => 1, | |
| 'pdfparser.php' => 1, | |
| 'gitaski' => 1, | |
| 'terminatur.database.inc' => 1, | |
| 'domquery.js' => 1, | |
| 'lifestreamserviceprovider.php' => 1, | |
| 'config.yml-dist' => 1, | |
| 'wc-edostavka.php' => 1, | |
| '.platform-project' => 1, | |
| 'emailmakr' => 1, | |
| 'windwalker' => 1, | |
| 'phpunit.xml.pgsql.dist' => 1, | |
| 'admin-global-search-autocomplete.php' => 1, | |
| 'moduleloader.js' => 1, | |
| 'etmas.css' => 1, | |
| 'ajaxutil.js' => 1, | |
| 'direction.php' => 1, | |
| 'imageuploadasset.php' => 1, | |
| 'imageupload.php' => 1, | |
| 'ezmigrationbundle.php' => 1, | |
| 'makephar' => 1, | |
| 'kaliopqueueingpluginskinesisbundle.php' => 1, | |
| 'kaliopqueueingpluginssqsbundle.php' => 1, | |
| 'kaliopqueueingpluginsstompbundle.php' => 1, | |
| 'kaliopqueueingbundle.php' => 1, | |
| 'simplemenu.php' => 1, | |
| 'shortcutmenu.php' => 1, | |
| 'lyrixxlifestreambundle.php' => 1, | |
| 'city.mmdb' => 1, | |
| 'viewengine.php' => 1, | |
| 'b3wasset.php' => 1, | |
| 'tinymcecontentstylesasset.php' => 1, | |
| 'elfindercontroller.php' => 1, | |
| 'authitem.php' => 1, | |
| 'terminatur.drush.inc' => 1, | |
| 'fullcalendarassets.php' => 1, | |
| 'terminatur.files.inc' => 1, | |
| 'dynmodels.php' => 1, | |
| 'dynmodelfields.php' => 1, | |
| 'dynmodeleditor.php' => 1, | |
| 'checkboxlist.php' => 1, | |
| 'wtexception.php' => 1, | |
| 'country.mmdb' => 1, | |
| 'simpledemo.php' => 1, | |
| 'groupdemo.php' => 1, | |
| 'worldtextsms.class.php' => 1, | |
| 'worldtextgroup.class.php' => 1, | |
| 'worldtextadmin.class.php' => 1, | |
| 'worldtext.php' => 1, | |
| 'terminatur.settings.inc' => 1, | |
| 'terminatur.utils.inc' => 1, | |
| 'symfonyformgeneratorbundle.php' => 1, | |
| 'lzakrzewskifacebookauthenticationbundle.php' => 1, | |
| 'pingpp.php' => 1, | |
| 'notifymenu.php' => 1, | |
| 'webuploaderhtml5onlyasset.php' => 1, | |
| 'readme.eng' => 1, | |
| 'mage.package.xml' => 1, | |
| 'localebundleevents.php' => 1, | |
| 'changelog-2_1' => 1, | |
| 'wp-nonce.php' => 1, | |
| 'listsearchwidget.php' => 1, | |
| 'coalaconsolebundle.php' => 1, | |
| 'coalacatchphperrorsbundle.php' => 1, | |
| 'decoder.php' => 1, | |
| 'interface-pm-proxy' => 1, | |
| 'pdo.class.inc.php' => 1, | |
| 'pear.package.xml' => 1, | |
| 'micro.sql' => 1, | |
| 'wysibbwidgetasset.php' => 1, | |
| '.atoum.php.ci' => 1, | |
| 'playbloomguzzlebundle.php' => 1, | |
| '.kisma.php' => 1, | |
| 'pbarcode39.php~' => 1, | |
| 'gusuploaderbundle.php' => 1, | |
| 'multicombinator.php' => 1, | |
| 'klein.php' => 1, | |
| 'ppie.php~' => 1, | |
| 'humbuglog' => 1, | |
| 'workstead' => 1, | |
| 'snowflake' => 1, | |
| 'luneticstimezonebundle.php' => 1, | |
| 'timezonebundleevents.php' => 1, | |
| 'webuploaderflashonlyasset.php' => 1, | |
| 'remote-admin.png' => 1, | |
| 'uploaderaction.php' => 1, | |
| 'ueditorassets.php' => 1, | |
| 'amazeuithreepresenter.php' => 1, | |
| 'test3.jpeg' => 1, | |
| 'test2.jpeg' => 1, | |
| 'test1.jpeg' => 1, | |
| 'featurecheckerbundle.php' => 1, | |
| 'garbagecollector.php' => 1, | |
| 'phreepio' => 1, | |
| 'kumitebundle.php' => 1, | |
| 'registerinterface.php' => 1, | |
| 'website' => 1, | |
| 'luya.php' => 1, | |
| 'bootstrap4asset.php' => 1, | |
| 'luxiferrabbitmqmanagementbundle.php' => 1, | |
| 'googlemapassets.php' => 1, | |
| 'navcustom.php' => 1, | |
| 'resizecrop.php' => 1, | |
| 'selectmaplocationassets.php' => 1, | |
| 'composer.jsonbak' => 1, | |
| 'chrome.crx' => 1, | |
| 'selectmaplocationwidget.php' => 1, | |
| 'wysibbwidget.php' => 1, | |
| 'subtree-split.config' => 1, | |
| 'twbsmaxlengthasset.php' => 1, | |
| 'wp-plugin-core.php' => 1, | |
| 'socolissimo.php' => 1, | |
| 'theliasmarty.php' => 1, | |
| 'theliamigratecountry.php' => 1, | |
| 'theliahybridauth.php' => 1, | |
| 'theliagooglemap.php' => 1, | |
| 'theliadebugbar.php' => 1, | |
| 'taxruleimport.php' => 1, | |
| 'takecustomeraccount.php' => 1, | |
| 'tntfrance.php' => 1, | |
| 'supportticket.php' => 1, | |
| 'stripepayment.php' => 1, | |
| 'storeseo.php' => 1, | |
| 'stockonorder.php' => 1, | |
| 'stockalert.php' => 1, | |
| 'smartyredirection.php' => 1, | |
| 'theliatwig.php' => 1, | |
| 'smartyfilter.php' => 1, | |
| 'smartycache.php' => 1, | |
| 'shoppingflux.php' => 1, | |
| 'routesmatchinverter.php' => 1, | |
| 'rewriteurl.php' => 1, | |
| 'removeuselesscart.php' => 1, | |
| 'redsys.php' => 1, | |
| 'redirection.php' => 1, | |
| 'recentlyviewed.php' => 1, | |
| 'productsearch.php' => 1, | |
| 'productonlinewithoutstock.php' => 1, | |
| 'productofflinewithstock.php' => 1, | |
| 'popin.php' => 1, | |
| 'theliastudio.php' => 1, | |
| 'tokenrenew.php' => 1, | |
| 'payzenmulti.php' => 1, | |
| 'configuration.html' => 1, | |
| 'document-edit.html' => 1, | |
| 'customers.html' => 1, | |
| 'customer-edit.html' => 1, | |
| 'currency-edit.html' => 1, | |
| 'currencies.html' => 1, | |
| 'create-password.html' => 1, | |
| 'create-password-success.html' => 1, | |
| 'coupon-update.html' => 1, | |
| 'coupon-list.html' => 1, | |
| 'coupon-create.html' => 1, | |
| 'country-edit.html' => 1, | |
| 'countries.html' => 1, | |
| 'content-edit.html' => 1, | |
| 'config-store.html' => 1, | |
| 'transferpayment.php' => 1, | |
| 'category-edit.html' => 1, | |
| 'categories.html' => 1, | |
| 'brands.html' => 1, | |
| 'brand-edit.html' => 1, | |
| 'attributes.html' => 1, | |
| 'attribute-edit.html' => 1, | |
| 'api.html' => 1, | |
| 'advanced-configuration.html' => 1, | |
| 'administrators.html' => 1, | |
| 'admin-logs.html' => 1, | |
| 'admin-layout.tpl' => 1, | |
| 'wiretransfer.php' => 1, | |
| 'virtualproductdelivery.php' => 1, | |
| 'virtualproductcontrol.php' => 1, | |
| 'payzenoneoffsepa.php' => 1, | |
| 'payzen.php' => 1, | |
| 'export-page.html' => 1, | |
| 'dealerteam.php' => 1, | |
| 'googleshopping.php' => 1, | |
| 'freeorder.php' => 1, | |
| 'forcephone.php' => 1, | |
| 'flatfeedelivery.php' => 1, | |
| 'featuretype.php' => 1, | |
| 'extraorderdata.php' => 1, | |
| 'duplicateorder.php' => 1, | |
| 'dpdpickup.php' => 1, | |
| 'dpdclassic.php' => 1, | |
| 'diaporamas.php' => 1, | |
| 'deliveryround.php' => 1, | |
| 'deliveryexcludedate.php' => 1, | |
| 'deliverydelay.php' => 1, | |
| 'dealer.php' => 1, | |
| 'gratisonlinealert.php' => 1, | |
| 'databasesmanager.php' => 1, | |
| 'customerscope.php' => 1, | |
| 'customergroupacl.php' => 1, | |
| 'phpcbf.sh' => 1, | |
| 'customergroup.php' => 1, | |
| 'customerfamily.php' => 1, | |
| 'customerbirthdate.php' => 1, | |
| 'customdelivery.php' => 1, | |
| 'criteriasearch.php' => 1, | |
| 'creditnote.php' => 1, | |
| 'creditaccount.php' => 1, | |
| 'contest.php' => 1, | |
| 'contentcode.php' => 1, | |
| 'googleuniversalanalytics.php' => 1, | |
| 'hookadminhome.php' => 1, | |
| 'paymentrecall.php' => 1, | |
| 'imagefactory.php' => 1, | |
| 'paybox.php' => 1, | |
| 'ordercreation.php' => 1, | |
| 'ordercomment.php' => 1, | |
| 'opensearchserversearch.php' => 1, | |
| 'moneris.php' => 1, | |
| 'mailjet.php' => 1, | |
| 'loyalty.php' => 1, | |
| 'lengow.php' => 1, | |
| 'legacyproductattributes.php' => 1, | |
| 'keyword.php' => 1, | |
| 'indexengine.php' => 1, | |
| 'importt1.php' => 1, | |
| 'importexportseo.php' => 1, | |
| 'inseegeo.php' => 1, | |
| 'hookanalytics.php' => 1, | |
| 'hooksocial.php' => 1, | |
| 'hooksearch.php' => 1, | |
| 'hookproductsoffer.php' => 1, | |
| 'hookproductsnew.php' => 1, | |
| 'hooknewsletter.php' => 1, | |
| 'hooknavigation.php' => 1, | |
| 'hooklinks.php' => 1, | |
| 'hooklang.php' => 1, | |
| 'hookdoc.php' => 1, | |
| 'hookcustomer.php' => 1, | |
| 'hookcurrency.php' => 1, | |
| 'hookcookies.php' => 1, | |
| 'hookcontact.php' => 1, | |
| 'hookcart.php' => 1, | |
| 'error.html' => 1, | |
| 'export.html' => 1, | |
| 'colissimo.php' => 1, | |
| 'theme.ini' => 1, | |
| 'dtgeshibundle.php' => 1, | |
| 'atresourceaccessbundle.php' => 1, | |
| 'theodorogercmsbundle.php' => 1, | |
| 'theodoquizbundle.php' => 1, | |
| 'theodoframeworkextrabundle.php' => 1, | |
| 'theodoevolutionsessionbundle.php' => 1, | |
| 'theodoevolutionlegacywrapperbundle.php' => 1, | |
| 'theododrupal8bundle.php' => 1, | |
| 'theodoesendexclientbundle.php' => 1, | |
| 'twade.php' => 1, | |
| 'katana' => 1, | |
| 'ovhsmsbundle.php' => 1, | |
| 'imagesbase64converterbundle.php' => 1, | |
| 'tmhoauth.php' => 1, | |
| '.shuntpwd' => 1, | |
| 'maschitcryptencoderbundle.php' => 1, | |
| 'maschitbarcodebundle.php' => 1, | |
| 'unit-tests.sh' => 1, | |
| 'unit-tests.bat' => 1, | |
| 'reset_install.sh' => 1, | |
| 'reset_install.bat' => 1, | |
| 'php-cs.bat' => 1, | |
| 'php-cs' => 1, | |
| 'change-version.sh' => 1, | |
| 'thelia.sql' => 1, | |
| 'tax_faker.php' => 1, | |
| 'insert.sql.tpl' => 1, | |
| 'insert.sql' => 1, | |
| 'rfc5849' => 1, | |
| 'travis.xml.dist' => 1, | |
| 'faker_100categories_1000products_4locales.php' => 1, | |
| 'aismatakuliahbundle.php' => 1, | |
| 'aisuserbundle.php' => 1, | |
| 'aistranskripbundle.php' => 1, | |
| 'aisstatuskeaktifanbundle.php' => 1, | |
| 'aisslotbundle.php' => 1, | |
| 'aissemesterbundle.php' => 1, | |
| 'aisruangbundle.php' => 1, | |
| 'aisprovinsibundle.php' => 1, | |
| 'aisprodibundle.php' => 1, | |
| 'aisprestasibundle.php' => 1, | |
| 'aispimpinanprodibundle.php' => 1, | |
| 'aispertemuanmahasiswabundle.php' => 1, | |
| 'aispertemuandosenbundle.php' => 1, | |
| 'aispertemuanbundle.php' => 1, | |
| 'aismahasiswaprofilebundle.php' => 1, | |
| 'tacticianbundle.php' => 1, | |
| 'aismahasiswabundle.php' => 1, | |
| 'aiskontrakmahasiswabundle.php' => 1, | |
| 'aiskontrakdosenbundle.php' => 1, | |
| 'aiskabupatenbundle.php' => 1, | |
| 'aisjadwalbundle.php' => 1, | |
| 'aisijasahsmabundle.php' => 1, | |
| 'aisharibundle.php' => 1, | |
| 'aisgedungbundle.php' => 1, | |
| 'aisdosenbundle.php' => 1, | |
| 'aisdaftarbundle.php' => 1, | |
| 'aisbimbinganbundle.php' => 1, | |
| 'md2resume_dev.php' => 1, | |
| 'working.php' => 1, | |
| 'fb' => 1, | |
| 'faker_add_ecotax.php' => 1, | |
| 'faker.php' => 1, | |
| 'feature-edit.html' => 1, | |
| 'module-edit.html' => 1, | |
| 'shipping-zones-edit.html' => 1, | |
| 'shipping-configuration.html' => 1, | |
| 'shipping-configuration-edit.html' => 1, | |
| 'sales.html' => 1, | |
| 'sale-edit.html' => 1, | |
| 'profiles.html' => 1, | |
| 'profile-edit.html' => 1, | |
| 'product-edit.html' => 1, | |
| 'orders.html' => 1, | |
| 'order-edit.html' => 1, | |
| 'modules.html' => 1, | |
| 'module-hooks.html' => 1, | |
| 'module-hook-edit.html' => 1, | |
| 'module-configure.html' => 1, | |
| 'simple-layout.tpl' => 1, | |
| 'message-edit.html' => 1, | |
| 'mailing-system.html' => 1, | |
| 'lost-password.html' => 1, | |
| 'languages.html' => 1, | |
| 'import-page.html' => 1, | |
| 'image-edit.html' => 1, | |
| 'hooks.html' => 1, | |
| 'hook-edit.html' => 1, | |
| 'home.html' => 1, | |
| 'general_error.html' => 1, | |
| 'folders.html' => 1, | |
| 'folder-edit.html' => 1, | |
| 'features.html' => 1, | |
| 'shipping-zones.html' => 1, | |
| 'state-edit.html' => 1, | |
| 'database.yml.sample' => 1, | |
| 'admin_password' => 1, | |
| 'hooktest.php' => 1, | |
| 'delivery.html' => 1, | |
| 'password' => 1, | |
| 'password.html' => 1, | |
| 'order_notification' => 1, | |
| 'order_notification.html' => 1, | |
| 'order_confirmation' => 1, | |
| 'order_confirmation.html' => 1, | |
| 'newsletter_subscription_confirmation' => 1, | |
| 'newsletter_subscription_confirmation.html' => 1, | |
| 'email-layout.tpl' => 1, | |
| 'default-text-layout.tpl' => 1, | |
| 'default-html-layout.tpl' => 1, | |
| 'admin_password.html' => 1, | |
| 'states.html' => 1, | |
| 'account_created_by_admin' => 1, | |
| 'account_created_by_admin.html' => 1, | |
| 'account_changed_by_admin' => 1, | |
| 'account_changed_by_admin.html' => 1, | |
| 'variables.html' => 1, | |
| 'variable-edit.html' => 1, | |
| 'translations.html' => 1, | |
| 'tools.html' => 1, | |
| 'templates.html' => 1, | |
| 'template-edit.html' => 1, | |
| 'taxes-rules.html' => 1, | |
| 'tax-rule-edit.html' => 1, | |
| 'tax-edit.html' => 1, | |
| 'system-logs.html' => 1, | |
| 'configdoc.php' => 1, | |
| 'cmcic.php' => 1, | |
| 'vmcpatientbundle.php' => 1, | |
| 'tebruexecutionerbundle.php' => 1, | |
| 'release-1.1.0' => 1, | |
| 'api-2.0.0' => 1, | |
| 'api-1.1.0' => 1, | |
| 'api-1.0.0' => 1, | |
| 'license.orig' => 1, | |
| 'example-vanilla.php' => 1, | |
| 'example-composer.php' => 1, | |
| 'phpctags.class.php' => 1, | |
| 'pbc-export.sh' => 1, | |
| 'wp-async-task.php' => 1, | |
| 'tebrustripebundle.php' => 1, | |
| 'tebruretrofitbundle.php' => 1, | |
| 'servicescollection.php' => 1, | |
| 'teapotiobaseuserbundle.php' => 1, | |
| 'release-2.0.1' => 1, | |
| 'teapotiobasethemebundle.php' => 1, | |
| 'teapotiobaseforumbundle.php' => 1, | |
| 'teapotiobasecachebundle.php' => 1, | |
| 'statuscode.php' => 1, | |
| 'retention.php' => 1, | |
| 'retention.civix.php' => 1, | |
| 'nonmembers.php' => 1, | |
| 'nonmembers.civix.php' => 1, | |
| 'registerwithoutemail.php' => 1, | |
| 'registerwithoutemail.civix.php' => 1, | |
| 'management.php' => 1, | |
| 'management.civix.php' => 1, | |
| 'mailgun.civix.php' => 1, | |
| 'release-2.0.0' => 1, | |
| 'release-2.0.2' => 1, | |
| 'cache' => 1, | |
| 'uspsprioritylabel.php' => 1, | |
| 'update-checker' => 1, | |
| '.circle.yml' => 1, | |
| 'pumukityoutubebundle.php' => 1, | |
| 'pumukitvideoeditorbundle.php' => 1, | |
| 'pumukitpaellaplayerbundle.php' => 1, | |
| 'pumukitmoodlebundle.php' => 1, | |
| 'pumukitgeantwebtvbundle.php' => 1, | |
| 'baserestservicetb.php' => 1, | |
| 'authtb.php' => 1, | |
| 'datatableassets.php' => 1, | |
| 'collapsewidgetasset.php' => 1, | |
| 'collapsewidget.php' => 1, | |
| 'uspsservicedeliverycalculator.php' => 1, | |
| 'uspsopendistributelabel.php' => 1, | |
| 'copying-gpl' => 1, | |
| 'uspsinternationallabel.php' => 1, | |
| 'uspsfirstclassservicestandards.php' => 1, | |
| 'cspoosmsbundle.php' => 1, | |
| 'cspooswiftmailermailgunbundle.php' => 1, | |
| 'data_bridge.php' => 1, | |
| 'siteidentifier.php' => 1, | |
| 'tedivmstashbundle.php' => 1, | |
| 'setupenvironment.sh' => 1, | |
| '.dovecottestingmark' => 1, | |
| 'phpcs_test.xml' => 1, | |
| 'quickstart-guide' => 1, | |
| 'pear-summary' => 1, | |
| 'project.properties' => 1, | |
| 'readme.pear' => 1, | |
| 'voice' => 1, | |
| 'pagetsconfig' => 1, | |
| 'temporesourceextrabundle.php' => 1, | |
| 'memcachefactory.php' => 1, | |
| 'tfoxestidcardbundle.php' => 1, | |
| 'tfoxditoolsbundle.php' => 1, | |
| 'tfoxdbprocedureevents.php' => 1, | |
| 'tfoxdbprocedurebundle.php' => 1, | |
| 'tfoxcalendarbundle.php' => 1, | |
| 'tfoxbeanstalkdbundle.php' => 1, | |
| 'nginx_rewrite' => 1, | |
| 'thtranslationlogbundle.php' => 1, | |
| 'loggingmessagecatalogue.php' => 1, | |
| 'statsd.php' => 1, | |
| 'smstatsdbundle.php' => 1, | |
| 'smmemcachebundle.php' => 1, | |
| 'mockmemcache.php' => 1, | |
| 'tariochphealbundle.php' => 1, | |
| 'userpolicy.php' => 1, | |
| 'tariocheveapifetcherbundle.php' => 1, | |
| 'upstartmonitorbundle.php' => 1, | |
| 'upstartbundle.php' => 1, | |
| 'dockerfile.py' => 1, | |
| 'test-runner.php' => 1, | |
| 'torm.php' => 1, | |
| 'delayedmail.php' => 1, | |
| 'solrfacade.php' => 1, | |
| 'solrconnectionfactory.php' => 1, | |
| 'solrconnection.php' => 1, | |
| 'taprontoformfilterbundle.php' => 1, | |
| 'filterformservice.php' => 1, | |
| 'formulate.php' => 1, | |
| 'tfoxpangalinkbundle.php' => 1, | |
| 'workchatclient.php' => 1, | |
| 'rqlbundle.php' => 1, | |
| 'gan_tokenizer.php' => 1, | |
| 'leoorestbundle.php' => 1, | |
| 'teaandcodeapibundle.php' => 1, | |
| 'vertere' => 1, | |
| 'rml' => 1, | |
| 'agpl-3.0' => 1, | |
| 'example_torrent_creator.php' => 1, | |
| 'example_seeder.php' => 1, | |
| 'example_announce.php' => 1, | |
| 'license.gplv2' => 1, | |
| 'license.asl20' => 1, | |
| 'pxgif.php' => 1, | |
| 'pquery.php' => 1, | |
| 'gan_xml2array.php' => 1, | |
| 'gan_selector_html.php' => 1, | |
| 'class-page-layouts.php' => 1, | |
| 'gan_parser_html.php' => 1, | |
| 'gan_node_html.php' => 1, | |
| 'gan_formatter.php' => 1, | |
| 'iquery.php' => 1, | |
| 'server-conf.php' => 1, | |
| 'oandawrapreference.html' => 1, | |
| 'oandawraplicense' => 1, | |
| 'oandawrap.php' => 1, | |
| 'taviisqsjobqueuebundle.php' => 1, | |
| 'sqsjobqueueevents.php' => 1, | |
| 'sutra.kdev4' => 1, | |
| 'flourish-alternatives' => 1, | |
| 'field-groups.php' => 1, | |
| 'class-post-layouts.php' => 1, | |
| 'tempojsconfigurationbundle.php' => 1, | |
| 'samplev2.php' => 1, | |
| 'catchthelia1url.php' => 1, | |
| 'topribbonmenu.css' => 1, | |
| 'underscore.png' => 1, | |
| 'jquery-1.7.2.min.js' => 1, | |
| 'loading.gif' => 1, | |
| 'fileuploader.js' => 1, | |
| 'fileuploader.css' => 1, | |
| 'static_highlight.js' => 1, | |
| 'scrollable-page.html' => 1, | |
| 'kitchen-sink.html' => 1, | |
| 'kitchen-sink-req.html' => 1, | |
| 'druplash.module' => 1, | |
| 'druplash.info' => 1, | |
| 'messages.css' => 1, | |
| 'topribbonmenu.js' => 1, | |
| 'thecitystrategy.php' => 1, | |
| 'composer-mouf.lock' => 1, | |
| 'phpcliutil.class.php' => 1, | |
| 'phpcli.class.php' => 1, | |
| 'theapicctvblindfoldbundle.php' => 1, | |
| 'stepper.php' => 1, | |
| 'blindfold.php' => 1, | |
| 'lace' => 1, | |
| 'environment.json' => 1, | |
| '.travis,yml' => 1, | |
| 'jquery.percentageloader-0.1.js' => 1, | |
| 'jquery.percentageloader-0.1.css' => 1, | |
| 'multiple.html' => 1, | |
| 'index8.html' => 1, | |
| 'index7.html' => 1, | |
| 'composer-mouf.json' => 1, | |
| 'composer-mouf.sh' => 1, | |
| 'index5.html' => 1, | |
| 'adminsubdomain.php' => 1, | |
| 'canonicalurl.php' => 1, | |
| 'canadapost.php' => 1, | |
| 'cbfranfinance3x.php' => 1, | |
| 'brandproductdisplay.php' => 1, | |
| 'brandcarousel.php' => 1, | |
| 'bosearch.php' => 1, | |
| 'beanstreammodule.php' => 1, | |
| 'be2bill.php' => 1, | |
| 'backofficepath.php' => 1, | |
| 'backofficecss.php' => 1, | |
| 'responsecode.php' => 1, | |
| 'attributetype.php' => 1, | |
| 'atos.php' => 1, | |
| 'admincomment.php' => 1, | |
| 'git-commit-packages.sh' => 1, | |
| 'pdo.json.default' => 1, | |
| 'memcache.php.default' => 1, | |
| 'app.php.default' => 1, | |
| 'mongo.json.default' => 1, | |
| 'upload_cc.sh' => 1, | |
| 'documentation.zip' => 1, | |
| 'gruntfile' => 1, | |
| 'gruntfile.php' => 1, | |
| 'rediscache.php' => 1, | |
| 'php-travis.ini' => 1, | |
| 'cacheadmin.php' => 1, | |
| 'node-js.png' => 1, | |
| 'install_screen.php' => 1, | |
| 'git-recursive.sh' => 1, | |
| 'index6.html' => 1, | |
| 'index4.html' => 1, | |
| 'tenelevengeolocatorbundle.php' => 1, | |
| 'modulelanguageredirect.php' => 1, | |
| 'mpforms.php' => 1, | |
| 'formmpformpageswitch.php' => 1, | |
| 'mailusername.php' => 1, | |
| 'leadsexport.php' => 1, | |
| 'leads.php' => 1, | |
| 'inserttags.php' => 1, | |
| 'formstylify.php' => 1, | |
| 'easythemes.php' => 1, | |
| 'checkboxchooseatleastone.php' => 1, | |
| 'formcountryselectmenu.php' => 1, | |
| 'formconditionalselectmenu.php' => 1, | |
| 'conditionalselectmenu.php' => 1, | |
| 'conditionalformfields.php' => 1, | |
| 'modulechangelanguage.php' => 1, | |
| 'newslanguage.php' => 1, | |
| 'changelanguage.php' => 1, | |
| 'ceaccess.php' => 1, | |
| 'namespaceclassloader.php' => 1, | |
| 'wiringpiphp.iml' => 1, | |
| 'nagios_check_nagixx' => 1, | |
| 'paginator.html.twig' => 1, | |
| 'dev-auth.php-sample' => 1, | |
| 'autoloader-dev.php' => 1, | |
| 'sitemap-glue.php.sample' => 1, | |
| 'ten24cmspagesbundle.php' => 1, | |
| 'blockdiag.php' => 1, | |
| 'rpc.php' => 1, | |
| 'btc_address_validator.php' => 1, | |
| 'mpformsformmanager.php' => 1, | |
| 'modulebackgroundimage.php' => 1, | |
| 'index3.html' => 1, | |
| 'youtrackticket.php' => 1, | |
| 'index2.html' => 1, | |
| 'wizard-list-place.html' => 1, | |
| 'wizard-list-boat.html' => 1, | |
| 'jquery.creditcardvalidator.js' => 1, | |
| 'cards.png' => 1, | |
| 'xiseasyformsbundle.php' => 1, | |
| 'hampezurbinkbundle.php' => 1, | |
| 'vendor.yml' => 1, | |
| 'lyrisapi.php' => 1, | |
| 'tgaforumbundle.php' => 1, | |
| 'tgaopengraphbundle.php' => 1, | |
| 'textpack' => 1, | |
| 'textmagic-cli.php' => 1, | |
| 'youtrackticket.body.php' => 1, | |
| 'modulepageimage.php' => 1, | |
| 'piwik_tracking_api.php' => 1, | |
| 'piwiktracker.php' => 1, | |
| 'tetranzselect2entitybundle.php' => 1, | |
| 'option-parser' => 1, | |
| 'option-parameter' => 1, | |
| 'bloggerblogbundle.php' => 1, | |
| 'fotogrid.php' => 1, | |
| 'commentsbundle.php' => 1, | |
| 'doctrinestackbundle.php' => 1, | |
| 'terramarsalesbundle.php' => 1, | |
| 'terramarcustomerbundle.php' => 1, | |
| 'modulealias.php' => 1, | |
| 'tablelookupwizard.php' => 1, | |
| 'pageimage.php' => 1, | |
| 'aiswisudabundle.php' => 1, | |
| 'vmcvisitbundle.php' => 1, | |
| 'alicache.php' => 1, | |
| 'precis.php' => 1, | |
| 'fnc.php' => 1, | |
| 'pecserkeyamlfixturesbundle.php' => 1, | |
| 'pecserketwigdoctrineloaderbundle.php' => 1, | |
| 'oauth.py' => 1, | |
| 'o1auth.php' => 1, | |
| 'moreoauth.php' => 1, | |
| 'index4.php' => 1, | |
| 'hello.py' => 1, | |
| 'flaskoauth.py' => 1, | |
| 'auth.py' => 1, | |
| 'valueexpression.php' => 1, | |
| 'dynamicactiverecord.php' => 1, | |
| 'dynamicactivequery.php' => 1, | |
| 'casefolddatatrait.php' => 1, | |
| 'debug-performance.css' => 1, | |
| 'casefold.php' => 1, | |
| 'bididatatrait.php' => 1, | |
| 'bidi.php' => 1, | |
| 'labeler.php' => 1, | |
| 'labeler' => 1, | |
| 'liver' => 1, | |
| 'test_login.php' => 1, | |
| 'abc.php' => 1, | |
| 'test_patterns.php' => 1, | |
| 'test_login_html_auto.php' => 1, | |
| 'test_login_html.php' => 1, | |
| 'test_login3.php' => 1, | |
| 'test_login2.php' => 1, | |
| 'conceptitorientdbbundle.php' => 1, | |
| 'debug-performance.js' => 1, | |
| 'ebi.phar' => 1, | |
| 'tiga' => 1, | |
| 'superglue.php' => 1, | |
| 'fm-demo2.png' => 1, | |
| 'fm-demo.png' => 1, | |
| 'demo_temp_for_laravel.blade.php' => 1, | |
| 'view.xml' => 1, | |
| 'tooffftoolsforcrudbundle.php' => 1, | |
| 'toofffsessionbundle.php' => 1, | |
| 'toofffformsbundle.php' => 1, | |
| 'ovethesaurusbundle.php' => 1, | |
| 'oveproceduresbundle.php' => 1, | |
| 'oveauthentificationbundle.php' => 1, | |
| 'tiga.php' => 1, | |
| 'tiga-command.php' => 1, | |
| 'threescalebundle.php' => 1, | |
| 'diffdir.php' => 1, | |
| 'biodb_body.php' => 1, | |
| 'biodb.php' => 1, | |
| 'semanticdataimport.php' => 1, | |
| 'semanticdataimport.i18n.php' => 1, | |
| 'pdflib.php' => 1, | |
| 'pdflibexception.php' => 1, | |
| 'dscountdownasset.php' => 1, | |
| 'dscountdown.php' => 1, | |
| 'arkulpasymfonyextensionsbundle.php' => 1, | |
| 'arkulpacontactformbundle.php' => 1, | |
| 'ruleset-for-tests.xml' => 1, | |
| 'ruleset-for-contexts.xml' => 1, | |
| 'tommygnrdatatablesbundle.php' => 1, | |
| 'create-composer-json.php' => 1, | |
| 'test_login1.php' => 1, | |
| 'toin0udigitaloceanbundle.php' => 1, | |
| 'create_migration.php' => 1, | |
| 'maczukinappversionbundle.php' => 1, | |
| 'couscous.phar' => 1, | |
| 'phpunit_stdlib.xml' => 1, | |
| 'phpunit_mvc.xml' => 1, | |
| 'phpunit_di.xml' => 1, | |
| 'module_documents' => 1, | |
| 'documents' => 1, | |
| 'test11' => 1, | |
| 123 => 1, | |
| 'access.log' => 1, | |
| 'tmcycyitmapbundle.php' => 1, | |
| 'themer-logo' => 1, | |
| 'enttestfile.php' => 1, | |
| 'algorithm' => 1, | |
| 'smtpmailer.php' => 1, | |
| 'tmwkcpaneluapibundle.php' => 1, | |
| 'oauth2china.php' => 1, | |
| 'sybase.php' => 1, | |
| 'tkuskauserevents.php' => 1, | |
| 'tkuskauserbundle.php' => 1, | |
| 'tkuskaribbonbundle.php' => 1, | |
| 'tkuskageneratorbundle.php' => 1, | |
| 'widgetprovider.php' => 1, | |
| 'tkuskadashboardbundle.php' => 1, | |
| 'refreshtabaction.php' => 1, | |
| 'dwzxheditorasset.php' => 1, | |
| 'dwzuploadifyasset.php' => 1, | |
| 'dwzprintasset.php' => 1, | |
| 'dwzcoreasset.php' => 1, | |
| 'ebfacebookbundle.php' => 1, | |
| 'naokihanzawa.php' => 1, | |
| 'toiinecouchbasebundle.php' => 1, | |
| 'skeleton.html.php' => 1, | |
| 'samples.html' => 1, | |
| 'toguuserbundle.php' => 1, | |
| 'togutemplatebundle.php' => 1, | |
| 'toguengine.php' => 1, | |
| 'toguserializationbundle.php' => 1, | |
| 'togumediabundle.php' => 1, | |
| 'togugeneratorbundle.php' => 1, | |
| 'togufrontendbundle.php' => 1, | |
| 'toguapplicationmodelsbundle.php' => 1, | |
| 'toguannotationbundle.php' => 1, | |
| 'toguadminbundle.php' => 1, | |
| 'toffiakurlshortenerbundle.php' => 1, | |
| 'skeleton.json.php' => 1, | |
| 'sitemap.xslt.php' => 1, | |
| 'email.class.php' => 1, | |
| 'tjmstandardeditionbundle.php' => 1, | |
| 'pprint_r.php' => 1, | |
| 'symfony2_env_vars' => 1, | |
| 'phpunit.bootstrapless.xml.dist' => 1, | |
| 'boris-loader.php' => 1, | |
| 'tobiassjostenthetvdbbundle.php' => 1, | |
| 'ascoraformatter.php' => 1, | |
| 'toavalidatorbundle.php' => 1, | |
| 'toatwitterbootstrapbundle.php' => 1, | |
| 'toaframeworkextrabundle.php' => 1, | |
| 'toalayoutbundle.php' => 1, | |
| 'toabowerbundle.php' => 1, | |
| 'toaasseticbundle.php' => 1, | |
| 'toaapcbundle.php' => 1, | |
| 'color_terminal.php' => 1, | |
| 'update_database.php' => 1, | |
| 'gaunt.php' => 1, | |
| 'my-sites-search.js' => 1, | |
| 'vhost.conf.dist' => 1, | |
| 'autocompletion.php' => 1, | |
| '.env.docker.dist' => 1, | |
| 'jslogasset.php' => 1, | |
| 'arrayinputasset.php' => 1, | |
| 'arrayinput.php' => 1, | |
| 'aceeditor.php' => 1, | |
| 'capayable-client-php.sublime-project' => 1, | |
| 'myposeobundle.php' => 1, | |
| 'tristanbeselophantbundle.php' => 1, | |
| 'environment.php.dist' => 1, | |
| 'apiclientbundle.php' => 1, | |
| 'my-sites-search.php' => 1, | |
| 'my-sites-search.css' => 1, | |
| 'cerberus.mysql.sql' => 1, | |
| 'class-tp-taxonomy-terms.php' => 1, | |
| 'class-tp-post-type-posts.php' => 1, | |
| 'class-tp-widget-customizable.php' => 1, | |
| 'tw-sliders.php' => 1, | |
| 'class-tp-term-taxonomy-meta.php' => 1, | |
| 'class-tp-term-image.php' => 1, | |
| 'class-tp-term-description-editor.php' => 1, | |
| 'class-tp-tabs.php' => 1, | |
| 'class-tp-static-widget.php' => 1, | |
| 'class-tp-smtp.php' => 1, | |
| 'class-tp-related.php' => 1, | |
| 'class-tp-redirects.php' => 1, | |
| 'recurring-widgets.php' => 1, | |
| 'vhost.conf.docker.dist' => 1, | |
| 'cerberus.pgsql.sql' => 1, | |
| 'class-tp-post-type-archive-settings.php' => 1, | |
| 'tinymce.min.js' => 1, | |
| 'pingdom-rum.php' => 1, | |
| 'img-pingdom-logo.png' => 1, | |
| 'tuisessionbundle.php' => 1, | |
| 'tuhaokuai.php' => 1, | |
| 'rssreader.php' => 1, | |
| 'flagicon.php' => 1, | |
| 'uniqifier.php' => 1, | |
| 'bementioned' => 1, | |
| 'filebundle.php' => 1, | |
| 'update-1.1' => 1, | |
| 'tssbehatbuilderbundle.php' => 1, | |
| 'sculpinrelatedpostsbundle.php' => 1, | |
| 'relatedpostsgenerator.php' => 1, | |
| 'jquery.tinymce.min.js' => 1, | |
| 'clear.sql' => 1, | |
| 'cachedrivers.php.ini' => 1, | |
| 'asciimath.php' => 1, | |
| 'pkpass.php' => 1, | |
| 'trustly.php' => 1, | |
| 'ezcontentdecoratorbundle.php' => 1, | |
| 'trsteelhtmlformvalidationbundle.php' => 1, | |
| 'preloader.i18n.php' => 1, | |
| 'trovitcronmanagerbundle.php' => 1, | |
| 'doxyfile.in' => 1, | |
| 'gitnotes' => 1, | |
| 'mssqlbundle.php' => 1, | |
| 'httpwebrequest.php' => 1, | |
| 'sethost.php' => 1, | |
| 'composer54.json' => 1, | |
| 'class-tp-post-type-order.php' => 1, | |
| 'class-tp-opening-hours.php' => 1, | |
| 'future.json' => 1, | |
| 'privmsg.php' => 1, | |
| 'tpeigneadminbundle.php' => 1, | |
| 'activate' => 1, | |
| 'switcheryasset.php' => 1, | |
| 'switchery.php' => 1, | |
| 'fineuploaderjqueryasset.php' => 1, | |
| 'toukiftpbundle.php' => 1, | |
| 'index.csv' => 1, | |
| 'imageinspector' => 1, | |
| 'tzandertestbundle.php' => 1, | |
| 'tzblogbundle.php' => 1, | |
| 'pagefactory.iml' => 1, | |
| 'terms.php' => 1, | |
| 'styleguide.php' => 1, | |
| 'opensearch_desc_bt.xml' => 1, | |
| 'sitemapmodule.php' => 1, | |
| 'opensearch_desc.xml' => 1, | |
| 'modcp.php' => 1, | |
| 'group_edit.php' => 1, | |
| 'dl_list.php' => 1, | |
| 'dl.php' => 1, | |
| 'callseed.php' => 1, | |
| 'movefile.sample' => 1, | |
| 'uorm.lib.php' => 1, | |
| 'udb.php' => 1, | |
| 'mysqli-log.php' => 1, | |
| 'error-log.php' => 1, | |
| 'trtswiftcssinlinerbundle.php' => 1, | |
| 'trtasynctasksbundle.php' => 1, | |
| 'imagick.php' => 1, | |
| 'cmars.php' => 1, | |
| 'class-tp-opening-hours-widget.php' => 1, | |
| 'class-tp-debug.php' => 1, | |
| 'class-tp-opening-hours-special.php' => 1, | |
| 'class-tp-opening-hours-periods.php' => 1, | |
| 'class-tp-opening-hours-frontend.php' => 1, | |
| 'class-tp-opening-hours-day.php' => 1, | |
| 'class-tp-opening-hours-admin.php' => 1, | |
| 'multisite-labels.php' => 1, | |
| 'class-tp-multiple-thumbnails.php' => 1, | |
| 'multiple-content-blocks.php' => 1, | |
| 'class-tp-global-content-blocks.php' => 1, | |
| 'class-tp-events.php' => 1, | |
| 'class-tp-editor-capabilities.php' => 1, | |
| 'class-tp-dev-uploads.php' => 1, | |
| 'class-tp-dev-mail.php' => 1, | |
| 'credits.php' => 1, | |
| 'aliexpress.php' => 1, | |
| 'class-tp-contact-information.php' => 1, | |
| 'auto-update.php' => 1, | |
| 'trend404bundle.php' => 1, | |
| 'install_composer.sh' => 1, | |
| 'tweaks.patch' => 1, | |
| 'autoload.patch' => 1, | |
| 'pmd.xml' => 1, | |
| 'amkfile' => 1, | |
| '.ctags' => 1, | |
| '.empty' => 1, | |
| 'translationexchange.php' => 1, | |
| 'transferbundle.php' => 1, | |
| 'nikoladevanabookappbundle.php' => 1, | |
| 'cache-main.php' => 1, | |
| 'dwzasset.php' => 1, | |
| 'example.nginx.conf' => 1, | |
| 'phpab.bat' => 1, | |
| 'iron.json' => 1, | |
| 'formhandler.php' => 1, | |
| 'bpost.php' => 1, | |
| 'bpack247.php' => 1, | |
| 'dropbox.php' => 1, | |
| 'dbfact.php' => 1, | |
| 'ciscospa500.php' => 1, | |
| 'activecollab.php' => 1, | |
| 'translator.tpl.php' => 1, | |
| 'testfilter.php' => 1, | |
| 'lsoftadbundle.php' => 1, | |
| 'jigsaw' => 1, | |
| 'doctrinegeneratemodelsbundle.php' => 1, | |
| 'tigefa.jquery.json' => 1, | |
| 'tideways.php' => 1, | |
| 'shm-deep-integration-v3.xsd' => 1, | |
| 'tickitcachebundle.php' => 1, | |
| 'riak.php' => 1, | |
| 'php-doxyfile' => 1, | |
| 'testapi.php' => 1, | |
| 'freemobile.crt' => 1, | |
| 'freemobilenotificationsender.php' => 1, | |
| 'select2buttonasset.php' => 1, | |
| 'select2button.php' => 1, | |
| 'isloadingasset.php' => 1, | |
| 'isloadingajaxstatusasset.php' => 1, | |
| 'isloading.php' => 1, | |
| 'json2dto' => 1, | |
| 'triplepointphpunitsofmeasurebundle.php' => 1, | |
| 'geo6.php' => 1, | |
| 'log.todo' => 1, | |
| 'mapping.yaml' => 1, | |
| 'noderpcclient.php' => 1, | |
| 'booty.php' => 1, | |
| 'booty.i18n.php' => 1, | |
| 'booty.extension.php' => 1, | |
| 'booty.class.php' => 1, | |
| 'tester' => 1, | |
| 'u.php' => 1, | |
| 'elementoptionsplugin.php' => 1, | |
| 'rpcserverbundle.php' => 1, | |
| 'rpcserver.php' => 1, | |
| 'rpcproxy.php' => 1, | |
| 'rpcclientbundle.php' => 1, | |
| 'rpcclient.php' => 1, | |
| 'nodeserverbundle.php' => 1, | |
| 'nodeclientbundle.php' => 1, | |
| 'phonebook.mwb' => 1, | |
| 'nodeclient.php' => 1, | |
| 'geonamesbundle.php' => 1, | |
| 'geonames.php' => 1, | |
| 'querybuilder.png' => 1, | |
| 'devcon.jpg' => 1, | |
| 'varnishbundle.php' => 1, | |
| 'epicoftimewastedcryptobundle.php' => 1, | |
| 'timepadapi.php' => 1, | |
| 'stripeoauth2client.class.php' => 1, | |
| 'stripeoauth.class.php' => 1, | |
| 'raorocrmtimelapbundle.php' => 1, | |
| 'travis-codeclimate-report.sh' => 1, | |
| 'redis-cache.php' => 1, | |
| 'taskpaper.todo' => 1, | |
| 'sharepointapi.php' => 1, | |
| 'hinter.php' => 1, | |
| 'skinny.i18n.magic.php' => 1, | |
| 'rtti.php' => 1, | |
| 'newscoopmeteobluepluginbundle.php' => 1, | |
| 'newscoopdonationspluginbundle.php' => 1, | |
| 'inewstickerasset.php' => 1, | |
| 'thingdom.php' => 1, | |
| 'galdiboletobundle.php' => 1, | |
| 'thibaudtwittertwigextensionbundle.php' => 1, | |
| 'zenviamodule.php' => 1, | |
| 'apicomponent.php' => 1, | |
| 'skelgen' => 1, | |
| 'ppp.sublime-workspace' => 1, | |
| 'uploadutil.php' => 1, | |
| 'strutil.php' => 1, | |
| 'requestparser.php' => 1, | |
| 'paramutil.php' => 1, | |
| 'newscooptwitterpluginbundle.php' => 1, | |
| 'objectcreator.php' => 1, | |
| 'jsoninvoker.php' => 1, | |
| 'httpsender.php' => 1, | |
| 'classcreator.php' => 1, | |
| 'castutil.php' => 1, | |
| 'arrayutil.php' => 1, | |
| 'thewellcomcontactbundle.php' => 1, | |
| 'pirum-license' => 1, | |
| 'slim' => 1, | |
| 'phpdox.bat' => 1, | |
| 'phpdox' => 1, | |
| 'fdomdocument.spec' => 1, | |
| 'phpab.php' => 1, | |
| 'newscoopsmartyextensionspluginbundle.php' => 1, | |
| 'installing' => 1, | |
| 'helper.overframe.php' => 1, | |
| 'execute' => 1, | |
| 'config.overframe.php' => 1, | |
| 'statreportasset.php' => 1, | |
| 'statreport.php' => 1, | |
| 'series.php' => 1, | |
| 'fixedheaderasset.php' => 1, | |
| 'datatablesresponsiveasset.php' => 1, | |
| 'datatablesgridview.php' => 1, | |
| 'dataseries.php' => 1, | |
| 'thracemediabundle.php' => 1, | |
| 'thraceformbundle.php' => 1, | |
| 'thracedatagridbundle.php' => 1, | |
| 'thracecomponentbundle.php' => 1, | |
| 'execute.bat' => 1, | |
| 'booting.yml' => 1, | |
| 'apigeneratorbundle.php' => 1, | |
| 'thormeiertransportclientbundle.php' => 1, | |
| 'thormeierbreadcrumbbundle.php' => 1, | |
| 'thormeiermobiledetectlightbundle.php' => 1, | |
| 'twimultidomainlocalebundle.php' => 1, | |
| 'laravel-composer' => 1, | |
| 'bsd-3-clause-license' => 1, | |
| 'redpilllinprosimplereportsbundle.php' => 1, | |
| 'bisonlabsakonninbundle.php' => 1, | |
| 'bisonlabcommonbundle.php' => 1, | |
| 'querybuilderrepositorygeneratorbundle.php' => 1, | |
| 'jsonannotationbundle.php' => 1, | |
| 'tcreference_1.php' => 1, | |
| 'getsetforeignnormalizerbundle.php' => 1, | |
| 'doctrinerelationvisualizerbundle.php' => 1, | |
| 'skinny.class.php' => 1, | |
| 'skinny.i18n.php' => 1, | |
| 'tjvmollieidealbundle.php' => 1, | |
| 'file.hh' => 1, | |
| 'localeroute.hh' => 1, | |
| 'group.hh' => 1, | |
| 'filter.hh' => 1, | |
| 'callbackroute.hh' => 1, | |
| 'output.hh' => 1, | |
| 'middleware.hh' => 1, | |
| 'kernel.hh' => 1, | |
| 'input.hh' => 1, | |
| 'application.hh' => 1, | |
| 'abstractkernel.hh' => 1, | |
| 'writer.hh' => 1, | |
| 'node.hh' => 1, | |
| 'folder.hh' => 1, | |
| 'bundle.hh' => 1, | |
| 'route.hh' => 1, | |
| 'translator.hh' => 1, | |
| 'routeresolver.hh' => 1, | |
| 'pluralrule.hh' => 1, | |
| 'messageloader.hh' => 1, | |
| 'messagebundle.hh' => 1, | |
| 'localeregistry.hh' => 1, | |
| 'localebundle.hh' => 1, | |
| 'locale.hh' => 1, | |
| 'catalog.hh' => 1, | |
| 'outgoingresponseaware.hh' => 1, | |
| 'outgoingresponse.hh' => 1, | |
| 'mime.hh' => 1, | |
| 'message.hh' => 1, | |
| 'matcher.hh' => 1, | |
| 'router.hh' => 1, | |
| 'incomingrequest.hh' => 1, | |
| 'abstractvalidator.hh' => 1, | |
| 'test.selector.php' => 1, | |
| 'selector.inc' => 1, | |
| 'view.hh' => 1, | |
| 'template.hh' => 1, | |
| 'locator.hh' => 1, | |
| 'helper.hh' => 1, | |
| 'engineview.hh' => 1, | |
| 'engine.hh' => 1, | |
| 'abstractview.hh' => 1, | |
| 'validator.hh' => 1, | |
| 'corevalidator.hh' => 1, | |
| 'constraintprovider.hh' => 1, | |
| 'constraint.hh' => 1, | |
| 'validate.hh' => 1, | |
| 'urlbuilder.hh' => 1, | |
| 'time.hh' => 1, | |
| 'str.hh' => 1, | |
| 'sanitize.hh' => 1, | |
| 'path.hh' => 1, | |
| 'number.hh' => 1, | |
| 'inflect.hh' => 1, | |
| 'format.hh' => 1, | |
| 'config.hh' => 1, | |
| 'col.hh' => 1, | |
| 'xml.hh' => 1, | |
| 'stringbuffer.hh' => 1, | |
| 'objectcollection.hh' => 1, | |
| 'hashmap.hh' => 1, | |
| 'arraylist.hh' => 1, | |
| 'incomingrequestaware.hh' => 1, | |
| 'http.hh' => 1, | |
| 'skinny.php' => 1, | |
| 'zorbusadminthemebundle.php' => 1, | |
| 'arrayable.hh' => 1, | |
| 'storageaware.hh' => 1, | |
| 'storage.hh' => 1, | |
| 'missitem.hh' => 1, | |
| 'item.hh' => 1, | |
| 'hititem.hh' => 1, | |
| 'cache.hh' => 1, | |
| 'wiresannotations.hh' => 1, | |
| 'wireable.hh' => 1, | |
| 'annotation.hh' => 1, | |
| 'zorbususerthemebundle.php' => 1, | |
| 'zorbuspagebundle.php' => 1, | |
| 'zorbusblockbundle.php' => 1, | |
| 'zorbuslinkedinbundle.php' => 1, | |
| 'cacheable.hh' => 1, | |
| 'syncuptest.sh' => 1, | |
| 'syncup.sh' => 1, | |
| 'not_rsync_up' => 1, | |
| '_deletepreviewfiles.php' => 1, | |
| 'webbotcheccker.php' => 1, | |
| 'tipimail.php' => 1, | |
| 'wikiseo.php' => 1, | |
| 'wikiseo.i18n.php' => 1, | |
| 'wikiseo.i18n.magic.php' => 1, | |
| 'wikiseo.body.php' => 1, | |
| 'skinny.template.php' => 1, | |
| 'skinny.slim.php' => 1, | |
| 'skinny.skin.php' => 1, | |
| 'bag.hh' => 1, | |
| 'jsonable.hh' => 1, | |
| 'cookie.hh' => 1, | |
| 'mcryptcipher.hh' => 1, | |
| 'subject.hh' => 1, | |
| 'observer.hh' => 1, | |
| 'listener.hh' => 1, | |
| 'event.hh' => 1, | |
| 'emitter.hh' => 1, | |
| 'emitsevents.hh' => 1, | |
| 'loader.hh' => 1, | |
| 'detector.hh' => 1, | |
| 'logger.hh' => 1, | |
| 'dumper.hh' => 1, | |
| 'debugger.hh' => 1, | |
| 'benchmark.hh' => 1, | |
| 'opensslcipher.hh' => 1, | |
| 'cipher.hh' => 1, | |
| 'macroable.hh' => 1, | |
| 'abstractcipher.hh' => 1, | |
| 'errorcontroller.hh' => 1, | |
| 'controller.hh' => 1, | |
| 'action.hh' => 1, | |
| 'abstractcontroller.hh' => 1, | |
| 'serviceprovider.hh' => 1, | |
| 'depository.hh' => 1, | |
| 'definition.hh' => 1, | |
| 'xmlable.hh' => 1, | |
| 'vectorable.hh' => 1, | |
| 'stringable.hh' => 1, | |
| 'staticcacheable.hh' => 1, | |
| 'mutable.hh' => 1, | |
| 'mapable.hh' => 1, | |
| 'alicacheserver.php' => 1, | |
| 'example.mdb' => 1, | |
| 'netsuite application developer license agreement' => 1, | |
| 'homonoia.php' => 1, | |
| 'staffimdtobundle.php' => 1, | |
| 'attachmentbuilder.php' => 1, | |
| 'stadlineexecutioncachebundle.php' => 1, | |
| 'stadlinejsextensionbundle.php' => 1, | |
| 'glog_util.php' => 1, | |
| 'stackinstancemailerbundle.php' => 1, | |
| 'xhprof.inc.php' => 1, | |
| 'yandexmetrika.php' => 1, | |
| 'metrikabase.php' => 1, | |
| 'metrika.php' => 1, | |
| 'ssonecmsbundle.php' => 1, | |
| 'talos.php' => 1, | |
| 'hygieia.php' => 1, | |
| 'hestia.php' => 1, | |
| 'staffimsplunkbundle.php' => 1, | |
| 'cache-manager.php' => 1, | |
| 'autoload.example.php' => 1, | |
| 'spjsonrpc.php' => 1, | |
| 'proxy.example.ini' => 1, | |
| 'test_converter.php' => 1, | |
| 'converter.class.php' => 1, | |
| 'apidoc.xml.dist' => 1, | |
| 'ceca.php' => 1, | |
| 'firebirdmigration.php' => 1, | |
| 'activeresponseasset.php' => 1, | |
| 'activeresponse.php' => 1, | |
| 'wp-cli-composer-command.php' => 1, | |
| 'no-wpmu.php' => 1, | |
| 'staffimdatetimebundle.php' => 1, | |
| 'staffimtimestampablebundle.php' => 1, | |
| 'socialshareevents.php' => 1, | |
| 'starkerxpcqrsesbundle.php' => 1, | |
| 'rebase.sh' => 1, | |
| 'deluntrackedbranch.sh' => 1, | |
| 'deltag.sh' => 1, | |
| 'addtag.sh' => 1, | |
| 'devbundle.php' => 1, | |
| 'contactbundle.php' => 1, | |
| 'spraedpdfgeneratorbundle.php' => 1, | |
| 'buildapidocs.sh' => 1, | |
| 'apcprofilerbundle.php' => 1, | |
| 'nyx.json.dist' => 1, | |
| 'dbmysql.php' => 1, | |
| 'startplatzwordpressintegrationbundle.php' => 1, | |
| 'soundex.php' => 1, | |
| 'wp-commonmark.php' => 1, | |
| 'cfvalidator.php' => 1, | |
| 'solero.php' => 1, | |
| 'wp-deep-links.php' => 1, | |
| 'deeplinks.php' => 1, | |
| 'lemonrestbundle.php' => 1, | |
| 'lemonreportbundle.php' => 1, | |
| 'lemoncrudbundle.php' => 1, | |
| 'lemonbootstrapbundle.php' => 1, | |
| 'lemonappbundle.php' => 1, | |
| 'sms-factory.uml' => 1, | |
| 'searcher.uml' => 1, | |
| 'sf-code.class.php' => 1, | |
| 'stampery.inc.php' => 1, | |
| 'license.zf' => 1, | |
| 'cfvalidatorasset.php' => 1, | |
| 'lockdown-wp-admin.php' => 1, | |
| 'srozeiosocialsharebundle.php' => 1, | |
| 'status.sh' => 1, | |
| 'spiritdevcihubpostbundle.php' => 1, | |
| 'osteo.yml' => 1, | |
| 'tokenmanagerbundle.php' => 1, | |
| 'sncapiloggerbundle.php' => 1, | |
| 'apiauthenticator.php' => 1, | |
| 'abstractfixtureloadbundle.php' => 1, | |
| 'abstractfixtureload.php' => 1, | |
| 'sample.png' => 1, | |
| 'mono.png' => 1, | |
| 'everyblock-php-api.php' => 1, | |
| 'class-querystring.php' => 1, | |
| 'spiritdevoauth2clientbundle.php' => 1, | |
| 'spiritdevoauth2serverbundle.php' => 1, | |
| 'spiritdevcihubprebundle.php' => 1, | |
| 'spiritdevcihubcorebundle.php' => 1, | |
| 'spress.php' => 1, | |
| 'spiritdevbugreporterbundle.php' => 1, | |
| 'spiral.bat' => 1, | |
| 'spiral' => 1, | |
| 'spiraapplication.php' => 1, | |
| 'urlentry.php' => 1, | |
| 'generator' => 1, | |
| 'filterbuilder.php' => 1, | |
| 'spiiicyflightstatsbundle.php' => 1, | |
| 'application.config.php.dist' => 1, | |
| 'license_vendor' => 1, | |
| 'future.php' => 1, | |
| 'apidockert.php' => 1, | |
| 's4atimeagobundle.php' => 1, | |
| 'sprainvalidatorbundle.php' => 1, | |
| 'cerb5_webapi.php' => 1, | |
| 'sriorestuploadbundle.php' => 1, | |
| 'websocket_server.php' => 1, | |
| 'processcollection.php' => 1, | |
| 'namedchainprocessinterface.php' => 1, | |
| 'dependentchainprocessinterface.php' => 1, | |
| 'decoratorfactoryinterface.php' => 1, | |
| 'decoratorfactory.php' => 1, | |
| 'chainrunner.php' => 1, | |
| 'chainprocessinterface.php' => 1, | |
| 'chainprocessdecorator.php' => 1, | |
| 'chaincontext.php' => 1, | |
| 'chainbuilder.php' => 1, | |
| 'arraychaincontext.php' => 1, | |
| 'jquery.easypaginate.js' => 1, | |
| 'easypaginate.jquery.json' => 1, | |
| 'websocket_client.html' => 1, | |
| 'cachemanagerinterface.php' => 1, | |
| 'basicoauth.php' => 1, | |
| 'docusign.php' => 1, | |
| 'bookmark.php' => 1, | |
| 'spyritpropeldatagridbundle.php' => 1, | |
| 'spyritpropelcrudgeneratorbundle.php' => 1, | |
| 'tabcollapsex.php' => 1, | |
| 'tabcollapseasset.php' => 1, | |
| 'tabcollapse.php' => 1, | |
| 'collapsebehavior.php' => 1, | |
| 'sputnikpubsubbundle.php' => 1, | |
| 'pubsubevents.php' => 1, | |
| 'sputniknewsletterbundle.php' => 1, | |
| 'batchsubscriberinterface.php' => 1, | |
| 'sputnikcachebundle.php' => 1, | |
| 'renamebranch.sh' => 1, | |
| 'proxybundle.php' => 1, | |
| 'sunrise-scenarios.sh' => 1, | |
| 'stocarultwitterbundle.php' => 1, | |
| 'elasticbundle.php' => 1, | |
| 'pff2.iml' => 1, | |
| 'run_phpunit.sh' => 1, | |
| 'run_phpmd.sh' => 1, | |
| 'pre_commit.sh' => 1, | |
| 'init-pgsql.sql' => 1, | |
| 'init-mysql.sql' => 1, | |
| 'doctrine-bootstrap.php' => 1, | |
| 'config-testing.php' => 1, | |
| 'ckeditor.css' => 1, | |
| 'addventurectl.php' => 1, | |
| 'xlabpchartbundle.php' => 1, | |
| 'stocarulurbanairshipbundle.php' => 1, | |
| 'pitechpdodblibbundle.php' => 1, | |
| 'key.p12.enc' => 1, | |
| 'stocarulfacebookbundle.php' => 1, | |
| 'stnwdatepickerbundle.php' => 1, | |
| 'avatarbundle.php' => 1, | |
| 'flipclock.php' => 1, | |
| 'excuseme.php' => 1, | |
| 'simusanteuserwidgetbundle.php' => 1, | |
| 'cpasimusantesimutoolsbundle.php' => 1, | |
| 'cpasimusantesimuresourcebundle.php' => 1, | |
| 'cpasimusanteghangoutbundle.php' => 1, | |
| 'simusantepfcbundle.php' => 1, | |
| 'charcoal.inc.php' => 1, | |
| 'ditto.sublime-project' => 1, | |
| 'phpunit.unit.xml' => 1, | |
| 'issue' => 1, | |
| 'tech' => 1, | |
| 'bootstrap.integration.php' => 1, | |
| 'wp-term-colors.php' => 1, | |
| 'soapaction.php' => 1, | |
| 'paynl.php' => 1, | |
| 'icepay.php' => 1, | |
| 'servecontroller.php' => 1, | |
| 'changyanwidget.php' => 1, | |
| 'stz184captchabundle.php' => 1, | |
| 'wp-user-profiles.php' => 1, | |
| 'wp-user-groups.php' => 1, | |
| 'wp-user-avatars.php' => 1, | |
| 'wp-user-activity.php' => 1, | |
| 'wp-term-visibility.php' => 1, | |
| 'wp-term-meta.php' => 1, | |
| 'wp-term-families.php' => 1, | |
| 'wp-spider-cache.php' => 1, | |
| '.git_workflow.ini' => 1, | |
| 'wp-post-publish-ays.php' => 1, | |
| 'wpmn-loader.php' => 1, | |
| 'wp-event-calendar.php' => 1, | |
| 'wp-comment-humility.php' => 1, | |
| 'wp-article-order.php' => 1, | |
| 'studiositeapiclientgeneratorbundle.php' => 1, | |
| 'conventer.php' => 1, | |
| 'studioartlansyngbundle.php' => 1, | |
| 'demo_auth.php' => 1, | |
| 'strsocialsmsqueuebundle.php' => 1, | |
| 'stormssonmultifetchbundle.php' => 1, | |
| 'clientside.php' => 1, | |
| 'deploy-key.enc' => 1, | |
| 'sagextras.php' => 1, | |
| 'bootstrap.unit.php' => 1, | |
| 'pui.php' => 1, | |
| 'blockprefixtrait.php' => 1, | |
| 'ssh2bundle.php' => 1, | |
| 'contentdivider.php' => 1, | |
| 'advent' => 1, | |
| 'cloudflare' => 1, | |
| 'zebra_curl.php' => 1, | |
| 'zebra_session.php' => 1, | |
| 'zebra_pagination.php' => 1, | |
| 'zebra_mptt.php' => 1, | |
| 'zebra_image.php' => 1, | |
| 'mimes.json' => 1, | |
| 'zebra_form.php' => 1, | |
| 'zebra_database.php' => 1, | |
| 'sbpushbulletbundle.php' => 1, | |
| 'versionsbundle.php' => 1, | |
| 'shortcutsbundle.php' => 1, | |
| 'facecommanderbundle.php' => 1, | |
| 'scripts.sh' => 1, | |
| 'schema.sh' => 1, | |
| 'pull.sh' => 1, | |
| 'doctrinemigrations.sh' => 1, | |
| 'doctrinecache.sh' => 1, | |
| 'dirs.sh' => 1, | |
| 'csfixer.sh' => 1, | |
| 'composerupdate.sh' => 1, | |
| 'composerinstall.sh' => 1, | |
| 'cache.sh' => 1, | |
| 'assetsinstall.sh' => 1, | |
| 'asseticdump.sh' => 1, | |
| 'nametrait.php' => 1, | |
| 'mangojsonapibundle.php' => 1, | |
| 'modeltrait.php' => 1, | |
| 'pdb.php' => 1, | |
| 'changelog.config.php' => 1, | |
| 'stfalconportfoliobundle.php' => 1, | |
| 'stfalconpaymentbundle.php' => 1, | |
| 'stfalconpagebundle.php' => 1, | |
| 'stfalconnewsbundle.php' => 1, | |
| 'cron.conf' => 1, | |
| 'stfalconshippingbundle.php' => 1, | |
| 'stfalconabtestbundle.php' => 1, | |
| 'stewejsi18nbundle.php' => 1, | |
| 'stevninjainvoicebundle.php' => 1, | |
| 'stevlistafirmebundle.php' => 1, | |
| 'stevgeonamesbundle.php' => 1, | |
| 'footestcase.php' => 1, | |
| 'barsuite.xml' => 1, | |
| 'process_aweber.php' => 1, | |
| 'class-php-ico.php' => 1, | |
| 'aweberclass.php' => 1, | |
| 'api-guide' => 1, | |
| 'menubrowser.php' => 1, | |
| 'phpcs.xml.sample' => 1, | |
| 'phpcs-vip.xml.sample' => 1, | |
| 'inventory-banner.jpg' => 1, | |
| 'calendar-helper-banner.jpg' => 1, | |
| 'sladbookingbundle.php' => 1, | |
| 'mustang.engine' => 1, | |
| 'mustache.engine' => 1, | |
| 'handlebars.engine' => 1, | |
| 'forecast' => 1, | |
| 'newpassword' => 1, | |
| 'laravelmodelbehavior.php' => 1, | |
| '.gitattributes.layout' => 1, | |
| 'unusedcode.xml' => 1, | |
| 'francium.log' => 1, | |
| 'sesshin' => 1, | |
| 'soerenmartiuswishlistbundle.php' => 1, | |
| 'digitalshiftmailboxpersistencebundle.php' => 1, | |
| 'digitalshiftmailboxformbundle.php' => 1, | |
| 'digitalshiftmailboxconnectionbundle.php' => 1, | |
| 'date_time_picker-v5.php' => 1, | |
| 'date_time_picker-v4.php' => 1, | |
| 'date_time_picker-v3.php' => 1, | |
| 'acf-date_time_picker.php' => 1, | |
| 'jupiter' => 1, | |
| 'requirements-test' => 1, | |
| 'parallel-phpunit' => 1, | |
| 'exelreaderinterface.php' => 1, | |
| 'exel.php' => 1, | |
| 'hybridauthcomponent.php' => 1, | |
| 'duallistboxasset.php' => 1, | |
| 'left-pad.php' => 1, | |
| 'receive.php' => 1, | |
| 'config.xsd' => 1, | |
| 'snowcapyamlfixturesbundle.php' => 1, | |
| 'snowcapogonebundle.php' => 1, | |
| 'ogonemanager.php' => 1, | |
| 'ogoneevents.php' => 1, | |
| 'snowcapimbundle.php' => 1, | |
| 'snowcapi18nbundle.php' => 1, | |
| 'snowcapelasticabundle.php' => 1, | |
| 'snowcapcorebundle.php' => 1, | |
| 'snowcapcachebundle.php' => 1, | |
| 'snowcapbootstrapbundle.php' => 1, | |
| 'creole.php' => 1, | |
| 'sample-code' => 1, | |
| 'whoops.php' => 1, | |
| 'soilnotificationbundle.php' => 1, | |
| 'solilokiamsummernotebundle.php' => 1, | |
| 'httprediscache.php' => 1, | |
| 'installerwrapper.php' => 1, | |
| 'disable-comments-mu.php' => 1, | |
| 'solano.yml' => 1, | |
| 'solano-phpunit' => 1, | |
| 'bare-composer.json' => 1, | |
| 'bare-readme' => 1, | |
| 'soilusertrackbundle.php' => 1, | |
| 'soilsmserbundle.php' => 1, | |
| 'soilrdfpersistencebundle.php' => 1, | |
| 'soilqueuehttpendpointbundle.php' => 1, | |
| 'soilonsitenotificationbundle.php' => 1, | |
| 'soileventbundle.php' => 1, | |
| 'captchaasset.php' => 1, | |
| 'soildiscoverbundle.php' => 1, | |
| 'soilcorsrequesthandlerbundle.php' => 1, | |
| 'soilcommentsdigestbundle.php' => 1, | |
| 'soilackservicebundle.php' => 1, | |
| 'eloquent-command.php' => 1, | |
| 'softlogouserbundle.php' => 1, | |
| 'softlogoshopbundle.php' => 1, | |
| 'softlogoproductbundle.php' => 1, | |
| 'softlogoportfoliobundle.php' => 1, | |
| 'softlogonewsbundle.php' => 1, | |
| 'softlogocustomerbundle.php' => 1, | |
| 'softlogocmsbundle.php' => 1, | |
| 'softflygeneratorbundle.php' => 1, | |
| 'seto-mini.ttf' => 1, | |
| 'snowcapadminbundle.php' => 1, | |
| 'twig.class.php' => 1, | |
| 'moneta-api.ini' => 1, | |
| 'deliverer.php' => 1, | |
| 'cache-faculty-journal-menus.sql' => 1, | |
| 'enrollment-info-ui-tweaks.js' => 1, | |
| 'embedded-documentation.js' => 1, | |
| 'discussion-permalinks.js' => 1, | |
| 'show-rubrics.php' => 1, | |
| 'cache-rubrics.php' => 1, | |
| 'cache-and-show-rubrics.js' => 1, | |
| 'bookmarklet.php' => 1, | |
| 'bookmarklet.js' => 1, | |
| 'auto-open-feedback.js' => 1, | |
| 'wpup' => 1, | |
| 'intro.gif' => 1, | |
| 'smsupapibundle.php' => 1, | |
| 'smoyaomniatabundle.php' => 1, | |
| 'smcanvaslib' => 1, | |
| 'makerlabspagerbundle.php' => 1, | |
| 'smoyacustomchoicebundle.php' => 1, | |
| 'smoyaassetmanagementbundle.php' => 1, | |
| 'gnu-gpl' => 1, | |
| 'installcheck.php' => 1, | |
| 'aplbundle.php' => 1, | |
| 'smith981securitybundle.php' => 1, | |
| 'smith981newsboxbundle.php' => 1, | |
| 'smith981crudgeneratorbundle.php' => 1, | |
| 'smiriktaggablebundle.php' => 1, | |
| 'smirikpropelserializerbundle.php' => 1, | |
| 'smirikpropeladminbundle.php' => 1, | |
| 'smirikconfigbundle.php' => 1, | |
| 'faculty-journal.php' => 1, | |
| 'student-loader.php' => 1, | |
| 'monolog.php' => 1, | |
| 'oauthnegotiator.php' => 1, | |
| 'hookagent.php' => 1, | |
| 'dotarrayfilter.php' => 1, | |
| 'cyberappuploaderbundle.php' => 1, | |
| 'cyberapptreechoicebundle.php' => 1, | |
| 'cyberappselect2bundle.php' => 1, | |
| 'twofactorforeveryone.png' => 1, | |
| 'snapcmsmodule.php' => 1, | |
| 'microphp.php' => 1, | |
| 'microphp.min.php' => 1, | |
| 'cloud-zoom.js' => 1, | |
| 'cloud-zoom.css' => 1, | |
| 'smurfyasseticcssbundleimagesbundle.php' => 1, | |
| 'asaayerscrowdbundle.php' => 1, | |
| 'templates.js.php' => 1, | |
| 'canvas-custom-prefs.sql' => 1, | |
| 'templates-schema.sql' => 1, | |
| 'templates-loader.js' => 1, | |
| 'template-copy.php' => 1, | |
| 'assignments api.csv' => 1, | |
| 'color-schedule.js.php' => 1, | |
| 'color-schedule.css.php' => 1, | |
| 'stmarks-branding.css' => 1, | |
| 'organize-user-enrollments.css' => 1, | |
| 'lock-notifications.js.php' => 1, | |
| 'lock-notifications.css' => 1, | |
| 'navigation-menu.js.php' => 1, | |
| 'navbar.css' => 1, | |
| 'menu-loader.js' => 1, | |
| 'click.php' => 1, | |
| 'solispauwelsthemespackbundle.php' => 1, | |
| 'meme.phar' => 1, | |
| 'naming.xml' => 1, | |
| 'echo-js-lazy-load.php' => 1, | |
| 'writer.sql' => 1, | |
| 'commentswidget.php' => 1, | |
| 'spamjs_book.iml' => 1, | |
| 'project_structure' => 1, | |
| 'package_structure' => 1, | |
| 'libraries' => 1, | |
| 'isjs' => 1, | |
| 'foojs' => 1, | |
| 'definejs' => 1, | |
| 'glossary' => 1, | |
| 'super-simple-events.php' => 1, | |
| 'simple-google-news-sitemap.php' => 1, | |
| 'wpcom-helper.php' => 1, | |
| 'disable-xml-rpc-fully.php' => 1, | |
| 'http-status-check' => 1, | |
| 'custom-post-type-rss-feed.php' => 1, | |
| 'built-in-taxos-cpt.php' => 1, | |
| 'advanced-nav-cache.php' => 1, | |
| 'repairtags.php' => 1, | |
| 'soyukaseedbundle.php' => 1, | |
| 'phpsemver.xml' => 1, | |
| 'docker-compose-dev.yml' => 1, | |
| 'svntime.php' => 1, | |
| 'revisions.csv' => 1, | |
| 'months.csv' => 1, | |
| 'example.bat' => 1, | |
| 'cleaned_blocks.csv' => 1, | |
| 'blocks.csv' => 1, | |
| 'php7to5' => 1, | |
| 'ssl-certificate-chain-resolver' => 1, | |
| 'html2text.php' => 1, | |
| 'htmlpurifier.safe-includes.php' => 1, | |
| 'design.xml' => 1, | |
| 'controversial.xml' => 1, | |
| 'codesize.xml' => 1, | |
| 'cleancode.xml' => 1, | |
| 'composer-package-update-checker.php' => 1, | |
| 'composer-package-update-checker' => 1, | |
| 'composerupdatechecker.php' => 1, | |
| 'painfreereleases' => 1, | |
| 'gitpolicy' => 1, | |
| 'analyser' => 1, | |
| '.gitpolicy.yml' => 1, | |
| 'transipclient.php' => 1, | |
| 'wideimage.php' => 1, | |
| 'htmlpurifier.path.php' => 1, | |
| 'specgenstateworkflowspecgenbundle.php' => 1, | |
| 'htmlpurifier.kses.php' => 1, | |
| 'htmlpurifier.includes.php' => 1, | |
| 'htmlpurifier.func.php' => 1, | |
| 'htmlpurifier.composer.php' => 1, | |
| 'htmlpurifier.autoload.php' => 1, | |
| 'htmlpurifier.auto.php' => 1, | |
| 'polymerasset.php' => 1, | |
| 'headerpanel.php' => 1, | |
| 'static.tpl' => 1, | |
| 'login.tpl' => 1, | |
| 'header.tpl' => 1, | |
| 'footer.tpl' => 1, | |
| 'component.tpl' => 1, | |
| 'project.kwi' => 1, | |
| 'spritify.php' => 1, | |
| 'global_defines.sample.php' => 1, | |
| 'pvp_api.php' => 1, | |
| 'sonatradoctrineextensionsbundle.php' => 1, | |
| 'sonatrasessionbundle.php' => 1, | |
| 'sonatrasecuritybundle.php' => 1, | |
| 'reachableroleevents.php' => 1, | |
| 'organizationaltypes.php' => 1, | |
| 'identityretrievalevents.php' => 1, | |
| 'aclmanipulatorevents.php' => 1, | |
| 'sonatraresourcebundle.php' => 1, | |
| 'resourcestatutes.php' => 1, | |
| 'resourceliststatutes.php' => 1, | |
| 'sonatramailerbundle.php' => 1, | |
| 'mailtypes.php' => 1, | |
| 'sonatragluonbundle.php' => 1, | |
| 'sonatraformextensionsbundle.php' => 1, | |
| 'sonatradoctrineconsolebundle.php' => 1, | |
| 'spoolemailstatus.php' => 1, | |
| 'sonatradefaultvaluebundle.php' => 1, | |
| 'sonatrabootstrapbundle.php' => 1, | |
| 'sonatrablockbundle.php' => 1, | |
| 'sonatraajaxbundle.php' => 1, | |
| 'ajaxevents.php' => 1, | |
| 'missingscmplugin.php' => 1, | |
| 'sonatajquerybundle.php' => 1, | |
| 'sonatatranslationbundle.php' => 1, | |
| 'sonatapropeladminbundle.php' => 1, | |
| 'sonatamarkitupbundle.php' => 1, | |
| 'sonataintlbundle.php' => 1, | |
| 'sonataeasyextendsbundle.php' => 1, | |
| 'sonataadminsearchbundle.php' => 1, | |
| 'sonatraswiftmailerdoctrinebundle.php' => 1, | |
| 'sntoolboxbundle.php' => 1, | |
| 'fs_directory.php' => 1, | |
| 'sopinetsimplepointbundle.php' => 1, | |
| 'fs_dialplan.php' => 1, | |
| 'fs_curl.php' => 1, | |
| 'fs_configuration.php' => 1, | |
| 'fs_chatplan.php' => 1, | |
| 'fs_cdr.php' => 1, | |
| 'dialplan_importer.php' => 1, | |
| 'sopinetchatbundle.php' => 1, | |
| 'sopinetuserbundle.php' => 1, | |
| 'sopinetuserpreferencesbundle.php' => 1, | |
| 'sopinetusernotificationsbundle.php' => 1, | |
| 'sopinetuploadmagicbundle.php' => 1, | |
| 'sopinettimelinebundle.php' => 1, | |
| 'sopinettemplatesbadmin2bundle.php' => 1, | |
| 'sopinetlogbundle.php' => 1, | |
| 'regionutils.php' => 1, | |
| 'help.es' => 1, | |
| 'sopinetflashmessagesbundle.php' => 1, | |
| 'sopinetcolorizebundle.php' => 1, | |
| 'sopinetbootstrapextendbundle.php~' => 1, | |
| 'sopinetbootstrapextendbundle.php' => 1, | |
| 'sopinetautologinbundle.php' => 1, | |
| 'sopinetaboutmagicbundle.php' => 1, | |
| 'sopinetuploadfilesbundle.php' => 1, | |
| 'sopinetgcmbundle.php' => 1, | |
| 'gcmevents.php' => 1, | |
| 'sopinetapihelperbundle.php' => 1, | |
| 'sopinetadminbundle.php' => 1, | |
| 'improverangevalidator.php' => 1, | |
| 'regionvalidator.php' => 1, | |
| 'soapservice.php' => 1, | |
| 'class.logsys.php' => 1, | |
| 'phpaccess.php' => 1, | |
| 'propertyaccessextractorinterface.php' => 1, | |
| 'csrftokenmanager.php' => 1, | |
| 'authenticationevents.php' => 1, | |
| 'securitybundle.php' => 1, | |
| 'routecollectionbuilder.php' => 1, | |
| 'requestcontextawareinterface.php' => 1, | |
| 'compiledroute.php' => 1, | |
| 'httpmessagefactoryinterface.php' => 1, | |
| 'httpfoundationfactoryinterface.php' => 1, | |
| 'propertytypeextractorinterface.php' => 1, | |
| 'propertylistextractorinterface.php' => 1, | |
| 'propertyinfoextractorinterface.php' => 1, | |
| 'propertyinfoextractor.php' => 1, | |
| 'propertydescriptionextractorinterface.php' => 1, | |
| 'propertypathiteratorinterface.php' => 1, | |
| 'abstractguardauthenticator.php' => 1, | |
| 'propertypathiterator.php' => 1, | |
| 'propertypathinterface.php' => 1, | |
| 'propertypathbuilder.php' => 1, | |
| 'propertypath.php' => 1, | |
| 'propertyaccessorinterface.php' => 1, | |
| 'propertyaccessorbuilder.php' => 1, | |
| 'processutils.php' => 1, | |
| 'processbuilder.php' => 1, | |
| 'phpprocess.php' => 1, | |
| 'phpexecutablefinder.php' => 1, | |
| 'inputstream.php' => 1, | |
| 'executablefinder.php' => 1, | |
| 'binaryonfuncoverload.php' => 1, | |
| 'csrftokenmanagerinterface.php' => 1, | |
| 'guardauthenticatorhandler.php' => 1, | |
| 'php70.php' => 1, | |
| 'templatenameparser.php' => 1, | |
| 'appvariable.php' => 1, | |
| 'translatorbaginterface.php' => 1, | |
| 'pluralizationrules.php' => 1, | |
| 'metadataawareinterface.php' => 1, | |
| 'messageselector.php' => 1, | |
| 'messagecatalogueinterface.php' => 1, | |
| 'messagecatalogue.php' => 1, | |
| 'loggingtranslator.php' => 1, | |
| 'identitytranslator.php' => 1, | |
| 'datacollectortranslator.php' => 1, | |
| 'templatereferenceinterface.php' => 1, | |
| 'templatereference.php' => 1, | |
| 'templatenameparserinterface.php' => 1, | |
| 'streamingengineinterface.php' => 1, | |
| 'guardauthenticatorinterface.php' => 1, | |
| 'phpengine.php' => 1, | |
| 'delegatingengine.php' => 1, | |
| '.travis.php' => 1, | |
| 'stopwatchperiod.php' => 1, | |
| 'stopwatchevent.php' => 1, | |
| 'stopwatch.php' => 1, | |
| 'section.php' => 1, | |
| 'serializerawaretrait.php' => 1, | |
| 'securityevents.php' => 1, | |
| 'parameterbagutils.php' => 1, | |
| 'firewallmapinterface.php' => 1, | |
| 'firewallmap.php' => 1, | |
| 'accessmapinterface.php' => 1, | |
| 'accessmap.php' => 1, | |
| 'binarynofuncoverload.php' => 1, | |
| 'php56.php' => 1, | |
| 'constraint.php' => 1, | |
| 'formrendererinterface.php' => 1, | |
| 'reversedtransformer.php' => 1, | |
| 'resolvedformtypeinterface.php' => 1, | |
| 'resolvedformtypefactoryinterface.php' => 1, | |
| 'resolvedformtypefactory.php' => 1, | |
| 'resolvedformtype.php' => 1, | |
| 'requesthandlerinterface.php' => 1, | |
| 'preloadedextension.php' => 1, | |
| 'nativerequesthandler.php' => 1, | |
| 'formview.php' => 1, | |
| 'formtypeinterface.php' => 1, | |
| 'formtypeguesserinterface.php' => 1, | |
| 'formtypeguesserchain.php' => 1, | |
| 'formtypeextensioninterface.php' => 1, | |
| 'formrendererengineinterface.php' => 1, | |
| 'submitbuttonbuilder.php' => 1, | |
| 'formrenderer.php' => 1, | |
| 'formregistryinterface.php' => 1, | |
| 'formregistry.php' => 1, | |
| 'formfactoryinterface.php' => 1, | |
| 'formfactorybuilderinterface.php' => 1, | |
| 'formfactorybuilder.php' => 1, | |
| 'formfactory.php' => 1, | |
| 'formextensioninterface.php' => 1, | |
| 'formevents.php' => 1, | |
| 'formerroriterator.php' => 1, | |
| 'formerror.php' => 1, | |
| 'formconfiginterface.php' => 1, | |
| 'formconfigbuilderinterface.php' => 1, | |
| 'submitbutton.php' => 1, | |
| 'submitbuttontypeinterface.php' => 1, | |
| 'php55arraycolumn.php' => 1, | |
| 'icudata.php' => 1, | |
| 'php55.php' => 1, | |
| 'php54.php' => 1, | |
| 'mbstring.php' => 1, | |
| 'grapheme.php' => 1, | |
| 'iconv.php' => 1, | |
| 'optionsresolver.php' => 1, | |
| 'notfoundactivationstrategy.php' => 1, | |
| 'monologbundle.php' => 1, | |
| 'ldapclientinterface.php' => 1, | |
| 'ldapclient.php' => 1, | |
| 'icuregionbundle.php' => 1, | |
| 'iculocalebundle.php' => 1, | |
| 'iculanguagebundle.php' => 1, | |
| 'icucurrencybundle.php' => 1, | |
| 'acceptheader.php' => 1, | |
| 'urisigner.php' => 1, | |
| 'terminableinterface.php' => 1, | |
| 'kernelinterface.php' => 1, | |
| 'serverbag.php' => 1, | |
| 'responseheaderbag.php' => 1, | |
| 'requeststack.php' => 1, | |
| 'requestmatcherinterface.php' => 1, | |
| 'requestmatcher.php' => 1, | |
| 'iputils.php' => 1, | |
| 'headerbag.php' => 1, | |
| 'expressionrequestmatcher.php' => 1, | |
| 'binaryfileresponse.php' => 1, | |
| 'apacherequest.php' => 1, | |
| 'acceptheaderitem.php' => 1, | |
| 'templateiterator.php' => 1, | |
| 'constraintvalidator.php' => 1, | |
| 'formbuilderinterface.php' => 1, | |
| 'tadckasitemapbundle.php' => 1, | |
| 'urls.sql' => 1, | |
| 'endiciaapi.php' => 1, | |
| 'tahoecrudbundle.php' => 1, | |
| 'tahoecredentialbundle.php' => 1, | |
| 'countries.json' => 1, | |
| 'out.php' => 1, | |
| 'outtest.php' => 1, | |
| 'tadckatreebundle.php' => 1, | |
| 'textinformation.php' => 1, | |
| 'tadckatextbundle.php' => 1, | |
| 'tadckageneratorbundle.php' => 1, | |
| 'modelmanagerinfo.php' => 1, | |
| 'tadckasitemapevents.php' => 1, | |
| 'tadckaroutingbundle.php' => 1, | |
| 'newscoopgithublatestcommitsbundle.php' => 1, | |
| 'tadckareporterbundle.php' => 1, | |
| 'tadckapaginatorbundle.php' => 1, | |
| 'tadckaobjectratingbundle.php' => 1, | |
| 'objectratinginfo.php' => 1, | |
| 'tadckanoticemanagerbundle.php' => 1, | |
| 'noticetype.php' => 1, | |
| 'tadckamapperbundle.php' => 1, | |
| 'tadckajstreebundle.php' => 1, | |
| 'filedownloader.php' => 1, | |
| 'tadckaattributesbundle.php' => 1, | |
| 'tadckaaddressbundle.php' => 1, | |
| 'psr-police' => 1, | |
| 'php-cs-fixer.pre-commit.php' => 1, | |
| 'takeitamphtmlbundle.php' => 1, | |
| 'newscoopcommunitytickerbundle.php' => 1, | |
| 'propelwebprofilerserviceprovider.php' => 1, | |
| 'automate.config' => 1, | |
| 'finzip.php' => 1, | |
| 'tconverter.class.php' => 1, | |
| 'routerintern.interface.php' => 1, | |
| 'routerintern.class.php' => 1, | |
| 'routerext.php' => 1, | |
| 'errors.class.php' => 1, | |
| 'client.json' => 1, | |
| 'model.interface.php' => 1, | |
| 'loadbase.php' => 1, | |
| 'controller.interface.php' => 1, | |
| 'controller.class.php' => 1, | |
| 'automate.php' => 1, | |
| 'automate.json' => 1, | |
| 'bdados.php' => 1, | |
| 'locks.log' => 1, | |
| 'bdadospdo.php' => 1, | |
| 'cs' => 1, | |
| 'tambur.php' => 1, | |
| 'weather.php' => 1, | |
| 'toby.php' => 1, | |
| 'rackem.php' => 1, | |
| 'tamagotipsmanagerbundle.php' => 1, | |
| 'tamagofeedrenderbundle.php' => 1, | |
| 'cccemailtemplatebundle.php' => 1, | |
| 'install_v8js' => 1, | |
| 'tab.php' => 1, | |
| 'materializecustomasset.php' => 1, | |
| 'fab.php' => 1, | |
| 'basewidgettrait.php' => 1, | |
| 'daydream.php' => 1, | |
| 'propellogger.php' => 1, | |
| 'constraintvalidatorfactoryinterface.php' => 1, | |
| 's2bcrawlerbundle.php' => 1, | |
| 'inputrange.php' => 1, | |
| 'syselevenpowerdnsbundle.php' => 1, | |
| 'mysqlmyisamdriver.php' => 1, | |
| 'syrmawebcontainerbundle.php' => 1, | |
| 'synoliafullcontactbundle.php' => 1, | |
| 'readonlybehavior.php' => 1, | |
| 'synatreeasset.php' => 1, | |
| 'dynamicrelations.php' => 1, | |
| 'synaqzasabundle.php' => 1, | |
| 'synaqcurlbundle.php' => 1, | |
| 'phpunit.shippable.xml' => 1, | |
| 'symtoockeditorbundle.php' => 1, | |
| 'acmesymfonyanbundle.php' => 1, | |
| 'admingeneratorformextensionsbundle.php' => 1, | |
| 'fullcalendarbundle.php' => 1, | |
| 'admingeneratorformbundle.php' => 1, | |
| 'check_cs' => 1, | |
| 'unescaper.php' => 1, | |
| 'inline.php' => 1, | |
| 'webprofilerbundle.php' => 1, | |
| 'validatorbuilderinterface.php' => 1, | |
| 'validatorbuilder.php' => 1, | |
| 'objectinitializerinterface.php' => 1, | |
| 'groupsequenceproviderinterface.php' => 1, | |
| 'constraintviolationlistinterface.php' => 1, | |
| 'constraintviolationlist.php' => 1, | |
| 'constraintviolationinterface.php' => 1, | |
| 'constraintvalidatorinterface.php' => 1, | |
| 'pagemediasetbundle.php' => 1, | |
| 'sessao.php' => 1, | |
| 'propeldatacollector.php' => 1, | |
| 'wunderliststrategy.php' => 1, | |
| 'docini' => 1, | |
| 'edmodostrategy.php' => 1, | |
| 'tabernicolajukeclouduserbundle.php' => 1, | |
| 'tabernicolajukecloudbundle.php' => 1, | |
| 'tabernicolajukecloudadminbundle.php' => 1, | |
| 'tabernicolablogbundle.php' => 1, | |
| 'ezreal-0.html' => 1, | |
| 'tabbi89commanderbundle.php' => 1, | |
| 'twigextrabundle.php' => 1, | |
| 'phpunit.xml.coverage' => 1, | |
| 'tpsolariumextensionsbundle.php' => 1, | |
| 't73biztranslocationbundle.php' => 1, | |
| 'changleog' => 1, | |
| 'wakatimestrategy.php' => 1, | |
| 'createtable.php' => 1, | |
| 'ultraregstrategy.php' => 1, | |
| 'trellostrategy.php' => 1, | |
| 'timelystrategy.php' => 1, | |
| 'slackstrategy.php' => 1, | |
| 'harveststrategy.php' => 1, | |
| 'frecklestrategy.php' => 1, | |
| 'dropboxstrategy.php' => 1, | |
| 'campaignmonitorstrategy.php' => 1, | |
| 'basecampstrategy.php' => 1, | |
| 'ignore.gitignore' => 1, | |
| 'entityexplorerbundle.php' => 1, | |
| 'szummediauploadbundle.php' => 1, | |
| 'szumadministrationpanelbundle.php' => 1, | |
| 'auto-login.php' => 1, | |
| 'formconfigbuilder.php' => 1, | |
| 'datatransformerinterface.php' => 1, | |
| 'tca.php' => 1, | |
| 'tagcloudall.php' => 1, | |
| 'keriodirectoryapi.php' => 1, | |
| 'keriocontrolapi.php' => 1, | |
| 'kerioconnectapi.php' => 1, | |
| 'superfeedr.php' => 1, | |
| 'curl_readme' => 1, | |
| 'debug-tests.sh' => 1, | |
| '.blackfire.yml' => 1, | |
| 'superreal.png' => 1, | |
| 'sunraturbosmsbundle.php' => 1, | |
| 'wishlistmember.php' => 1, | |
| 'widgetadvertisement.php' => 1, | |
| 'widgetadvertisement .ss' => 1, | |
| 'tagcloudall.ss' => 1, | |
| 'sidetext.png' => 1, | |
| 'kerioworkspaceapi.php' => 1, | |
| 'sidetextwidget.ss' => 1, | |
| 'sidetextwidget.php' => 1, | |
| 'richadvertisement.ss' => 1, | |
| 'richadvertisement.php' => 1, | |
| 'quote.ss' => 1, | |
| 'quote.php' => 1, | |
| 'quicklinks.ss' => 1, | |
| 'quicklinks.php' => 1, | |
| 'featuredvideowidget.ss' => 1, | |
| 'featuredvideowidget.php' => 1, | |
| 'latestpagesvisitedwidget.ss' => 1, | |
| 'latestpagesvisitedwidget.php' => 1, | |
| 'latestblogentries.ss' => 1, | |
| 'keriooperatorapi.php' => 1, | |
| 'samepageapi.php' => 1, | |
| 'headlines.ss' => 1, | |
| 'effect.js' => 1, | |
| 'ant-crc32.jar' => 1, | |
| 'ajaxfileuploadcomponent.php' => 1, | |
| 'graphqlbundle.php' => 1, | |
| 'graphql.php' => 1, | |
| 'uploadbutton.js' => 1, | |
| 'swf.js' => 1, | |
| 'storage.js' => 1, | |
| 'sound.js' => 1, | |
| 'sharedobject.js' => 1, | |
| 'sb.js' => 1, | |
| 'js1_5.js' => 1, | |
| 'ie6.js' => 1, | |
| 'flashgate.js' => 1, | |
| 'developer.js' => 1, | |
| 'supertaggearmanbundle.php' => 1, | |
| 'cookies.js' => 1, | |
| 'bookmarklets.js' => 1, | |
| 'uploadbutton.swf' => 1, | |
| 'surebert.swf' => 1, | |
| 'flashgate.swf' => 1, | |
| 'neostag.php' => 1, | |
| 'openssltools.php' => 1, | |
| 'can.php' => 1, | |
| 'aes.php' => 1, | |
| 'limp.php' => 1, | |
| 'shared_host_install' => 1, | |
| 'recurringsubscription.php' => 1, | |
| 'paypalrecurring.php' => 1, | |
| 'workload.php' => 1, | |
| 'latestblogentries.php' => 1, | |
| 'headlines.php' => 1, | |
| 'paginate.standalone.php' => 1, | |
| 'factr.php' => 1, | |
| 'mobiledetectbundle.php' => 1, | |
| 'suncatadminpageboardbundle.php' => 1, | |
| 'config.ini-dist' => 1, | |
| '.htaccess-dist' => 1, | |
| 'teamleader.php' => 1, | |
| 'sumoforkclass.php' => 1, | |
| 'sumocodersframeworkuserbundle.php' => 1, | |
| 'sumocodersframeworksettingsbundle.php' => 1, | |
| 'settingsmanager.php' => 1, | |
| 'sumocodersframeworksearchbundle.php' => 1, | |
| 'sumocodersframeworkexamplebundle.php' => 1, | |
| 'sumocodersframeworkerrorbundle.php' => 1, | |
| 'sumocodersframeworkcorebundle.php' => 1, | |
| '.phpbench.dist' => 1, | |
| 'applicationextra.php' => 1, | |
| 'suluroutebundle.php' => 1, | |
| 'suluqrcodebundle.php' => 1, | |
| 'sululdapbundle.php' => 1, | |
| 'suludeveloperbundle.php' => 1, | |
| 'phpffmpegbundle.php' => 1, | |
| 'gen_keys.php' => 1, | |
| 'encrypt_cls.php' => 1, | |
| 'encrypt.php' => 1, | |
| 'encoding2.php' => 1, | |
| 'encoding1.php' => 1, | |
| 'encoded.php' => 1, | |
| 'worker_script' => 1, | |
| 'supervisor-suitcoda.conf' => 1, | |
| 'weatherundergroundbundle.php' => 1, | |
| 'libravatar-replace.php' => 1, | |
| 'didyouknow.ss' => 1, | |
| 'zendaclserviceprovider.php' => 1, | |
| 'didyouknow.php' => 1, | |
| 'currencyconverterwidget.ss' => 1, | |
| 'currencyconverterwidget.php' => 1, | |
| 'childblogentries.ss' => 1, | |
| 'childblogentries.php' => 1, | |
| 'upgradesilverstripe.php' => 1, | |
| 'replacementdata.php' => 1, | |
| 'reset.sh' => 1, | |
| 'index.php.removethispartforwindows' => 1, | |
| '_ss_environment.php.example' => 1, | |
| 'upgradedocs' => 1, | |
| 'zendsessionserviceprovider.php' => 1, | |
| 'zendauthenticationserviceprovider.php' => 1, | |
| 'webprofilercontrollerprovider.php' => 1, | |
| '.vendor.png' => 1, | |
| 'restserviceprovider.php' => 1, | |
| 'restevents.php' => 1, | |
| 'restevent.php' => 1, | |
| 'ormserviceprovider.php' => 1, | |
| 'managerregistryserviceprovider.php' => 1, | |
| 'dbalserviceprovider.php' => 1, | |
| 'crudevents.php' => 1, | |
| 'crudevent.php' => 1, | |
| 'pimpleawareinterface.php' => 1, | |
| 'pimpleawareeventdispatcher.php' => 1, | |
| 'pimpleaware.php' => 1, | |
| 'phar-compiler.xsd' => 1, | |
| 'v.php' => 1, | |
| 'paginate.php' => 1, | |
| 'unnoyandexmapsbundle.php' => 1, | |
| 'block_helper.php' => 1, | |
| 'clickableinterface.php' => 1, | |
| 'metadatainterface.php' => 1, | |
| 'callbackslugifier.php' => 1, | |
| 'cmfsimplecmsbundle.php' => 1, | |
| 'suggestionproviderinterface.php' => 1, | |
| 'sitemapawareinterface.php' => 1, | |
| 'seoawaretrait.php' => 1, | |
| 'seoawareinterface.php' => 1, | |
| 'cmfseobundle.php' => 1, | |
| 'alternatelocaleproviderinterface.php' => 1, | |
| 'cmfsearchbundle.php' => 1, | |
| 'cmfroutingbundle.php' => 1, | |
| 'cmfroutingautobundle.php' => 1, | |
| 'quietfactory.php' => 1, | |
| 'cmfmenubundle.php' => 1, | |
| 'mediamanagerinterface.php' => 1, | |
| 'package_template.xml' => 1, | |
| 'hierarchyinterface.php' => 1, | |
| 'cmfmediabundle.php' => 1, | |
| 'binaryinterface.php' => 1, | |
| 'cmfcorebundle.php' => 1, | |
| 'cmfcontentbundle.php' => 1, | |
| 'jack' => 1, | |
| 'cmfblockbundle.php' => 1, | |
| 'symfonycmfroutingextrabundle.php' => 1, | |
| 'urigeneratorinterface.php' => 1, | |
| 'urigenerator.php' => 1, | |
| 'uricontextcollectionbuilder.php' => 1, | |
| 'uricontextcollection.php' => 1, | |
| 'uricontext.php' => 1, | |
| 'slugifierinterface.php' => 1, | |
| 'sl_si.csv' => 1, | |
| 'routingautoevents.php' => 1, | |
| 'bufferinglogger.php' => 1, | |
| 'callbacktransformer.php' => 1, | |
| 'buttontypeinterface.php' => 1, | |
| 'buttonbuilder.php' => 1, | |
| 'abstractrendererengine.php' => 1, | |
| 'lockhandler.php' => 1, | |
| 'immutableeventdispatcher.php' => 1, | |
| 'containerawareeventdispatcher.php' => 1, | |
| 'abstracturielement.php' => 1, | |
| 'containerawareeventmanager.php' => 1, | |
| 'taggedcontainerinterface.php' => 1, | |
| 'resettablecontainerinterface.php' => 1, | |
| 'expressionlanguageprovider.php' => 1, | |
| 'definitiondecorator.php' => 1, | |
| 'cssselectorconverter.php' => 1, | |
| 'post' => 1, | |
| 'consoleevents.php' => 1, | |
| 'resourcecheckerinterface.php' => 1, | |
| 'resourcecheckerconfigcachefactory.php' => 1, | |
| 'resourcecheckerconfigcache.php' => 1, | |
| 'filelocatorinterface.php' => 1, | |
| 'configcacheinterface.php' => 1, | |
| 'configcachefactoryinterface.php' => 1, | |
| 'configcachefactory.php' => 1, | |
| 'wincacheclassloader.php' => 1, | |
| 'doctrineprovider.php' => 1, | |
| 'urlpackage.php' => 1, | |
| 'pathpackage.php' => 1, | |
| 'packages.php' => 1, | |
| 'packageinterface.php' => 1, | |
| 'tokenproviderinterface.php' => 1, | |
| 'defunctroutehandlerinterface.php' => 1, | |
| 'vellozziurlshortenerbundle.php' => 1, | |
| 'yellowcube.install' => 1, | |
| 'syph' => 1, | |
| 'sycamorepostcodeanywherebundle.php' => 1, | |
| 'sycamorefreespeebundle.php' => 1, | |
| 'sycamorecarwebbundle.php' => 1, | |
| 'dropzoneassets.php' => 1, | |
| 'ecommerceassets.php' => 1, | |
| 'wechatshareaddr.php' => 1, | |
| 'swoopsterobjectmanagerbundle.php' => 1, | |
| 'gpl-2.0-license' => 1, | |
| 'yellowcube.rules_defaults.inc' => 1, | |
| 'yellowcube.rules.inc' => 1, | |
| 'yellowcube.module' => 1, | |
| 'yellowcube.jobs.inc' => 1, | |
| 'yellowcube.info' => 1, | |
| 'sdstripebundle.php' => 1, | |
| 'yellowcube.client.inc' => 1, | |
| 'neo4juserbundle.php' => 1, | |
| 'swismoonphasebundle.php' => 1, | |
| 'swisgoogleanalyticsbundle.php' => 1, | |
| 'swisdatabaseextrabundle.php' => 1, | |
| 'swisannotationextrabundle.php' => 1, | |
| 'curlerarray.php' => 1, | |
| 'license.mb' => 1, | |
| 'sweikenbredismqbundle.php' => 1, | |
| 'swarrotbundle.php' => 1, | |
| 'y.php' => 1, | |
| 'migrace.php' => 1, | |
| 'clanky' => 1, | |
| 'flosytwitterbundle.php' => 1, | |
| 'symboobootstrapbundle.php' => 1, | |
| 'conflictresolverinterface.php' => 1, | |
| 'chainrouterinterface.php' => 1, | |
| 'autoroutemanager.php' => 1, | |
| 'versatilegeneratorinterface.php' => 1, | |
| 'routereferrersreadinterface.php' => 1, | |
| 'routereferrersinterface.php' => 1, | |
| 'routeobjectinterface.php' => 1, | |
| 'redirectrouteinterface.php' => 1, | |
| 'providerbasedgenerator.php' => 1, | |
| 'pagedrouteproviderinterface.php' => 1, | |
| 'pagedroutecollection.php' => 1, | |
| 'lazyroutecollection.php' => 1, | |
| 'contentrepositoryinterface.php' => 1, | |
| 'contentawaregenerator.php' => 1, | |
| 'chainedrouterinterface.php' => 1, | |
| 'chainrouter.php' => 1, | |
| 'symeditblogbundle.php' => 1, | |
| 'chainroutecollection.php' => 1, | |
| 'cmfresourcerestbundle.php' => 1, | |
| 'cmfresourcebundle.php' => 1, | |
| 'repositoryregistryinterface.php' => 1, | |
| 'cmfcreatebundle.php' => 1, | |
| 'cmfblogbundle.php' => 1, | |
| 'symfoniansadminbundle.php' => 1, | |
| 'symeditwidgetbundle.php' => 1, | |
| 'symeditthemebundle.php' => 1, | |
| 'symeditsitemapbundle.php' => 1, | |
| 'symeditshortcodebundle.php' => 1, | |
| 'symeditmenubundle.php' => 1, | |
| 'symeditmediabundle.php' => 1, | |
| 'symediteventsbundle.php' => 1, | |
| 'pingdom.css' => 1, | |
| 'runbehat' => 1, | |
| 'smilingplantspagerbundle.php' => 1, | |
| 'bootstrapfakeasset.php' => 1, | |
| 'yamilovssypexgeobundle.php' => 1, | |
| 'yamikocacheadministrationbundle.php' => 1, | |
| 'yamikobasicpagesbundle.php' => 1, | |
| 'example2_object.php' => 1, | |
| 'example1_create.php' => 1, | |
| 'example0_intro.php' => 1, | |
| 'samples' => 1, | |
| 'config.json.example' => 1, | |
| 'googletagmanagerbundle.php' => 1, | |
| 'xynnnblacklistedemailvalidatorbundle.php' => 1, | |
| 'xxtea.php' => 1, | |
| 'pregfile.php' => 1, | |
| 'jsxs.php' => 1, | |
| 'minput.php' => 1, | |
| 'herosphpv2.0.chm' => 1, | |
| 'peter.php' => 1, | |
| 'qqvalidator.php' => 1, | |
| 'mobilevalidator.php' => 1, | |
| 'dialog.css' => 1, | |
| 'customasset.php' => 1, | |
| 'stflagiconcssbundle.php' => 1, | |
| 'rbac.sql' => 1, | |
| 'emoji.php' => 1, | |
| 'templateserviceprovider.php' => 1, | |
| 'uncleemptymaintenancebundle.php' => 1, | |
| 'update-modules.sh' => 1, | |
| 'tacticianmiddlewarebundle.php' => 1, | |
| 'aweapp.php' => 1, | |
| 'constants.enc.yamoney' => 1, | |
| 'bump_version.sh' => 1, | |
| 'xthiagoformextrabundle.php' => 1, | |
| 'lackeyfile.php' => 1, | |
| 'qtranslate_services.php' => 1, | |
| 'qtranslate_options.php' => 1, | |
| 'qtranslate_hooks.php' => 1, | |
| 'qtranslate_frontend.php' => 1, | |
| 'qtranslate_core.php' => 1, | |
| 'qtranslate_compatibility.php' => 1, | |
| 'qtranslate.php' => 1, | |
| 'i18n-config.json' => 1, | |
| 'multilingual-press.php' => 1, | |
| 'breadcrumbsnode.php' => 1, | |
| 'breadcrumbsbundle.php' => 1, | |
| 'breadcrumbsbuilder.php' => 1, | |
| 'txt.thanks' => 1, | |
| 'turkish.php' => 1, | |
| 'enumbundle.php' => 1, | |
| 'phpunit-local.xml' => 1, | |
| 'yasiekzrouterbundle.php' => 1, | |
| 'readme.pl' => 1, | |
| 'yasiekzformbundle.php' => 1, | |
| 'yasiekzvideojsbundle.php' => 1, | |
| 'milight.php' => 1, | |
| 'jquery.bt.min.js' => 1, | |
| 'jquery.bt.js' => 1, | |
| 'jquery.bt.css' => 1, | |
| 'yanyabosymfonybundle.php' => 1, | |
| 'edropzone.php' => 1, | |
| 'dependencyinjection.json' => 1, | |
| 'yokaiizanamibundle.php' => 1, | |
| 'izanamievents.php' => 1, | |
| 'imagemodule.php' => 1, | |
| 'screen1.jpg' => 1, | |
| 'qtranslate_widget.php' => 1, | |
| 'esperantoassetsbundle.php' => 1, | |
| 'esperantoshopbundle.php' => 1, | |
| 'esperantosettingbundle.php' => 1, | |
| 'esperantosearchbundle.php' => 1, | |
| 'esperantoreferencebundle.php' => 1, | |
| 'esperantoprojectbundle.php' => 1, | |
| 'esperantopagebundle.php' => 1, | |
| 'esperantonewsletterbundle.php' => 1, | |
| 'esperantonewsbundle.php' => 1, | |
| 'esperantomediabundle.php' => 1, | |
| 'esperantodownloadbundle.php' => 1, | |
| 'esperantocontentbundle.php' => 1, | |
| 'esperantocategorybundle.php' => 1, | |
| 'esperantocalendarbundle.php' => 1, | |
| 'esperantoadminbundle.php' => 1, | |
| 'esperantotestingbundle.php' => 1, | |
| 'octoguard.config.dist' => 1, | |
| 'gpg-mailgate.php' => 1, | |
| 'grumphp.sh' => 1, | |
| 'cs-fixer.sh' => 1, | |
| 'codecept.sh' => 1, | |
| 'tagbundle.php' => 1, | |
| 'xphereonetimeaccessbundle.php' => 1, | |
| 'test.xar' => 1, | |
| 'boot.pth' => 1, | |
| 'project.pth' => 1, | |
| 'integration.ini' => 1, | |
| 'mysqlcontroller.php' => 1, | |
| 'xolaelasticsearchproxybundle.php' => 1, | |
| 'esperantosliderbundle.php' => 1, | |
| 'esperantouserbundle.php' => 1, | |
| 'previewasset.php' => 1, | |
| 'producerchangesv1.patch' => 1, | |
| 'jquery.fullscreen.js' => 1, | |
| 'jquery.fullscreen.css' => 1, | |
| 'xsolveunitskelgenbundle.php' => 1, | |
| 'xsolvegoogleauthbundle.php' => 1, | |
| 'xsolvecookieacknowledgementbundle.php' => 1, | |
| 'wtw.phar' => 1, | |
| 'wtw-inline.phar' => 1, | |
| 'box-inline.json' => 1, | |
| 'shone.phar' => 1, | |
| 'xpress' => 1, | |
| 'license_lbp' => 1, | |
| 'svg-edit-2-6-patch-for-xrowsvg.diff' => 1, | |
| 'odata.ini' => 1, | |
| 'config.php.append' => 1, | |
| 'simplehtmldomnode.php' => 1, | |
| 'xrowmetadatabundle.php' => 1, | |
| 'anychart_eula.pdf' => 1, | |
| 'xrowgisbundle.php' => 1, | |
| 'xrowsyliusbundle.php' => 1, | |
| 'xrowrestbundle.php' => 1, | |
| 'xrowjbpmbundle.php' => 1, | |
| 'xrowfieldtypesbundle.php' => 1, | |
| 'xrowezobjectrelationlistplusbundle.php' => 1, | |
| 'xrowdownloadlibrarybundle.php' => 1, | |
| 'xrowbootstrapbundle.php' => 1, | |
| 'xrowgoogletagmanagerbundle.php' => 1, | |
| 'xrowtwitterimportbundle.php' => 1, | |
| 'xrowbundleezpublishtoolsbundle.php' => 1, | |
| 'xrowezpublishsolrdocsbundle.php' => 1, | |
| 'qtranslate_utils.php' => 1, | |
| 'content-chat.php' => 1, | |
| 'xoeorohelperbundle.php' => 1, | |
| 'eccvalidator.php' => 1, | |
| 'linkmanybehavior.php' => 1, | |
| 'transformfilebehavior.php' => 1, | |
| 'imagefilebehavior.php' => 1, | |
| 'eagerjointrait.php' => 1, | |
| 'eagerjoinquerytrait.php' => 1, | |
| 'templatestoragephp.php' => 1, | |
| 'templatestoragemongodb.php' => 1, | |
| 'templatestoragedb.php' => 1, | |
| 'templatestorageactiverecord.php' => 1, | |
| 'templatestorage.php' => 1, | |
| 'templatemodelfinder.php' => 1, | |
| 'activemessageevent.php' => 1, | |
| 'activemessage.php' => 1, | |
| 'timezoneaction.php' => 1, | |
| 'rolebehavior.php' => 1, | |
| 'selectize.php' => 1, | |
| 'pieasset.php' => 1, | |
| 'pie.php' => 1, | |
| 'linkpreviewasset.php' => 1, | |
| 'linkpreview.php' => 1, | |
| 'ionsliderasset.php' => 1, | |
| 'ionslider.php' => 1, | |
| 'imagecomponent.php' => 1, | |
| 'googlemapsasset.php' => 1, | |
| 'ftpwrapper.php' => 1, | |
| 'ftpclient.php' => 1, | |
| 'datasyncbehavior.php' => 1, | |
| 'commentasset.php' => 1, | |
| 'positionbehavior.php' => 1, | |
| 'variationbehavior.php' => 1, | |
| 'bxslider.php' => 1, | |
| 'filemanagerphp.php' => 1, | |
| 'dbtokenmanager.php' => 1, | |
| 'emongoquerybuilder.php' => 1, | |
| 'emongodbref.php' => 1, | |
| 'hauth.php' => 1, | |
| 'cepinput.php' => 1, | |
| 'cepasset.php' => 1, | |
| 'cepaction.php' => 1, | |
| 'ceivalidator.php' => 1, | |
| 'indexfile.php' => 1, | |
| 'basefile.php' => 1, | |
| 'localfileplaceholder.php' => 1, | |
| 'initcontroller.php' => 1, | |
| 'queryprocessor.php' => 1, | |
| 'filemanagerjson.php' => 1, | |
| 'authlogidentitybehavior.php' => 1, | |
| 'mapping.php' => 1, | |
| 'containertrait.php' => 1, | |
| 'storagephp.php' => 1, | |
| 'storagemongodb.php' => 1, | |
| 'storagedb.php' => 1, | |
| 'storageactiverecord.php' => 1, | |
| 'behaviortrait.php' => 1, | |
| 'managermongodb.php' => 1, | |
| 'managerdbtransaction.php' => 1, | |
| 'managerdb.php' => 1, | |
| 'managerdataserializetrait.php' => 1, | |
| 'manageractiverecord.php' => 1, | |
| 'authlogwebuserbehavior.php' => 1, | |
| 'authlogloginformbehavior.php' => 1, | |
| 'bxsliderasset.php' => 1, | |
| 'purifybehavior.php' => 1, | |
| 'content-status.php' => 1, | |
| 'database-repair.php' => 1, | |
| 'eavbehavior.php' => 1, | |
| 'yee.php' => 1, | |
| 'blockmodule.php' => 1, | |
| 'server.ini' => 1, | |
| 'wpuf.php' => 1, | |
| 'wpuf-functions.php' => 1, | |
| 'wp-pagenavi.php' => 1, | |
| 'pagenavi-css.css' => 1, | |
| 'wp-page-numbers.php' => 1, | |
| 'screenshot-1.gif' => 1, | |
| 'wp-dbmanager.pot' => 1, | |
| 'wp-dbmanager.php' => 1, | |
| 'database-run.php' => 1, | |
| 'database-optimize.php' => 1, | |
| 'eavquerytrait.php' => 1, | |
| 'database-manager.php' => 1, | |
| 'database-manage.php' => 1, | |
| 'database-empty.php' => 1, | |
| 'database-backup.php' => 1, | |
| 'authkey.sample.php' => 1, | |
| 'header.blade.php' => 1, | |
| 'footer.blade.php' => 1, | |
| 'content.blade.php' => 1, | |
| 'content-search.php' => 1, | |
| 'sidebar-content.php' => 1, | |
| 'featured-content.php' => 1, | |
| 'content-featured-post.php' => 1, | |
| 'sidebar-main.php' => 1, | |
| 'eavmodule.php' => 1, | |
| 'mediamodule.php' => 1, | |
| 'selenium-server-standalone-2.45.0.jar' => 1, | |
| 'ygfacebookbundle.php' => 1, | |
| 'robo.phar' => 1, | |
| 'breadcrumbsfilter.php' => 1, | |
| 'epdffactorydoc.php' => 1, | |
| 'epdffactory.php' => 1, | |
| 'multimodelform.php' => 1, | |
| 'scrolluppager.php' => 1, | |
| 'fileuploaderwidget.php' => 1, | |
| 'paymentcomponent.php' => 1, | |
| 'gatewayabstract.php' => 1, | |
| 'membershipinterface.php' => 1, | |
| 'membershipcomponent.php' => 1, | |
| 'webuploaderaction.php' => 1, | |
| 'markdown2htmlasset.php' => 1, | |
| 'idiorm.php.b0922d8719a94e3a0e0e4a0ca3876f4f91475dcf' => 1, | |
| 'pagemodule.php' => 1, | |
| '.yf_version' => 1, | |
| 'yetheedateformbundle.php' => 1, | |
| 'biplaneenumbundle.php' => 1, | |
| 'yitnotificationbundle.php' => 1, | |
| 'yithelpbundle.php' => 1, | |
| 'yitgeobridgebundle.php' => 1, | |
| 'yitpollbundle.php' => 1, | |
| 'yitmapbundle.php' => 1, | |
| 'yitadsbundle.php' => 1, | |
| 'lsnotificationbundle.php' => 1, | |
| 'avroextrabundle.php' => 1, | |
| 'tripmodule.php' => 1, | |
| 'translationmodule.php' => 1, | |
| 'settingsmodule.php' => 1, | |
| 'xoeoropicturecutbundle.php' => 1, | |
| 'xoeorobytehandbundle.php' => 1, | |
| 'mongodbtokenmanager.php' => 1, | |
| 'start-8020.sh' => 1, | |
| 'xabbuhlrsbundle.php' => 1, | |
| 'xabbuhdiconfigurationbundle.php' => 1, | |
| 'xaavqueuebundle.php' => 1, | |
| 'vanityurls.php' => 1, | |
| 'steamid.php' => 1, | |
| '.codeclimate.sh' => 1, | |
| 'view_serverping.php' => 1, | |
| 'ocicollections.php' => 1, | |
| 'stop-8021.sh' => 1, | |
| 'start-8021.sh' => 1, | |
| 'stop-8030.sh' => 1, | |
| 'stop-8020.sh' => 1, | |
| 'start-8030.sh' => 1, | |
| 'pssaasbundle.php' => 1, | |
| 'xabbuhxapiclientbundle.php' => 1, | |
| 'pspublicwriterbundle.php' => 1, | |
| 'pspublicreaderbundle.php' => 1, | |
| 'stop-8010.sh' => 1, | |
| 'start-8010.sh' => 1, | |
| 'start-8000.sh' => 1, | |
| 'cfddns.sample.yml' => 1, | |
| 'jswidget.php' => 1, | |
| 'iterable.php' => 1, | |
| 'functional.php' => 1, | |
| 'argplaceholder.php' => 1, | |
| 'xscanner.class.php' => 1, | |
| 'myscanner.class.php' => 1, | |
| 'millenniumpaginationbundle.php' => 1, | |
| 'xabbuhpandabundle.php' => 1, | |
| 'xabbuhcrapibundle.php' => 1, | |
| 'view-without-data.png' => 1, | |
| 'xv-planeta.php' => 1, | |
| 'employeeattadancemovement.note' => 1, | |
| 'phorms.php' => 1, | |
| 'build-pear.sh' => 1, | |
| 'slug_test.php' => 1, | |
| 'proctor' => 1, | |
| 'bandaid.inc' => 1, | |
| 'bandaid.drush.inc' => 1, | |
| 'fueluxasset.php' => 1, | |
| 'combobox.php' => 1, | |
| 'php_opendkim.h' => 1, | |
| 'opendkim.c' => 1, | |
| 'bwork_edit_notes' => 1, | |
| 'helloword.php' => 1, | |
| 'types-timber-integration.php' => 1, | |
| 'xapiclient.php' => 1, | |
| 'foggitexpertbundle.php' => 1, | |
| 'entitymodalbundle.php' => 1, | |
| '.gitignore.dist' => 1, | |
| 'exampleenvironment.php' => 1, | |
| 'tracyshortcuts.php' => 1, | |
| 'verbfixtures.php' => 1, | |
| 'statementresultfixtures.php' => 1, | |
| 'statementfixtures.php' => 1, | |
| 'documentfixtures.php' => 1, | |
| 'actorfixtures.php' => 1, | |
| 'activityfixtures.php' => 1, | |
| 'xapiclientinterface.php' => 1, | |
| 'xapiclientbuilderinterface.php' => 1, | |
| 'xapiclientbuilder.php' => 1, | |
| 'tree-resources.png' => 1, | |
| 'view-with-data.png' => 1, | |
| 'xpressdataloader.php' => 1, | |
| 'wplib.php' => 1, | |
| 'admin-content-labels.php' => 1, | |
| 'wp_pointer.php' => 1, | |
| 'options-template.php' => 1, | |
| 'options-framework.php' => 1, | |
| 'wp_options.php' => 1, | |
| 'wp_notify.php' => 1, | |
| 'wp_mvc.php' => 1, | |
| 'wp_debugbar.php' => 1, | |
| 'wp_autoupdate.php' => 1, | |
| 'wizadsettingsbundle.php' => 1, | |
| 'wizaddoctrinedocbundle.php' => 1, | |
| 'wizadcrudbundle.php' => 1, | |
| 'wizadapiblueprintbundle.php' => 1, | |
| 'defines.php' => 1, | |
| 'wps_extend_plugin.php' => 1, | |
| 'update-version.sh' => 1, | |
| 'json-loader.php' => 1, | |
| 'fieldsetinterface.php' => 1, | |
| 'metabox.php' => 1, | |
| 'boots.php' => 1, | |
| 'boots.json' => 1, | |
| 'xu.php' => 1, | |
| 'wp-sync-db.php' => 1, | |
| 'wp-sync-db-media-files.php' => 1, | |
| 'wp-sync-db-cli.php' => 1, | |
| 'slab' => 1, | |
| 'class-imagify.php' => 1, | |
| 'wp-lorem-ipsum.php' => 1, | |
| 'carelib.php' => 1, | |
| 'wps-extend-plugin.php' => 1, | |
| 'panel-transaction-history.png' => 1, | |
| 'remotedumpbundle.php' => 1, | |
| 'wysowarchivemytweetsbundle.php' => 1, | |
| 'parameters.yml.sample' => 1, | |
| 'bot.png' => 1, | |
| 'custom_autoload.php' => 1, | |
| 'zermelo.php' => 1, | |
| 'video.class.php' => 1, | |
| 'embed.class.php' => 1, | |
| 'commandr' => 1, | |
| 'flyercore' => 1, | |
| 'routefacade.php' => 1, | |
| 'facadeserviceprovider.php' => 1, | |
| 'exceptionizer.php' => 1, | |
| 'systeminfoexception.php' => 1, | |
| 'wurstpresscorebundle.php' => 1, | |
| 'aimb.php' => 1, | |
| 'wucdbmwucdbmbundle.php' => 1, | |
| 'wucdbmmenubuilderbundle.php' => 1, | |
| 'wucdbmlocalebundle.php' => 1, | |
| 'wucdbmgallerybundle.php' => 1, | |
| 'wucdbmepaybundle.php' => 1, | |
| 'wucdbmbannerbundle.php' => 1, | |
| 'socks.conf.template' => 1, | |
| 'wssysdtogeneratorbundle.php' => 1, | |
| 'tabularinput_test.php' => 1, | |
| 'tabularasset.php' => 1, | |
| 'inputcolumn.php' => 1, | |
| 'bfootableasset.php' => 1, | |
| 'wreptcpdfbundle.php' => 1, | |
| 'fosuserbundlemandrillmailerbundle.php' => 1, | |
| 'twigfactory.php' => 1, | |
| 'xpressgithubmetadataplugin.php' => 1, | |
| 'bytehandapi.php' => 1, | |
| 'hashasset.php' => 1, | |
| 'mosaicasset.php' => 1, | |
| 'mosaic.php' => 1, | |
| 'lightbox2asset.php' => 1, | |
| 'imagehelper.php' => 1, | |
| 'juxtaposeasset.php' => 1, | |
| 'zoomasset.php' => 1, | |
| 'wscratchpadasset.php' => 1, | |
| 'themefullasset.php' => 1, | |
| 'structureasset.php' => 1, | |
| 'scriptasset.php' => 1, | |
| 'iconsvgasset.php' => 1, | |
| 'iconpngextasset.php' => 1, | |
| 'iconpngasset.php' => 1, | |
| 'eraserasset.php' => 1, | |
| 'lightboxasset.php' => 1, | |
| 'jplayerwidget.php' => 1, | |
| 'commonassets.php' => 1, | |
| 'circleaudiowidget.php' => 1, | |
| 'audiowidget.php' => 1, | |
| 'imgareaselectasset.php' => 1, | |
| 'imgareaselect.php' => 1, | |
| 'holderassets.php' => 1, | |
| 'galleriaassets.php' => 1, | |
| 'galleria.php' => 1, | |
| 'orbit.php' => 1, | |
| 'foundationfullasset.php' => 1, | |
| 'easingasset.php' => 1, | |
| 'duckyasset.php' => 1, | |
| 'defaultthemeasset.php' => 1, | |
| 'qqexmailauth.php' => 1, | |
| 'd3asset.php' => 1, | |
| 'actionsheet.php' => 1, | |
| 'form.html' => 1, | |
| 'formerlyplugin.php' => 1, | |
| 'artvandelayplugin.php' => 1, | |
| 'xmonsonatamediaprovidervideobundle.php' => 1, | |
| 'xmoncolorpickertypebundle.php' => 1, | |
| 'easylogger.php' => 1, | |
| 'zeptoasset.php' => 1, | |
| 'xs.php' => 1, | |
| 'weuijsasset.php' => 1, | |
| 'weuiasset.php' => 1, | |
| 'msgpage.php' => 1, | |
| 'griditem.php' => 1, | |
| 'actionsheetcell.php' => 1, | |
| 'timesheetasset.php' => 1, | |
| 'readme.qqexmail' => 1, | |
| 'timesheet.php' => 1, | |
| 'thumbrule.php' => 1, | |
| 'thumbhelper.php' => 1, | |
| 'tagitasset.php' => 1, | |
| 'tagit.php' => 1, | |
| 'supersizedslideshowasset.php' => 1, | |
| 'supersizedcoreasset.php' => 1, | |
| 'supersized.php' => 1, | |
| 'ratchetiosasset.php' => 1, | |
| 'ratchetasset.php' => 1, | |
| 'ratchetandroidasset.php' => 1, | |
| 'pnotifyhelperassets.php' => 1, | |
| 'pnotifyassets.php' => 1, | |
| 'weixinmpauth.php' => 1, | |
| 'duckieasset.php' => 1, | |
| 'animoasset.php' => 1, | |
| 'xpressmoretag.php' => 1, | |
| 'xgclocalebundle.php' => 1, | |
| 'c.html' => 1, | |
| 'a.html' => 1, | |
| 'rql' => 1, | |
| 'xierrorbundle.php' => 1, | |
| 'xitagbundle.php' => 1, | |
| 'xismsbundle.php' => 1, | |
| 'xiselectorbundle.php' => 1, | |
| 'xisearchbundle.php' => 1, | |
| 'xifilelibbundle.php' => 1, | |
| 'xifilebrowserbundle.php' => 1, | |
| 'xidialogbundle.php' => 1, | |
| 'xibreadcrumbsbundle.php' => 1, | |
| 'xiarticlebundle.php' => 1, | |
| 'yuntongxunsmser.php' => 1, | |
| 'ossmanager.php' => 1, | |
| 'yunpiansmser.php' => 1, | |
| 'webchinesesmser.php' => 1, | |
| 'sxtsmser.php' => 1, | |
| 'cloudsmser.php' => 1, | |
| 'bootstraplanguagesasset.php' => 1, | |
| 'met.php' => 1, | |
| 'allpositions.php' => 1, | |
| 'site.php' => 1, | |
| 'restapi' => 1, | |
| 'minifyhtml.php' => 1, | |
| 'elasticsearchrequest.php' => 1, | |
| 'elasticsearchraw.php' => 1, | |
| 'smscenter.php' => 1, | |
| 'read' => 1, | |
| 'ossupload.php' => 1, | |
| 'snoopy.php' => 1, | |
| 'jqueryxasset.php' => 1, | |
| '.env.sample.php' => 1, | |
| 'alauda' => 1, | |
| 'default.vcl' => 1, | |
| 'modulegenerateprovider.php' => 1, | |
| 'php_filter.php' => 1, | |
| 'ximaicalbundle.php' => 1, | |
| 'ezrbachook.php' => 1, | |
| 'xiideaeasymenuaclbundle.php' => 1, | |
| 'xiideaeasyformbundle.php' => 1, | |
| 'xiideaeasyauditbundle.php' => 1, | |
| 'wwwasset.php' => 1, | |
| 'toptipsasset.php' => 1, | |
| 'toptips.php' => 1, | |
| 'jquery2asset.php' => 1, | |
| 'uploadoss.php' => 1, | |
| 'fullscreenbackgroundasset.php' => 1, | |
| 'fullscreenbackground.php' => 1, | |
| 'backtopasset.php' => 1, | |
| 'backtop.php' => 1, | |
| 'statuses.php' => 1, | |
| 'companies.php' => 1, | |
| 'timer' => 1, | |
| 'memory' => 1, | |
| 'debugger' => 1, | |
| 'weibolist.php' => 1, | |
| 'weibo_login.png' => 1, | |
| 'saetv2.ex.class.php' => 1, | |
| 'testpackage.php' => 1, | |
| 'ip2region.php' => 1, | |
| 'mongodbphp7tokenmanager.php' => 1, | |
| 'mysqltokenmanager.php' => 1, | |
| 'vpconfig.defaults.neon' => 1, | |
| 'contactactionop.php' => 1, | |
| 'documentactionop.php' => 1, | |
| 'distributionlistsubscribeop.php' => 1, | |
| 'distributionlistgranteeby.php' => 1, | |
| 'distributionlistby.php' => 1, | |
| 'distributionlistactionop.php' => 1, | |
| 'directorysearchtype.php' => 1, | |
| 'deployzimletaction.php' => 1, | |
| 'dedupaction.php' => 1, | |
| 'datasourcetype.php' => 1, | |
| 'datasourceby.php' => 1, | |
| 'countobjectstype.php' => 1, | |
| 'cosby.php' => 1, | |
| 'convactionop.php' => 1, | |
| 'compactindexaction.php' => 1, | |
| 'documentpermission.php' => 1, | |
| 'certtype.php' => 1, | |
| 'calendarresourceby.php' => 1, | |
| 'cachetype.php' => 1, | |
| 'cacheentryby.php' => 1, | |
| 'csrtype.php' => 1, | |
| 'csrkeysize.php' => 1, | |
| 'browseby.php' => 1, | |
| 'autoprovtaskaction.php' => 1, | |
| 'autoprovprincipalby.php' => 1, | |
| 'authscheme.php' => 1, | |
| 'attrmethod.php' => 1, | |
| 'alwaysonclusterby.php' => 1, | |
| 'alarmaction.php' => 1, | |
| 'documentgranttype.php' => 1, | |
| 'domainby.php' => 1, | |
| 'acltype.php' => 1, | |
| 'iptype.php' => 1, | |
| 'rangetype.php' => 1, | |
| 'quotasortby.php' => 1, | |
| 'queueactionby.php' => 1, | |
| 'queueaction.php' => 1, | |
| 'participationstatus.php' => 1, | |
| 'nameidby.php' => 1, | |
| 'msgactionop.php' => 1, | |
| 'membertype.php' => 1, | |
| 'memberofselector.php' => 1, | |
| 'mdsconnectiontype.php' => 1, | |
| 'logginglevel.php' => 1, | |
| 'lockoutoperation.php' => 1, | |
| 'itemactionop.php' => 1, | |
| 'invitestatus.php' => 1, | |
| 'entrytype.php' => 1, | |
| 'inviteclass.php' => 1, | |
| 'invitechange.php' => 1, | |
| 'interesttype.php' => 1, | |
| 'importance.php' => 1, | |
| 'granteetype.php' => 1, | |
| 'granteeby.php' => 1, | |
| 'getsessionssortby.php' => 1, | |
| 'galsearchtype.php' => 1, | |
| 'galmode.php' => 1, | |
| 'galconfigaction.php' => 1, | |
| 'frequency.php' => 1, | |
| 'freebusystatus.php' => 1, | |
| 'folderactionop.php' => 1, | |
| 'filtercondition.php' => 1, | |
| 'addresstype.php' => 1, | |
| 'acerighttype.php' => 1, | |
| 'reindexaction.php' => 1, | |
| 'zfrmailchimpbundle.php' => 1, | |
| 'ypsms.php' => 1, | |
| 'wxtsms.php' => 1, | |
| 'lsmsms.php' => 1, | |
| 'main.js' => 1, | |
| 'udpnotifierbundle.php' => 1, | |
| 'smaz.php' => 1, | |
| 'make_phpdoc.sh' => 1, | |
| 'phpflickr.php' => 1, | |
| 'development.local.php.dist' => 1, | |
| 'developmentmodecontrollerfactory.php' => 1, | |
| 'dockerfile-dev' => 1, | |
| 'default-configuration.php' => 1, | |
| '.scrutinizr.yml' => 1, | |
| 'zettamenubundle.php' => 1, | |
| 'compose-laravel.sh' => 1, | |
| 'review_1.0_cs' => 1, | |
| 'review_1.0' => 1, | |
| 'review-1.7-alpha1' => 1, | |
| 'review-1.7' => 1, | |
| 'review-1.3.4' => 1, | |
| 'review-1.6' => 1, | |
| 'review-1.3-test-failures' => 1, | |
| 'zesk.inc' => 1, | |
| 'zesk.application.inc' => 1, | |
| '_zesk_loader_.inc' => 1, | |
| 'steamimportuserstates.sh' => 1, | |
| 'steamimportuserstates.bat' => 1, | |
| 'zeroemdeferredrequestbundle.php' => 1, | |
| 'ytxsms.php' => 1, | |
| 'yii2debug.php' => 1, | |
| 'accountby.php' => 1, | |
| 'zikulajqueryminicolorsbundle.php' => 1, | |
| 'typedsequence.php' => 1, | |
| 'typedmap.php' => 1, | |
| 'simplexml.php' => 1, | |
| 'admininterface.php' => 1, | |
| 'adminfactory.php' => 1, | |
| 'accountinterface.php' => 1, | |
| 'accountfactory.php' => 1, | |
| 'zimcertauthbundle.php' => 1, | |
| 'certificatestorageitem.php' => 1, | |
| 'certificateitem.php' => 1, | |
| 'certificategenerator.php' => 1, | |
| 'certificateexpressionvalidator.php' => 1, | |
| 'certificateawareuserinterface.php' => 1, | |
| 'wizard.png' => 1, | |
| 'yii2debuglogroute.php' => 1, | |
| 'wizardcompleteinterface.php' => 1, | |
| 'injectcontainerinterface.php' => 1, | |
| 'formhandlerinterface.php' => 1, | |
| 'abortstageexception.php' => 1, | |
| 'zikulageneratorbundle.php' => 1, | |
| 'sftp.php' => 1, | |
| 'local.php' => 1, | |
| '_vimrc' => 1, | |
| '_viminfo' => 1, | |
| 'generate-phpstorm-helper.php' => 1, | |
| 'phpspec-hhvm.yml.dist' => 1, | |
| 'yii2debugviewrenderer.php' => 1, | |
| 'yii2debugpanel.php' => 1, | |
| 'yii2debugmodule.php' => 1, | |
| 'rankingactionop.php' => 1, | |
| 'reindextype.php' => 1, | |
| 'deferevents.php' => 1, | |
| 'uniprop.php' => 1, | |
| 'useragent.class.php' => 1, | |
| 'test-my-useragent.php' => 1, | |
| 'zacsturgessherokuizemebundle.php' => 1, | |
| 'zrashwaniarachnidsitemapbundle.php' => 1, | |
| 'dfd.php' => 1, | |
| 'gfdsgsdfgdfs.php' => 1, | |
| 'mylog.php' => 1, | |
| 'mylog' => 1, | |
| 'mypol.te' => 1, | |
| 'mypol.pp' => 1, | |
| 'deficient' => 1, | |
| 'datagrid' => 1, | |
| 'dataform' => 1, | |
| 'fetcher.php' => 1, | |
| 'zunienumbundle.php' => 1, | |
| 'defaultservices.php' => 1, | |
| 'commandservices.php' => 1, | |
| 'texput.log' => 1, | |
| 'mentemformextbundle.php' => 1, | |
| 'mentemdatagridbundle.php' => 1, | |
| 'sourceinterface.php' => 1, | |
| 'rowinterface.php' => 1, | |
| 'resolvedtypeinterface.php' => 1, | |
| 'resolvedtype.php' => 1, | |
| 'gridregistryinterface.php' => 1, | |
| 'gridregistry.php' => 1, | |
| 'gridinterface.php' => 1, | |
| 'gridfactoryinterface.php' => 1, | |
| 'zunidatatablebundle.php' => 1, | |
| 'zunilogbundle.php' => 1, | |
| 'gridevents.php' => 1, | |
| 'builder-show.php' => 1, | |
| 'dasherizephp.sublime-project' => 1, | |
| 'visitor-test.php' => 1, | |
| 'template-test.php' => 1, | |
| 'strategy-test.php' => 1, | |
| 'single-test.php' => 1, | |
| 'proxy-test.php' => 1, | |
| 'observer-test.php' => 1, | |
| 'mediator-test.php' => 1, | |
| 'interpreter-show.php' => 1, | |
| 'factory-show.php' => 1, | |
| 'facade-show.php' => 1, | |
| 'delegate-show.php' => 1, | |
| 'decorator-show.php' => 1, | |
| 'adapter-show.php' => 1, | |
| 'zunimenubundle.php' => 1, | |
| 'lsyncd.conf.lua.template' => 1, | |
| 'twigpath.php' => 1, | |
| 'requestevent.php' => 1, | |
| 'discovery-shell.php' => 1, | |
| 'dummyfilemanager.php' => 1, | |
| 'imageattachmentasset.php' => 1, | |
| 'elfinderinput.php' => 1, | |
| 'imagefileinput.php' => 1, | |
| 'watch.rb' => 1, | |
| 'gen' => 1, | |
| 'gcaljson.php' => 1, | |
| 'nfephp.css' => 1, | |
| 'grava_config.php' => 1, | |
| 'zunimenuevents.php' => 1, | |
| 'gridfactory.php' => 1, | |
| 'gridevent.php' => 1, | |
| 'replytype.php' => 1, | |
| 'voicemsgactionop.php' => 1, | |
| 'attributeselector.php' => 1, | |
| 'attributename.php' => 1, | |
| 'accountselector.php' => 1, | |
| 'accountnameselector.php' => 1, | |
| 'headercontext.php' => 1, | |
| 'mailinterface.php' => 1, | |
| 'mailfactory.php' => 1, | |
| 'zimletstatus.php' => 1, | |
| 'zimletexcludetype.php' => 1, | |
| 'xmppcomponentby.php' => 1, | |
| 'weekday.php' => 1, | |
| 'volumetype.php' => 1, | |
| 'voicesortby.php' => 1, | |
| 'versioncheckaction.php' => 1, | |
| 'attrsimpltrait.php' => 1, | |
| 'verbtype.php' => 1, | |
| 'ucserviceby.php' => 1, | |
| 'transparency.php' => 1, | |
| 'targettype.php' => 1, | |
| 'targetby.php' => 1, | |
| 'tagactionop.php' => 1, | |
| 'sortby.php' => 1, | |
| 'sessiontype.php' => 1, | |
| 'serverby.php' => 1, | |
| 'sectiontype.php' => 1, | |
| 'searchtype.php' => 1, | |
| 'rightclass.php' => 1, | |
| 'requestformat.php' => 1, | |
| 'attributeselectortrait.php' => 1, | |
| 'cursorinfo.php' => 1, | |
| 'gridbuilderinterface.php' => 1, | |
| 'voiceinterface.php' => 1, | |
| 'gridbuilder.php' => 1, | |
| 'columninterface.php' => 1, | |
| 'mentemconfigbundle.php' => 1, | |
| 'mentembootstrapbundle.php' => 1, | |
| 'mentemadminbundle.php' => 1, | |
| 'zk2usefulbundle.php' => 1, | |
| 'zk2adminpanelbundle.php' => 1, | |
| 'zk2spsbundle.php' => 1, | |
| 'generaldigitalpleskbundle.php' => 1, | |
| 'vi.php' => 1, | |
| 'ziron-api.php' => 1, | |
| 'testform.xml' => 1, | |
| 'floppybundle.php' => 1, | |
| 'voicefactory.php' => 1, | |
| 'entrysearchfilterinfo.php' => 1, | |
| 'attactment.php' => 1, | |
| 'waitsetspec.php' => 1, | |
| 'waitsetid.php' => 1, | |
| 'waitsetaddspec.php' => 1, | |
| 'tzonsetinfo.php' => 1, | |
| 'structinterface.php' => 1, | |
| 'searchfiltercondition.php' => 1, | |
| 'opvalue.php' => 1, | |
| 'namedvalue.php' => 1, | |
| 'namedelement.php' => 1, | |
| 'keyvaluepair.php' => 1, | |
| 'granteechooser.php' => 1, | |
| 'entrysearchfiltersinglecond.php' => 1, | |
| 'entrysearchfiltermulticond.php' => 1, | |
| 'deferredrequestinterface.php' => 1, | |
| 'zeroemapisecuritybundle.php' => 1, | |
| 'flashbasehelper.php' => 1, | |
| 'warehouse.class.php' => 1, | |
| 'jullocationbundle.php' => 1, | |
| '新建文本文档' => 1, | |
| 'rizewaycasbundle.php' => 1, | |
| 'anchour.php' => 1, | |
| '.anchour' => 1, | |
| 'rizewayjobbundle.php' => 1, | |
| 'ameblo.php' => 1, | |
| 'shorton.php' => 1, | |
| 'spressdataloader.php' => 1, | |
| 'spressmoretag.php' => 1, | |
| 'rpsguestbookbundle.php' => 1, | |
| 'rpscorebundle.php' => 1, | |
| 'yosmanygadomainparserbundle.php' => 1, | |
| 'v3warehousetest.php' => 1, | |
| 'currentsession.php' => 1, | |
| 'v3warehousemytest.php' => 1, | |
| 'v3warehouse.class.php' => 1, | |
| 'v3sdktest.php' => 1, | |
| 'v3sdk.class.php' => 1, | |
| 'v3application.class.php' => 1, | |
| 'mongo.script' => 1, | |
| 'binbase.sql' => 1, | |
| 'phpbintestmy.php' => 1, | |
| 'phpbintestmon.php' => 1, | |
| 'phpbintest.php' => 1, | |
| 'phpbin.class.php' => 1, | |
| 'bin.class.php' => 1, | |
| 'mysocial.class.php' => 1, | |
| 'apiconnector.php' => 1, | |
| 'deletebysaving.php' => 1, | |
| 'mydbtest.php' => 1, | |
| 'recurringtemplate.php' => 1, | |
| 'tpnregionalroutingbundle.php' => 1, | |
| 'specs' => 1, | |
| 'httpserver.php' => 1, | |
| 'cgistream.php' => 1, | |
| 'xmlmapper.php' => 1, | |
| 'unabletosettleexception.php' => 1, | |
| 'taxrate.php' => 1, | |
| 'syncobject.php' => 1, | |
| 'syncarray.php' => 1, | |
| 'storable.php' => 1, | |
| 'simplexmlelement.php' => 1, | |
| 'servererrorexception.php' => 1, | |
| 'sendable.php' => 1, | |
| 'payable.php' => 1, | |
| 'dirtyaware.php' => 1, | |
| 'notvalidexception.php' => 1, | |
| 'notloggedinexception.php' => 1, | |
| 'logtransportdecorator.php' => 1, | |
| 'jsonmapper.php' => 1, | |
| 'invoiceprofile.php' => 1, | |
| 'invalidstateexception.php' => 1, | |
| 'invalidservicetypeexception.php' => 1, | |
| 'invalidsequencetypeexception.php' => 1, | |
| 'invalidrequestexception.php' => 1, | |
| 'invalididexception.php' => 1, | |
| 'invalidfilterexception.php' => 1, | |
| 'incominginvoice.php' => 1, | |
| 'estimate.php' => 1, | |
| 'disclosure.php' => 1, | |
| 'mylogin.class.php' => 1, | |
| 'mydb.class.php' => 1, | |
| 'yvinviteevents.php' => 1, | |
| 'mysql.scheme.sql' => 1, | |
| 'yjvreportrenderingbundle.php' => 1, | |
| 'html_screenshot.png' => 1, | |
| 'reportrendering.php' => 1, | |
| 'filterconstants.php' => 1, | |
| 'builderinterfaces.php' => 1, | |
| 'targetmodeltrait.php' => 1, | |
| 'targetmodel.php' => 1, | |
| 'viewrendererstaticclassproxy.php' => 1, | |
| 'optimizer.php' => 1, | |
| 'yiicaster.php' => 1, | |
| 'batchqueryresult.php' => 1, | |
| 'togglebuttongroup.php' => 1, | |
| 'bootstrapwidgettrait.php' => 1, | |
| 'mediafile.php' => 1, | |
| 'abstractnamedbuilder.php' => 1, | |
| 'etwigviewrenderer.php' => 1, | |
| 'estatusbehavior.php' => 1, | |
| 'edbmigration.php' => 1, | |
| 'efileuploadaction.php' => 1, | |
| 'basechart.php' => 1, | |
| 'eactiverecordrelationbehaviortest.php' => 1, | |
| 'eactiverecordrelationbehavior.php' => 1, | |
| 'meritbehavior.php' => 1, | |
| 'forum.sql' => 1, | |
| 'readme-zh' => 1, | |
| 'uploadfilebehavior.php' => 1, | |
| 'jwplayerasset.php' => 1, | |
| 'jwplayer.php' => 1, | |
| 'abstractbuilder.php' => 1, | |
| 'buildernotreturnedexception.php' => 1, | |
| 'driverdb.class.php' => 1, | |
| 'typeregistry.php' => 1, | |
| 'test_xml.php' => 1, | |
| 'test_timbra.php' => 1, | |
| 'test_cancela.php' => 1, | |
| 'foxreferencedataloaderbundle.php' => 1, | |
| 'yjvvalidatorconstraintgroupbundle.php' => 1, | |
| 'yamlgrouploader.php' => 1, | |
| 'grouploaderinterface.php' => 1, | |
| 'groupfactoryinterface.php' => 1, | |
| 'groupfactory.php' => 1, | |
| 'groupcreationfailedexception.php' => 1, | |
| 'constraintgroup.php' => 1, | |
| 'typeresolverinterface.php' => 1, | |
| 'typeregistryinterface.php' => 1, | |
| 'typenotsupportedexception.php' => 1, | |
| 'buildernotsupportedexception.php' => 1, | |
| 'typenotfoundexception.php' => 1, | |
| 'typefactoryinterface.php' => 1, | |
| 'typefactorybuilderinterface.php' => 1, | |
| 'typefactorybuilder.php' => 1, | |
| 'typefactory.php' => 1, | |
| 'typeextensionsnotfoundexception.php' => 1, | |
| 'typechaininterface.php' => 1, | |
| 'typechain.php' => 1, | |
| 'registryextensioninterface.php' => 1, | |
| 'optionsresolvernotreturnedexception.php' => 1, | |
| 'namedtypefactoryinterface.php' => 1, | |
| 'namedtypefactory.php' => 1, | |
| 'namedbuilderinterface.php' => 1, | |
| 'finalizingtypeinterface.php' => 1, | |
| 'yvinvitebundle.php' => 1, | |
| 'yvmulticurrencybundle.php' => 1, | |
| 'zeroemjsonbundle.php' => 1, | |
| 'authmobile.php' => 1, | |
| 'testconfiguration.php.travis' => 1, | |
| 'testconfiguration.php.dist' => 1, | |
| 'phpmetrics.html' => 1, | |
| 'zend-blueprint.json' => 1, | |
| 'installing-nagios-debian6' => 1, | |
| 'foundationpluginasset.php' => 1, | |
| 'pryongoogletranslatorbundle.php' => 1, | |
| 'zeliard91dynamodbconnectorbundle.php' => 1, | |
| 'summernotepluginasset.php' => 1, | |
| 'rssview.php' => 1, | |
| 'slugifier.php' => 1, | |
| 'zelenincqrsbundle.php' => 1, | |
| 'authsites.php' => 1, | |
| 'authdirect.php' => 1, | |
| '.zf-mkdoc-theme-preserve' => 1, | |
| 'constantcontact.php' => 1, | |
| 'gitphploy.ini.sample' => 1, | |
| 'config.ini.sample.php' => 1, | |
| 'zebbavalidatorbundle.php' => 1, | |
| 'parameterconverter.php' => 1, | |
| 'classutility.php' => 1, | |
| 'zebbasecuritybundle.php' => 1, | |
| 'config_dist.php' => 1, | |
| 'entitymodel.php' => 1, | |
| 'paging.php' => 1, | |
| 'kcppay.php' => 1, | |
| 'bestsms.php' => 1, | |
| '.htdeployment' => 1, | |
| 'zf2.bat' => 1, | |
| 'bookdown.json' => 1, | |
| 'zapoyoktimelinejsbundle.php' => 1, | |
| 'kladrbundle.php' => 1, | |
| 'zeroemdeferredrequestpersisterbundle.php' => 1, | |
| 'millwrightsemaphorebundle.php' => 1, | |
| 'codesniffer.sample.conf' => 1, | |
| 'phputil.php' => 1, | |
| 'numbertostring.php' => 1, | |
| 'dateutil.php' => 1, | |
| 'update-vendors.sh' => 1, | |
| 'millwrighttwitterbootstrapbundle.php' => 1, | |
| 'millwrightradbundle.php' => 1, | |
| 'millwrightmenubundle.php' => 1, | |
| 'millwrightfilterbundle.php' => 1, | |
| 'millwrightboilerplatebundle.php' => 1, | |
| 'millwrightconfigurationbundle.php' => 1, | |
| 'vbv_learn_more.html' => 1, | |
| 'my first framework based on composer' => 1, | |
| 'robots_example' => 1, | |
| 'page_not_found.php' => 1, | |
| 'nddbc.html' => 1, | |
| 'mcs_learn_more.html' => 1, | |
| 'ipn_main_handler.php' => 1, | |
| 'init_includes.php' => 1, | |
| 'ricjloader.php' => 1, | |
| 'loaderhelper.php' => 1, | |
| 'cssjsfinder.php' => 1, | |
| 'outputcache.php' => 1, | |
| 'datacache.php' => 1, | |
| 'cachecore.php' => 1, | |
| 'turbo' => 1, | |
| 'igabuilderbundle.php' => 1, | |
| 'zapoyokuserpreferencesbundle.php' => 1, | |
| 'zapoyokholidaybundle.php' => 1, | |
| 'yvmulticurrencyevents.php' => 1, | |
| 'yuccadatabundle.php' => 1, | |
| 'install-chardet.sh' => 1, | |
| 'simpleldapbundle.php' => 1, | |
| 'openvpnmanagementbundle.php' => 1, | |
| 'ketch' => 1, | |
| 'svnlog' => 1, | |
| 'ci.bat' => 1, | |
| 'adminyii.sublime-workspace' => 1, | |
| 'adminyii.sublime-project' => 1, | |
| 'weibo.php' => 1, | |
| 'qq.php' => 1, | |
| 'smd.js' => 1, | |
| 'smd.css' => 1, | |
| 'yuccafosuseradapterbundle.php' => 1, | |
| 'setup.bat' => 1, | |
| 'abstractworkflowexecution.php' => 1, | |
| 'gardening' => 1, | |
| 'readme.api' => 1, | |
| 'dns_record.json' => 1, | |
| 'apcpanelbundle.php' => 1, | |
| 'ystoolserlangportbundle.php' => 1, | |
| 'ystoolsbackurlbundle.php' => 1, | |
| 'servicesjsonerror.php' => 1, | |
| 'servicesjson.php' => 1, | |
| 'rklocalebundle.php' => 1, | |
| 'betacieovhbundle.php' => 1, | |
| 'yoyelocalizationbundle.php' => 1, | |
| 'yvtransactionalemailevents.php' => 1, | |
| 'yvtransactionalemailbundle.php' => 1, | |
| 'abstractworkflowdefinition.php' => 1, | |
| 'abstractworkflowexecutionfactory.php' => 1, | |
| 'zanstandarduibundle.php' => 1, | |
| 'pico_oembed.php' => 1, | |
| 'zanhttpapibundle.php' => 1, | |
| 'zancorebundle.php' => 1, | |
| 'zancommandbundle.php' => 1, | |
| 'tha-theme-hooks.php' => 1, | |
| 'tha-example-index.php' => 1, | |
| 'zakharovvihumanstxtbundle.php' => 1, | |
| 'zz-number.iml' => 1, | |
| 'zaederlink4mailingbundle.php' => 1, | |
| 'holmes.php' => 1, | |
| 'wordnetphp-console' => 1, | |
| 'pronounce-php' => 1, | |
| 'petrol' => 1, | |
| 'pico_scheduled_post.php' => 1, | |
| 'doctrine.dbal.hooks.php' => 1, | |
| 'awx' => 1, | |
| 'ide_helper_mongo.php' => 1, | |
| 'hydra.phar' => 1, | |
| 'compile.bat' => 1, | |
| 'ddns-updater.yml.dist' => 1, | |
| 'regexes.yml' => 1, | |
| 'yzsupervisorbundle.php' => 1, | |
| 'good1' => 1, | |
| 'good' => 1, | |
| 'filesrc.php' => 1, | |
| 'classsrc.php' => 1, | |
| 'classmapandfile.php' => 1, | |
| 'release_note' => 1, | |
| 'jbuild.dist.ini' => 1, | |
| 'venom.php' => 1, | |
| 'vpconfig.neon' => 1, | |
| 'versionpress.php' => 1, | |
| 'runpostdeploy' => 1, | |
| 'abstractmultiactioncontroller.php' => 1, | |
| 'dispatcherawareinterface.php' => 1, | |
| 'serverhelper.php' => 1, | |
| 'htmlelements.php' => 1, | |
| 'htmlelement.php' => 1, | |
| 'domelements.php' => 1, | |
| 'domelement.php' => 1, | |
| 'relationdatamapper.php' => 1, | |
| 'abstractdatamapper.php' => 1, | |
| 'databasehelper.php' => 1, | |
| 'databasefactory.php' => 1, | |
| 'datasetinterface.php' => 1, | |
| 'datainterface.php' => 1, | |
| 'crypthelper.php' => 1, | |
| 'abstractconsole.php' => 1, | |
| 'eventtriggerableinterface.php' => 1, | |
| 'nincompare.php' => 1, | |
| 'neqcompare.php' => 1, | |
| 'ltecompare.php' => 1, | |
| 'ltcompare.php' => 1, | |
| 'incompare.php' => 1, | |
| 'gtecompare.php' => 1, | |
| 'gtcompare.php' => 1, | |
| 'eqcompare.php' => 1, | |
| 'comparehelper.php' => 1, | |
| 'credential.php' => 1, | |
| 'abstractwebapplication.php' => 1, | |
| 'abstractdaemonapplication.php' => 1, | |
| 'abstractcliapplication.php' => 1, | |
| 'dispatcherawaretrait.php' => 1, | |
| 'listenermapper.php' => 1, | |
| 'developmentbundle.php' => 1, | |
| 'abstractmiddleware.php' => 1, | |
| 'registryhelper.php' => 1, | |
| 'nestedrecord.php' => 1, | |
| 'queryexpression.php' => 1, | |
| 'queryelement.php' => 1, | |
| 'connectioncontainer.php' => 1, | |
| 'abstractquerybuilder.php' => 1, | |
| 'profilerinterface.php' => 1, | |
| 'profilerawareinterface.php' => 1, | |
| 'nullprofiler.php' => 1, | |
| 'databasemodelinterface.php' => 1, | |
| 'abstractmodel.php' => 1, | |
| 'endmiddleware.php' => 1, | |
| 'callbackmiddleware.php' => 1, | |
| 'languagenormalize.php' => 1, | |
| 'listenerpriority.php' => 1, | |
| 'windwalker.xml' => 1, | |
| 'jsoninput.php' => 1, | |
| 'formdatainput.php' => 1, | |
| 'filesinput.php' => 1, | |
| 'abstractrequest.php' => 1, | |
| 'validatorhelper.php' => 1, | |
| 'formhelper.php' => 1, | |
| 'fieldhelper.php' => 1, | |
| 'fielddefinitioninterface.php' => 1, | |
| 'abstractformelementhelper.php' => 1, | |
| 'outputfilter.php' => 1, | |
| 'inputfilter.php' => 1, | |
| 'htmlcleaner.php' => 1, | |
| 'listenersqueue.php' => 1, | |
| 'abstractapplication.php' => 1, | |
| 'mycomposer.php' => 1, | |
| 'abstractenginerenderer.php' => 1, | |
| 'tpl_package' => 1, | |
| 'varspoolwebsocketbundle.php' => 1, | |
| 'epub-titlepage.html' => 1, | |
| 'epub-page.html' => 1, | |
| 'epub-coverimage.html' => 1, | |
| 'default.textile' => 1, | |
| 'default.rtf' => 1, | |
| 'default.opendocument' => 1, | |
| 'default.mediawiki' => 1, | |
| 'default.latex' => 1, | |
| 'default.html5' => 1, | |
| 'default.html' => 1, | |
| 'default.docbook' => 1, | |
| 'vanilla_logo.png' => 1, | |
| 'sample_package.php' => 1, | |
| 'freq.php' => 1, | |
| 'class.exportmodel.php' => 1, | |
| 'class.exportcontroller.php' => 1, | |
| 'valitonshariffbundle.php' => 1, | |
| 'shariffconfig.php' => 1, | |
| 'valitonpaymentsaferpaybundle.php' => 1, | |
| 'valitonmultisitebundle.php' => 1, | |
| 'currentsite.php' => 1, | |
| 'valitonpaymentdatatransbundle.php' => 1, | |
| 'kwtyahoobossbundle.php' => 1, | |
| 'ot-loader.php' => 1, | |
| 'macaddressvalidator.php' => 1, | |
| 'class-phoenix-framework-form-field-type-base.php' => 1, | |
| 'class-phoenix-framework-form-builder.php' => 1, | |
| 'diacritic.php' => 1, | |
| 'parts.php' => 1, | |
| 'arg.php' => 1, | |
| 'model.hooks.php' => 1, | |
| 'doxport' => 1, | |
| 'bootstrap-tests.php' => 1, | |
| 'vf_license' => 1, | |
| 'application.config.local.php.dist' => 1, | |
| 'netsuite toolkit license agreement.docx' => 1, | |
| 'vegas.json' => 1, | |
| 'voting.i18n.php' => 1, | |
| 'voting.hooks.php' => 1, | |
| 'voting.class.php' => 1, | |
| 'activerecordsetup.php' => 1, | |
| 'activerecordormspecial.php' => 1, | |
| 'activerecordmediawiki.php' => 1, | |
| 'model.i18n.php' => 1, | |
| 'ororedisconfigbundle.php' => 1, | |
| 'phonetics.php' => 1, | |
| 'bots.json' => 1, | |
| 'cheburtwigphpfunctionsbundle.php' => 1, | |
| 'chebursphinxbundle.php' => 1, | |
| 'joubjoubnotificationbundle.php' => 1, | |
| 'multipleappkernelbundle.php' => 1, | |
| 'w3docslogviewerbundle.php' => 1, | |
| 'amgangularjsbundle.php' => 1, | |
| 'curlemu.php' => 1, | |
| 'vaszevselfadvertbundle.php' => 1, | |
| 'vaszevcrudbundle.php' => 1, | |
| 'vaszevcrudltebundle.php' => 1, | |
| 'vaszevcommonsbundle.php' => 1, | |
| 'suffixes.php' => 1, | |
| 'prefixes.php' => 1, | |
| 'abstractadapterrenderer.php' => 1, | |
| 'abstractrenderer.php' => 1, | |
| 'modularapp.php' => 1, | |
| 'checktypes.php' => 1, | |
| 'consumer.php' => 1, | |
| 'phpunit.teamcity.xml' => 1, | |
| 'phpunit.teamcity.sqlite3.xml' => 1, | |
| 'phpunit.teamcity.postgresql.xml' => 1, | |
| 'iframe' => 1, | |
| 'vincetbasebundle.php' => 1, | |
| 'vincetadminconfigurationbundle.php' => 1, | |
| 'vincetadminbundle.php' => 1, | |
| 'virtualhost.conf' => 1, | |
| 'vincetypebundle.php' => 1, | |
| 'vincecmssonataadminbundle.php' => 1, | |
| 'vincecmsbundle.php' => 1, | |
| 'vincecoreidelinkbundle.php' => 1, | |
| 'example.svg' => 1, | |
| 'signaturemethod.php' => 1, | |
| 'example.c4ml' => 1, | |
| 'api-autoloader.php' => 1, | |
| 'vihuvacrecaptchabundle.php' => 1, | |
| 'cpt-base.php' => 1, | |
| 'xmlelementinterface.php' => 1, | |
| 'xmlelement.php' => 1, | |
| 'xmlcollectioninterface.php' => 1, | |
| 'xmlcollection.php' => 1, | |
| 'xmlattributesinterface.php' => 1, | |
| 'xmlattributes.php' => 1, | |
| 'xmlarraycollection.php' => 1, | |
| 'definitions' => 1, | |
| 'appendr.php' => 1, | |
| 'hmacsha1.php' => 1, | |
| 'behat-client.yml.dist' => 1, | |
| 'actors.gif' => 1, | |
| 'iphpfilestorebundle.php' => 1, | |
| 'abstract_router.php' => 1, | |
| 'controller_exception.php' => 1, | |
| 'code' => 1, | |
| 'squarebitmap.php' => 1, | |
| 'pixel.php' => 1, | |
| 'imagebitmap.php' => 1, | |
| 'ilazybitmap.php' => 1, | |
| 'colorbitmap.php' => 1, | |
| 'bitmap.php' => 1, | |
| 'iphptreebundle.php' => 1, | |
| 'iphpsearchbundle.php' => 1, | |
| 'iphpredirectnotfoundbundle.php' => 1, | |
| 'iphppollbundle.php' => 1, | |
| 'iphpcorebundle.php' => 1, | |
| 'behat-worker.yml.dist' => 1, | |
| 'iphpcontentbundle.php' => 1, | |
| 'nds.php' => 1, | |
| 'cnzzwidget.php' => 1, | |
| 'basegeolocation.php' => 1, | |
| 'htmlencodeattributebehavior.php' => 1, | |
| 'basetimezone.php' => 1, | |
| 'youtubeasset.php' => 1, | |
| 'cns.php' => 1, | |
| 'queuemails.php' => 1, | |
| 'watermark.png' => 1, | |
| 'result.jpg' => 1, | |
| 'image.jpg' => 1, | |
| 'rotor' => 1, | |
| 'library' => 1, | |
| 'shooting.gif' => 1, | |
| 'phpviddler.php' => 1, | |
| 'bladerenderer.php' => 1, | |
| 'abstractview.php' => 1, | |
| 'menu-class-diagram.svg' => 1, | |
| 'ob_logo_compacto.png' => 1, | |
| 'ob_logo.png' => 1, | |
| 'gerar_boleto.php' => 1, | |
| 'ob_init.php' => 1, | |
| 'plugin' => 1, | |
| 'vershsphinxbundle.php' => 1, | |
| 'coind.php' => 1, | |
| 'veritrans.php' => 1, | |
| 'autoload_dist.php' => 1, | |
| 'viewinterface.php' => 1, | |
| 'simplehtmlview.php' => 1, | |
| 'htmlview.php' => 1, | |
| 'uriinterface.php' => 1, | |
| 'vespolinacommercebundle.php' => 1, | |
| 'uriimmutable.php' => 1, | |
| 'urihelper.php' => 1, | |
| 'psruri.php' => 1, | |
| 'abstracturi.php' => 1, | |
| 'testenvironment.php' => 1, | |
| 'utf8string.php' => 1, | |
| 'stringnormalise.php' => 1, | |
| 'stringinflector.php' => 1, | |
| 'simpletemplate.php' => 1, | |
| 'twigrenderer.php' => 1, | |
| 'platesrenderer.php' => 1, | |
| 'phprenderer.php' => 1, | |
| 'mustacherenderer.php' => 1, | |
| 'vespolinaadminbundle.php' => 1, | |
| 'storeevents.php' => 1, | |
| 'mitlicense' => 1, | |
| 'abstractsocket.php' => 1, | |
| 'phpdoc-md' => 1, | |
| 'servedocs.sh' => 1, | |
| 'publishdocs.sh' => 1, | |
| 'infinitepager.php' => 1, | |
| 'vgrelasticsearchhttpfoundationbundle.php' => 1, | |
| 'vgrelasticsearchbundle.php' => 1, | |
| 'vgrelasticsearchfosoauthserverbundle.php' => 1, | |
| 'amazonstoragebundle.php' => 1, | |
| 'socketinterface.php' => 1, | |
| 'remotesocket.php' => 1, | |
| 'localsocket.php' => 1, | |
| 'httpssocket.php' => 1, | |
| 'httpsocket.php' => 1, | |
| 'lxsocketbundle.php' => 1, | |
| 'vespolinastorebundle.php' => 1, | |
| 'lxjquerybundle.php' => 1, | |
| 'jquery-latest.js' => 1, | |
| 'lxbootstrapbundle.php' => 1, | |
| 'phpunit.sqlite.xml' => 1, | |
| 'phpunit.postgresql.xml' => 1, | |
| 'phpunit.mysqli.xml' => 1, | |
| 'moodlelib.php' => 1, | |
| 'class_cloudflare.php' => 1, | |
| 'config-empty.php' => 1, | |
| '.htaccess-template' => 1, | |
| 'finck.php' => 1, | |
| 'upgrade-0.6' => 1, | |
| 'vespolinataxonomybundle.php' => 1, | |
| 'vespolinataxationbundle.php' => 1, | |
| 'systemmodule.php' => 1, | |
| 'swaggermodule.php' => 1, | |
| 'vivaitauthbundle.php' => 1, | |
| 'favicongenerator.php' => 1, | |
| 'eshop.php' => 1, | |
| 'lazyrouter.php' => 1, | |
| 'antique.php' => 1, | |
| 'upfront-theme-manager.php' => 1, | |
| 'parse' => 1, | |
| 'uecodeawsclibundle.php' => 1, | |
| 'titlegenerator.php' => 1, | |
| 'staticseoitemadapter.php' => 1, | |
| 'socialmetatagsgenerator.php' => 1, | |
| 'seositeinterface.php' => 1, | |
| 'seometatagsgenerator.php' => 1, | |
| 'seoiteminterface.php' => 1, | |
| 'linksgenerator.php' => 1, | |
| 'dynamicseoitem.php' => 1, | |
| 'realestate.php' => 1, | |
| 'baseseogenerator.php' => 1, | |
| 'vagrafonybundle.php' => 1, | |
| 'udanadminltebundle.php' => 1, | |
| 'license-kohana' => 1, | |
| 'ucsfldapormbundle.php' => 1, | |
| 'ucsfduoormbundle.php' => 1, | |
| 'ucsdmath-logo.png' => 1, | |
| 'db.sqlite' => 1, | |
| 'conucha' => 1, | |
| 'ubcsisapibundle.php' => 1, | |
| 'screen 2.png' => 1, | |
| 'jquery-1.10.2.min.js' => 1, | |
| 'render.phtml' => 1, | |
| 'guestbook.php' => 1, | |
| '.zf.ini' => 1, | |
| 'uap-core' => 1, | |
| 'ldmmodule.php' => 1, | |
| 'class-zip.php' => 1, | |
| 'class-updraftplus.php' => 1, | |
| 'global-hide-brute-force-admin-tool-bar.php' => 1, | |
| 'global-hide-admin-tool-bar.php' => 1, | |
| 'reeeed_meeee' => 1, | |
| 'mockdata' => 1, | |
| 'umbrellawebmailerbundle.php' => 1, | |
| 'umbrellawebgooglegeocodingapibundle.php' => 1, | |
| 'umbrellawebmarkdownbundle.php' => 1, | |
| 'fileheaderdocblock' => 1, | |
| 'zendesk_app_controller.php' => 1, | |
| 'usnnewsletterbundle.php' => 1, | |
| 'ulffelasticsearchphpclientbundle.php' => 1, | |
| 'hillmodule.php' => 1, | |
| 'clean-cache.bat' => 1, | |
| 'acemodule.php' => 1, | |
| 'ulaboxrulerbundle.php' => 1, | |
| 'ulaboxgearmanbundle.php' => 1, | |
| 'redisphp.png' => 1, | |
| 'enricher.php' => 1, | |
| 'emptychildrenexception.php' => 1, | |
| 'elementtypenotsupportedexception.php' => 1, | |
| 'arrayconverterinterface.php' => 1, | |
| 'arrayconverter.php' => 1, | |
| 'tpnemailtemplatesbundle.php' => 1, | |
| 'start-update.sh' => 1, | |
| 'index.css' => 1, | |
| 'end-update.sh' => 1, | |
| 'clean-cache.sh' => 1, | |
| 'update-resources.sh' => 1, | |
| 'wagner.cson' => 1, | |
| 'restorer.php' => 1, | |
| 'dustasset.php' => 1, | |
| 'tvisionrackspacecloudfilesbundle.php' => 1, | |
| 'liuggiohelpdeskbundle.php' => 1, | |
| 'basereflection.php' => 1, | |
| 'crudassets.php' => 1, | |
| 'gsearch.php' => 1, | |
| 'embedwidget.php' => 1, | |
| 'codevalidator.php' => 1, | |
| 'yiimaterializeasset.php' => 1, | |
| 'waves.php' => 1, | |
| 'materializeiconsasset.php' => 1, | |
| 'actionbutton.php' => 1, | |
| 'formbuilderasset.php' => 1, | |
| 'fieldbehavior.php' => 1, | |
| 'tuxonevalidationbundle.php' => 1, | |
| 'wiechertdatatablesbundle.php' => 1, | |
| 'tuxonesocialmetatagsbundle.php' => 1, | |
| 'tuxonepostmarkbundle.php' => 1, | |
| 'bjycompat.classmap.php' => 1, | |
| 'style.v1.min.css' => 1, | |
| 'gulp' => 1, | |
| 'tuskredismqbundle.php' => 1, | |
| 'schemacollection.php' => 1, | |
| 'identitymap.php' => 1, | |
| 'baserecord.php' => 1, | |
| 'turretio.php' => 1, | |
| 'css-inliner' => 1, | |
| 'local-script.sh' => 1, | |
| 'runpostdeploy.bat' => 1, | |
| 'ctorsfilesystemcachebundle.php' => 1, | |
| 'twiftycorebundle.php' => 1, | |
| 'license_umc' => 1, | |
| 'multilevelselect.php' => 1, | |
| 'blaze' => 1, | |
| 'carbon-breadcrumbs.php' => 1, | |
| 'wp-hydra.php' => 1, | |
| 'tystrsendgridbundle.php' => 1, | |
| 'tystrreactjsbundle.php' => 1, | |
| 'tystrawsbundle.php' => 1, | |
| 'thunderbird.jpg' => 1, | |
| 'ios.jpg' => 1, | |
| 'websites.json' => 1, | |
| 'tyhandworkflowbundle.php' => 1, | |
| 'tyhanddocumentdownloaderbundle.php' => 1, | |
| 'tyhandbackgroundprocessbundle.php' => 1, | |
| 'composer-test.php' => 1, | |
| 'insurancesdk.php' => 1, | |
| 'twiftyformbundle.php' => 1, | |
| 'twodudeserrorloggerbundle.php' => 1, | |
| 'twodudesaclbundle.php' => 1, | |
| 'sortablecolumn.php' => 1, | |
| 'compatibility-notice.php' => 1, | |
| 'ä¸å›½é“¶è”手机支付枧件使用朇å—.pdf' => 1, | |
| '财付通银衜普通é™é¢åšç¼–ç （å—æ¯åˆ†è¡¨ï¼‰.xls' => 1, | |
| '财付通支付网关商户开å‘朇å—.doc' => 1, | |
| '财付通wap支付网关商户开å‘朇å—.doc' => 1, | |
| '腾讯公å¸è´¢ä»˜é€šwap支付网关商户开å‘朇å—v2.1.doc' => 1, | |
| '更新日志.log' => 1, | |
| '手机网页支付枥入丞使用规则.pdf' => 1, | |
| '手机网页å³æ—¶åˆ°è´¦æž¥å£.pdf' => 1, | |
| 'dropdock' => 1, | |
| 'dropdockrobofile.php' => 1, | |
| 'example-decrypt.php' => 1, | |
| 'updraftplus.php' => 1, | |
| 'cors.php' => 1, | |
| 'codeprettifyasset.php' => 1, | |
| 'formattedfilelogroute.php' => 1, | |
| 'sitechecker' => 1, | |
| 'textareaautosizeasset.php' => 1, | |
| 'scrolltotopasset.php' => 1, | |
| 'scrolltotop.php' => 1, | |
| 'appscrolltotopasset.php' => 1, | |
| 'pace.php' => 1, | |
| 'jqueryscrolltoasset.php' => 1, | |
| 'jquerymousewheelasset.php' => 1, | |
| 'jqueryformasset.php' => 1, | |
| 'jqueryessentialasset.php' => 1, | |
| 'igrowlasset.php' => 1, | |
| 'igrowl.php' => 1, | |
| 'sshot-1.png' => 1, | |
| 'selectcolumn.php' => 1, | |
| 'uran1980fancyboxbundle.php' => 1, | |
| 'game' => 1, | |
| 'logentriesbundle.php' => 1, | |
| 'eveonlinesso.php' => 1, | |
| '.gitignore.swp' => 1, | |
| 'unrlabsecuritybundle.php' => 1, | |
| 'unrlabdomainbundle.php' => 1, | |
| 'execute-tests.sh' => 1, | |
| 'builddefault.xml' => 1, | |
| 'sparrow.php' => 1, | |
| 'tokenbuffer.php' => 1, | |
| 'reflectionannotatedproperty.php' => 1, | |
| 'reflectionannotatedparameter.php' => 1, | |
| 'jsonfieldsbehavior.php' => 1, | |
| 'urodoztranslationunitbundle.php' => 1, | |
| 'reflectionannotatedfunction.php' => 1, | |
| 'ssh_config.php' => 1, | |
| 'queuemodule.php' => 1, | |
| 'develmodule.php' => 1, | |
| 'preview' => 1, | |
| 'metatagscomponent.php' => 1, | |
| 'metatagbehavior.php' => 1, | |
| 'loopcommandbundle.php' => 1, | |
| 'oauthstrategy.php' => 1, | |
| 'iso_codes' => 1, | |
| 'voelkeldatatablesbundle.php' => 1, | |
| 'renderparkingbundle.php' => 1, | |
| 'gfprojectinfobundle.php' => 1, | |
| 'ushiostumblrbundle.php' => 1, | |
| 'ushioselasticsearchbundle.php' => 1, | |
| 'ushiosawsbundle.php' => 1, | |
| 'urodozcachebundle.php' => 1, | |
| 'renderableaddressinterface.php' => 1, | |
| 'geography.php' => 1, | |
| 'markupwistiabundle.php' => 1, | |
| 'markupoembedbundle.php' => 1, | |
| 'markupneedlebundle.php' => 1, | |
| 'markupjobqueuebundle.php' => 1, | |
| 'markupfallbackpasswordencoderbundle.php' => 1, | |
| 'markupbarcodebundle.php' => 1, | |
| 'markupaddressingbundle.php' => 1, | |
| 'rfc' => 1, | |
| 'phpunit_composer.xml' => 1, | |
| 'phpunit_builtin_autoloader.xml' => 1, | |
| 'postpone.php' => 1, | |
| 'urodoztimeexecutionstatsbundle.php' => 1, | |
| 'reflectionannotatedmethod.php' => 1, | |
| 'reflectionannotatedclass.php' => 1, | |
| 'undanetextravalidatorbundle.php' => 1, | |
| 'shellwrapper.sh' => 1, | |
| 'entities.php' => 1, | |
| 'detector.php' => 1, | |
| 'code.php' => 1, | |
| 'char.php' => 1, | |
| 'wp-currencies.php' => 1, | |
| 'uneaktemplatesmanagerbundle.php' => 1, | |
| 'uneakroutesmanagerbundle.php' => 1, | |
| 'uneakformsmanagerbundle.php' => 1, | |
| 'uneakflatskinbundle.php' => 1, | |
| 'cktemplatebundle.php' => 1, | |
| 'uneakblocksmanagerbundle.php' => 1, | |
| 'uneakassetsmanagerbundle.php' => 1, | |
| 'uneakadminbundle.php' => 1, | |
| 'undfzoozpaymentbundle.php' => 1, | |
| 'specs.php' => 1, | |
| 'opentransactionhandler.php' => 1, | |
| 'undfformbundle.php' => 1, | |
| 'picojade.php' => 1, | |
| 'translatenotfound.php' => 1, | |
| 'langiterator.php' => 1, | |
| 'inlinecss.php' => 1, | |
| 'cfg.php' => 1, | |
| 'uecmediavideoproviderbundle.php' => 1, | |
| 'uecmediapdfbundle.php' => 1, | |
| 'extractmode.php' => 1, | |
| 'uecmediaimagebundle.php' => 1, | |
| 'uecmediaevents.php' => 1, | |
| 'uecmediabundle.php' => 1, | |
| 'repr.php' => 1, | |
| 'cool-faces' => 1, | |
| 'reflection.php' => 1, | |
| 'headmodule.php' => 1, | |
| 'parseexception.php' => 1, | |
| 'annotation_build.php' => 1, | |
| 'bootstrap.console.php' => 1, | |
| 'sqlbuilder.php' => 1, | |
| 'sessionhandlerserviceprovider.php' => 1, | |
| 'querylogger.php' => 1, | |
| 'plugininterface.php' => 1, | |
| 'pluggable.php' => 1, | |
| 'permissionmodel.php' => 1, | |
| 'pagermodule.php' => 1, | |
| 'mvcserviceprovider.php' => 1, | |
| 'mutator.php' => 1, | |
| 'morepagermodule.php' => 1, | |
| 'customcontrollerresolver.php' => 1, | |
| 'larathon' => 1, | |
| 'cookieidentity.php' => 1, | |
| 'convertutil.php' => 1, | |
| 'beanmodelformatter.php' => 1, | |
| 'beanmodel.php' => 1, | |
| 'configurationserviceprovider.php' => 1, | |
| 'unknownblisszurbfoundationbundle.php' => 1, | |
| 'unknownblissbootstrapbundle.php' => 1, | |
| 'uamuserbundle.php' => 1, | |
| 'uampropelsessionbundle.php' => 1, | |
| 'mockerytrait.php' => 1, | |
| 'spytrait.php' => 1, | |
| 'watchabletrait.php' => 1, | |
| 'staticshim.php' => 1, | |
| 'react-laravel' => 1, | |
| 'router_ini_factory.php' => 1, | |
| 'alicecontext.php' => 1, | |
| 'versionpress-nginx.conf' => 1, | |
| 'wmcstripebundle.php' => 1, | |
| 'gfunctions.php' => 1, | |
| 'gentry.php' => 1, | |
| 'gdefine.php' => 1, | |
| 'gconfig.php' => 1, | |
| 'pot-generator.php' => 1, | |
| 'required-plugins.php' => 1, | |
| 'mu-require.php' => 1, | |
| 'mu-loader.php' => 1, | |
| 'wmcswiftmailertwigbundle.php' => 1, | |
| 'wmcmenupartbundle.php' => 1, | |
| 'wmcdoctrinenamingstrategybundle.php' => 1, | |
| 'phpunit.xml.coverage.dist' => 1, | |
| 'wmctemplateinroutebundle.php' => 1, | |
| 'wmcmangopaybundle.php' => 1, | |
| 'simplelightncandy.php' => 1, | |
| 'wmcdirectoryloaderbundle.php' => 1, | |
| 'gelfmessage.php' => 1, | |
| 'php-util.phar' => 1, | |
| 'include.inc.php' => 1, | |
| 'changelog_generator.php' => 1, | |
| 'swarm.json' => 1, | |
| 'wordpress-importer.php' => 1, | |
| 'parsers.php' => 1, | |
| 'composer-run-script.gif' => 1, | |
| 'wcm_lang_switch.class.php' => 1, | |
| 'dev_tools.class.php' => 1, | |
| 'create-pot.sh' => 1, | |
| 'strip-naked-logo.png' => 1, | |
| 'abstractlightncandytemplate.php' => 1, | |
| 'dobee.php' => 1, | |
| 'openpptimelinebundle.php' => 1, | |
| 'emoji.png' => 1, | |
| 'whyte624sonataadminextraexportbundle.php' => 1, | |
| 'auto_prepend.php' => 1, | |
| 'whybugfile.ini' => 1, | |
| 'readme-tr' => 1, | |
| 'bbitbootstrapbundle.php' => 1, | |
| 'wp-badge-poser.php' => 1, | |
| 'whisllertechdatabundle.php' => 1, | |
| 'whisnetircbotbundle.php' => 1, | |
| 'whatwedoesrbundle.php' => 1, | |
| 'examples.png' => 1, | |
| 'nyan.gif' => 1, | |
| 'fabify-box.json' => 1, | |
| 'fab-box.json' => 1, | |
| 'emojis.png' => 1, | |
| 'wrpinjectabledoctrinebundle.php' => 1, | |
| 'emojis.php' => 1, | |
| 'whxeditablebundle.php' => 1, | |
| 'whuserbundle.php' => 1, | |
| 'whsmartadminbundle.php' => 1, | |
| 'whorganisationbundle.php' => 1, | |
| 'whmainbundle.php' => 1, | |
| 'whcmsbundle.php' => 1, | |
| 'whblogbundle.php' => 1, | |
| 'what3words.class.php' => 1, | |
| 'sli.php' => 1, | |
| 'satellizer.php' => 1, | |
| 'phoneutils.php' => 1, | |
| 'dddvalidator.php' => 1, | |
| 'polarbear.php' => 1, | |
| 'githooksloader.php' => 1, | |
| 'openpppushnotificationbundle.php' => 1, | |
| 'widopfixturesbundle.php' => 1, | |
| 'migrate-1.5.x' => 1, | |
| 'materializejsasset.php' => 1, | |
| 'materializecssasset.php' => 1, | |
| 'helper' => 1, | |
| 'filemodifier' => 1, | |
| 'analyzefiles' => 1, | |
| 'ipdb.dat' => 1, | |
| 'ip.class.php' => 1, | |
| 'person.json' => 1, | |
| 'webgriffepdftotextbundle.php' => 1, | |
| 'directorynotfoundexception.php' => 1, | |
| 'migrate-1.8.x' => 1, | |
| 'migrate-1.7.x' => 1, | |
| 'migrate-1.6.x' => 1, | |
| 'migrate-1.10.x' => 1, | |
| 'webnetssoauthbundle.php' => 1, | |
| 'view.sublime-project' => 1, | |
| 'translation.sublime-project' => 1, | |
| 'testplate.sublime-project' => 1, | |
| 'webforge-testdata-repository.sublime-project' => 1, | |
| 'webforge-project-stack.sublime-project' => 1, | |
| 'migrate-1.2' => 1, | |
| 'migrate-1.1' => 1, | |
| 'process.sublime-project' => 1, | |
| 'persona.sublime-project' => 1, | |
| 'fatal-error-handler.sublime-project' => 1, | |
| 'webforge-dom.sublime-project' => 1, | |
| 'webforge-console.sublime-project' => 1, | |
| 'webforge-configuration-tester.sublime-project' => 1, | |
| 'webmiltextlanguagedetectbundle.php' => 1, | |
| 'price.sublime-project' => 1, | |
| 'openppoauthserverbundle.php' => 1, | |
| 'sortercolumn.php' => 1, | |
| 'openppmapbundle.php' => 1, | |
| 'yii_production' => 1, | |
| 'seopanelmodule.php' => 1, | |
| 'feedbackmodule.php' => 1, | |
| 'jqtreewidgetasset.php' => 1, | |
| 'jqtreewidget.php' => 1, | |
| 'manymanyupdater.php' => 1, | |
| 'littlebighelper.php' => 1, | |
| 'gridpagesize.php' => 1, | |
| 'gridbulkactions.php' => 1, | |
| 'formfieldsvisibility.php' => 1, | |
| 'cropperhelper.php' => 1, | |
| 'statuscolumn.php' => 1, | |
| 'admindefaultcontroller.php' => 1, | |
| 'price.sublime-workspace' => 1, | |
| 'webuniasseticbundle.php' => 1, | |
| 'servers.yml' => 1, | |
| '.gitignore.install' => 1, | |
| 'onlines.sql' => 1, | |
| 'paypal_ipn.sql' => 1, | |
| 'webstronautsreactbundle.php' => 1, | |
| 'webstronautspusherbundle.php' => 1, | |
| 'instacontent.class.php' => 1, | |
| '.build.xml' => 1, | |
| '.build.properties' => 1, | |
| '.travis.bash' => 1, | |
| 'license-gpl-3.0' => 1, | |
| 'license-bsd-2-clause' => 1, | |
| 'caq.sh' => 1, | |
| 'widopfacebookjsbundle.php' => 1, | |
| 'widopframeworkextrabundle.php' => 1, | |
| 'migrate-1.8' => 1, | |
| 'callbackfilteriterator.php' => 1, | |
| 'wikibasequery.i18n.php' => 1, | |
| 'wikibasequery.i18n.aliases.php' => 1, | |
| 'resources.test.php' => 1, | |
| 'wikibasedatamodel.php' => 1, | |
| 'serialization.php' => 1, | |
| 'diff.mw.php' => 1, | |
| 'datavaluesjavascript.php' => 1, | |
| 'datatypes.mw.php' => 1, | |
| 'askserialization.php' => 1, | |
| 'ask.php' => 1, | |
| 'ask.mw.php' => 1, | |
| 'ask.i18n.php' => 1, | |
| 'hiera.yaml' => 1, | |
| 'wlfrmtwitterbootstrapbundle.php' => 1, | |
| 'querycli' => 1, | |
| 'webglue.php' => 1, | |
| 'wjzijderveldsculpinrelatedcontentbundle.php' => 1, | |
| 'smssign.php' => 1, | |
| 'smscore.php' => 1, | |
| 'ctmsend.php' => 1, | |
| 'antglob' => 1, | |
| 'wizinsimplecmsbundle.php' => 1, | |
| 'wizingeneratorbundle.php' => 1, | |
| 'wizinbasebundle.php' => 1, | |
| 'wizbiipipelinebundle.php' => 1, | |
| 'savchminkpageobjectbundle.php' => 1, | |
| 'wizachauniversignbundle.php' => 1, | |
| 'staging_bootstrap.php' => 1, | |
| 'wikibasequery.php' => 1, | |
| 'init.mw.php' => 1, | |
| 'development_bootstrap.php' => 1, | |
| 'dataset.yaml' => 1, | |
| 'versionpress-functions.php' => 1, | |
| 'wozberedirectbundle.php' => 1, | |
| 'wowoqueuebundle.php' => 1, | |
| 'queueimplementationinterface.php' => 1, | |
| 'wowonewsletterbundle.php' => 1, | |
| 'serializeattributesbehavior.php' => 1, | |
| 'symfonyslackbotbundle.php' => 1, | |
| 'classlist' => 1, | |
| 'wtkvideobundle.php' => 1, | |
| 'videofile.php' => 1, | |
| 'authchoice.php' => 1, | |
| 'plate.php' => 1, | |
| 'woppkeyvaluebundle.php' => 1, | |
| 'woothee' => 1, | |
| 'resources.tests.php' => 1, | |
| 'rpcschema.yml' => 1, | |
| 'rpc.yml' => 1, | |
| 'wwglobalcontainerbundle.php' => 1, | |
| 'sessiontable.sql' => 1, | |
| 'tinymcecontroller.php' => 1, | |
| 'tinymcecodemirrorasset.php' => 1, | |
| 'simple-app-task-def.json' => 1, | |
| 'nginx-site.conf' => 1, | |
| 'smscounter.php' => 1, | |
| 'wobblecoderestbundle.php' => 1, | |
| 'changelong' => 1, | |
| '.gitingnore' => 1, | |
| 'rid.php' => 1, | |
| 'wmdsmindbodyapibundle.php' => 1, | |
| 'production_bootstrap.php' => 1, | |
| 'wispira.php' => 1, | |
| 'githubhookprovider.php' => 1, | |
| 'articlefeedbackv5.activity.php' => 1, | |
| 'specialarticlefeedbackv5.php' => 1, | |
| 'articlefeedbackv5.utils.php' => 1, | |
| 'articlefeedbackv5.render.php' => 1, | |
| 'articlefeedbackv5.php' => 1, | |
| 'articlefeedbackv5.permissions.php' => 1, | |
| 'articlefeedbackv5.model.php' => 1, | |
| 'articlefeedbackv5.mailerjob.php' => 1, | |
| 'articlefeedbackv5.log.php' => 1, | |
| 'articlefeedbackv5.i18n.php' => 1, | |
| 'articlefeedbackv5.hooks.php' => 1, | |
| 'articlefeedbackv5.flagging.php' => 1, | |
| 'articlefeedbackv5.backend.lbfactory.php' => 1, | |
| 'articlefeedbackv5.alias.php' => 1, | |
| 'xenon-log.yaml' => 1, | |
| 'semantichighcharts.i18n.php' => 1, | |
| 'xenon-log.conf' => 1, | |
| 'xenon-log' => 1, | |
| 'xenon-generate-svgs' => 1, | |
| 'arclamp.php' => 1, | |
| 'wbgisgraphybundle.php' => 1, | |
| 'gisgraphyaddress.php' => 1, | |
| 'wbelasticabundle.php' => 1, | |
| 'elasticaclient.php' => 1, | |
| 'datatablesassets.php' => 1, | |
| 'express.class.php' => 1, | |
| 'gymrss.php' => 1, | |
| 'widoptwigextensionsbundle.php' => 1, | |
| 'widopphpbbbundle.php' => 1, | |
| 'specialarticlefeedbackv5watchlist.php' => 1, | |
| 'semantichighcharts.php' => 1, | |
| 'wireshell' => 1, | |
| 'bazingajstranslationbundle.php' => 1, | |
| 'winzoutntexpressbundle.php' => 1, | |
| 'winzoustatemachinebundle.php' => 1, | |
| 'winzouebaysdkbundle.php' => 1, | |
| 'winzoucachebundle.php' => 1, | |
| 'cachefactory.php' => 1, | |
| 't.bat' => 1, | |
| 'queryadapter.php' => 1, | |
| 'phpeffi.cli.php' => 1, | |
| 'joke.php' => 1, | |
| 'carminatogooglecsebundle.php' => 1, | |
| 'hateoas.xsd' => 1, | |
| 'bazingarestextrabundle.php' => 1, | |
| 'bazingaoauthserverbundle.php' => 1, | |
| 'bazingahateoasbundle.php' => 1, | |
| 'semantichighcharts.settings.php' => 1, | |
| 'bazingafakerbundle.php' => 1, | |
| 'amazonproductapi.php' => 1, | |
| 'blade' => 1, | |
| 'generic.css' => 1, | |
| 'infusionsoft.ini.dist' => 1, | |
| 'test_keys.json.example' => 1, | |
| 'wikppaymentmtgoxbundle.php' => 1, | |
| 'formats' => 1, | |
| 'sidebarmenu.settings.php' => 1, | |
| 'sidebarmenu.php' => 1, | |
| 'sidebarmenu.i18n.php' => 1, | |
| 'semanticsifter.php' => 1, | |
| 'semanticsifter.i18n.php' => 1, | |
| 'semanticsifter.i18n.magic.php' => 1, | |
| 'config.sublime-project' => 1, | |
| 'migrate-1.7' => 1, | |
| 'behataliceloader.php' => 1, | |
| 'kp.php' => 1, | |
| 'anubis.php' => 1, | |
| 'jwgl.php' => 1, | |
| 'libraryajax.php' => 1, | |
| 'eswis.php' => 1, | |
| 'vtedpearybundle.php' => 1, | |
| 'signpass' => 1, | |
| 'unisender_api.php' => 1, | |
| 'klbasebundle.php' => 1, | |
| '.maintenance.php' => 1, | |
| 'laravel-translation-manager.wiki' => 1, | |
| 'generators.wiki' => 1, | |
| 'patch.php' => 1, | |
| 'vpxseobundle.php' => 1, | |
| 'tdnforgebundle.php' => 1, | |
| 'baseuser.php' => 1, | |
| 'unit_tests' => 1, | |
| 'readme_2' => 1, | |
| 'purifierbehavior.php' => 1, | |
| 'consolerunner.php' => 1, | |
| 'xeditableassets.php' => 1, | |
| 'tinymcefield.php' => 1, | |
| 'select2field.php' => 1, | |
| 'select2assets.php' => 1, | |
| 'customassets.php' => 1, | |
| 'messagerasset.php' => 1, | |
| 'messager.php' => 1, | |
| 'vfgocardlessenterprisebundle.php' => 1, | |
| 'scrollpagerwrapper.php' => 1, | |
| 'baseloginform.php' => 1, | |
| 'baseuserquery.php' => 1, | |
| 'copyvaluebehavior.php' => 1, | |
| 'c33smenubundle.php' => 1, | |
| 'todo-sql-dump' => 1, | |
| 'todo-customer-repair' => 1, | |
| 'asapotidybundle.php' => 1, | |
| 'whatools.inc.php' => 1, | |
| 'holt45.php' => 1, | |
| 'simple_test.php' => 1, | |
| 'gamifyws.php' => 1, | |
| 'stirling' => 1, | |
| 'filtertab.php' => 1, | |
| 'columnstab.php' => 1, | |
| 'softdelete.php' => 1, | |
| 'c33ssimplegallerybundle.php' => 1, | |
| 'c33ssimplecontentbundle.php' => 1, | |
| 'c33scontactformbundle.php' => 1, | |
| 'timestampbehavior.php' => 1, | |
| 'c33ssymfonyconfigmanipulatorbundle.php' => 1, | |
| 'c33sconstructionkitbundle.php' => 1, | |
| 'c33sattachmentbundle.php' => 1, | |
| 'c33sattachmentadminbundle.php' => 1, | |
| 'daemonexception.php' => 1, | |
| 'vvgfilterlistbundle.php' => 1, | |
| 'testing.php' => 1, | |
| 'markdowncacheexception.php' => 1, | |
| 'markdowncache.php' => 1, | |
| 'boxer.php' => 1, | |
| 'hmvcfilter.php' => 1, | |
| 'hmvccomponent.php' => 1, | |
| 'relatedrecordtrait.php' => 1, | |
| 'relatedrecord.php' => 1, | |
| 'scrollpagerasset.php' => 1, | |
| 'numbers.php' => 1, | |
| 'php-array-kit.php' => 1, | |
| 'edvfilebundle.php' => 1, | |
| 'voce-error-logging.php' => 1, | |
| 'voce-color-setting.php' => 1, | |
| 'voce-cached-nav.php' => 1, | |
| 'post-selection-ui.php' => 1, | |
| 'post-selection-ui.js' => 1, | |
| 'post-selection-ui.css' => 1, | |
| 'objects-to-objects.php' => 1, | |
| 'no-stampede-actions.php' => 1, | |
| 'nginx-secure-media.php' => 1, | |
| 'df' => 1, | |
| 'vmelnikdoctrineencryptbundle.php' => 1, | |
| '.psysh.php' => 1, | |
| 'edvfileevents.php' => 1, | |
| 'cacert.php' => 1, | |
| 'voce-image-setting.php' => 1, | |
| '.shippable.yml' => 1, | |
| 'featuretogglebundle.php' => 1, | |
| 'ladelaslickgridbundle.php' => 1, | |
| 'ladelarequirejsbundle.php' => 1, | |
| 'ladelajqueryuibundle.php' => 1, | |
| 'ladelajquerybundle.php' => 1, | |
| 'ladelaformbundle.php' => 1, | |
| 'ladelabootstrapbundle.php' => 1, | |
| 'phpdocver' => 1, | |
| 'adduseraction.php' => 1, | |
| 'vivaittagbundle.php' => 1, | |
| 'vivaitworkercommandbundle.php' => 1, | |
| 'vivaitsmsmailerbundle.php' => 1, | |
| 'voce-featured-posts.php' => 1, | |
| 'voce-media-setting.php' => 1, | |
| 'executioner.php' => 1, | |
| 'wp-media-modal.php' => 1, | |
| 'editor.php' => 1, | |
| 'alive.php' => 1, | |
| 'notifiable.php' => 1, | |
| 'configregistry.php' => 1, | |
| 'yandexstrategy.php' => 1, | |
| 'command.example.php' => 1, | |
| 'gotopanel.php' => 1, | |
| 'extensionslist.php' => 1, | |
| 'gettext-extractor.php' => 1, | |
| 'wp-twitter-cards.php' => 1, | |
| 'metabox.js' => 1, | |
| 'pluginloader.php' => 1, | |
| 'wp-multisite-sso.php' => 1, | |
| 'wp-media-modal.js' => 1, | |
| 'voce-post-expiration.php' => 1, | |
| 'wp-large-options.php' => 1, | |
| 'wp-generate-new-image-sizes.php' => 1, | |
| 'wp-composition.php' => 1, | |
| 'class-wp-dependency-loader.php' => 1, | |
| 'wp-contextual-help.php' => 1, | |
| 'wp-cache-bucket.php' => 1, | |
| 'voce-widget-cache.php' => 1, | |
| 'voce-theme-customizer.php' => 1, | |
| 'voce-post-pdfs.php' => 1, | |
| 'voce-post-meta.php' => 1, | |
| 'voce-post-meta-psu.php' => 1, | |
| 'voce-post-meta-media.php' => 1, | |
| 'voce-post-meta-colors.php' => 1, | |
| 'voce-post-meta-colors.js' => 1, | |
| 'viewerpdf.php' => 1, | |
| 'uploads.sql' => 1, | |
| 'migrate-1.4' => 1, | |
| 'webeithspamassassinbundle.php' => 1, | |
| 'entity_views.routing.yml' => 1, | |
| 'entity_views.module' => 1, | |
| 'entity_views.info.yml' => 1, | |
| 'circle-checkout.sh' => 1, | |
| 'webfactorywfdmetabundle.php' => 1, | |
| 'metaqueryfactory.php' => 1, | |
| 'metaquery.php' => 1, | |
| 'webfactorypiwikbundle.php' => 1, | |
| 'webfactorynavigationbundle.php' => 1, | |
| 'webfactorylegacyintegrationbundle.php' => 1, | |
| 'webfactoryicutranslationbundle.php' => 1, | |
| 'webfactoryexceptionsbundle.php' => 1, | |
| 'billowrap.php' => 1, | |
| 'webeithimapbundle.php' => 1, | |
| 'entity_views.views.inc' => 1, | |
| 'webeithdnsblbundle.php' => 1, | |
| 'webdevviepheanstalktaskqueuebundle.php' => 1, | |
| 'webdevviepushoverbundle.php' => 1, | |
| 'sanalpos_yapikredi.php' => 1, | |
| 'sanalpos_denizbank3d.php' => 1, | |
| 'amazons3bundle.php' => 1, | |
| '.conveyor' => 1, | |
| 'conveyor.yml.dist' => 1, | |
| 'webburzasyliusgoogleecommercebundle.php' => 1, | |
| 'webburzasyliusarticlebundle.php' => 1, | |
| '新建 文本文档' => 1, | |
| 'updateassets' => 1, | |
| 'webdevignformbundle.php' => 1, | |
| 'entity_views.services.yml' => 1, | |
| 'micro.info.yml' => 1, | |
| 'organize' => 1, | |
| 'fastbill-api.sublime-project' => 1, | |
| 'webforge-collections.sublime-project' => 1, | |
| 'webforge-accounting.sublime-project' => 1, | |
| 'webforge-serializer.sublime-project' => 1, | |
| 'migrate-1.9.xx' => 1, | |
| 'migrate-1.8.xx' => 1, | |
| 'migrate-1.7.xx' => 1, | |
| 'migrate-1.6.xx' => 1, | |
| 'migrate-1.5.xx' => 1, | |
| 'migrate-1.4.xx' => 1, | |
| 'migrate-1.3.xx' => 1, | |
| 'migrate-1.2.xx' => 1, | |
| 'psc-cms-image.sublime-project' => 1, | |
| 'minimock.sublime-project' => 1, | |
| 'roboto.scss' => 1, | |
| 'micro.links.action.yml' => 1, | |
| 'roboto.min.css' => 1, | |
| 'roboto.less' => 1, | |
| 'roboto.css' => 1, | |
| 'open-sans.scss' => 1, | |
| 'open-sans.min.css' => 1, | |
| 'open-sans.less' => 1, | |
| 'open-sans.css' => 1, | |
| 'micro.services.yml' => 1, | |
| 'micro.routing.yml' => 1, | |
| 'micro.permissions.yml' => 1, | |
| 'micro.module' => 1, | |
| 'micro.links.task.yml' => 1, | |
| 'micro.links.menu.yml' => 1, | |
| 'micro.links.contextual.yml' => 1, | |
| 'geobundle.php' => 1, | |
| 'blazy-documentation.html' => 1, | |
| 'wnetouseragentbundle.php' => 1, | |
| 'function.imagecreatefrombmp.php' => 1, | |
| 'options.ru_ru.ini' => 1, | |
| 'morphy.php' => 1, | |
| 'russianplurality.php' => 1, | |
| 'russiannamesdeclension.php' => 1, | |
| 'russiangeneraldeclension.php' => 1, | |
| 'russiancases.php' => 1, | |
| 'russian.php' => 1, | |
| 'englishplurality.php' => 1, | |
| 'cases.php' => 1, | |
| 'basicplurality.php' => 1, | |
| 'basicnamesdeclension.php' => 1, | |
| 'basicdeclension.php' => 1, | |
| 'multithreading.png' => 1, | |
| 'imageeditortools.php' => 1, | |
| 'serverstat.conf' => 1, | |
| 'imageeditor.php' => 1, | |
| 'ccomponent.php' => 1, | |
| 'fork' => 1, | |
| 'wanupsmlrabbitmqbundle.php' => 1, | |
| 'mysqldb.class.php' => 1, | |
| 'wanadevseobundle.php' => 1, | |
| 'walterraj4p5bundle.php' => 1, | |
| 'suite.sh' => 1, | |
| 'suite.php' => 1, | |
| 'elasticsearch-indexer.php' => 1, | |
| 'next_version' => 1, | |
| '.phppm.yml' => 1, | |
| 'waldodatatablebundle.php' => 1, | |
| 'onecloudapi.php' => 1, | |
| 'archive.bat' => 1, | |
| 'background-size.min.htc' => 1, | |
| 'jpusher.php' => 1, | |
| 'webridgeoauth2accessbundle.php' => 1, | |
| 'eg.yml' => 1, | |
| 'bench' => 1, | |
| 'corleyrc4bundle.php' => 1, | |
| 'corleyversionbundle.php' => 1, | |
| 'corleymaintenancebundle.php' => 1, | |
| 'configloader.php' => 1, | |
| 'nestedsetquerybehavior.php' => 1, | |
| 'tradeoffers.php' => 1, | |
| 'steamexception.php' => 1, | |
| 'steamcommunity.php' => 1, | |
| 'market.php' => 1, | |
| 'sqlqueue.php' => 1, | |
| 'asynctaskasset.php' => 1, | |
| 'configurationerror.php' => 1, | |
| 'nativepay.php' => 1, | |
| 'micropay.php' => 1, | |
| 'googleauthenticator.php' => 1, | |
| 'igtbatch.php' => 1, | |
| 'igetui.php' => 1, | |
| 'wasp.class.php' => 1, | |
| 'wa72simplelogger.php' => 1, | |
| 'prettymin.php' => 1, | |
| 'errbit.php' => 1, | |
| 'citrix.php' => 1, | |
| 'flatasset.php' => 1, | |
| 'code-report' => 1, | |
| 'networkerror.php' => 1, | |
| 'filesystemerror.php' => 1, | |
| 'smirikbootstrapbundle.php' => 1, | |
| 'pipelineparserbundle.php' => 1, | |
| 'bow' => 1, | |
| 'falgunphantombundle.php' => 1, | |
| 'instancedecoderinterface.php' => 1, | |
| 'instancedecoder.php' => 1, | |
| 'wixframeworkbundle.php' => 1, | |
| 'sampleranjeet.php' => 1, | |
| 'rdvmigrationbundle.php' => 1, | |
| 'ramseysculpincodeblockbundle.php' => 1, | |
| 'convertlistener.php' => 1, | |
| 'rampforumbundle.php' => 1, | |
| 'raml2html' => 1, | |
| 'ramiropdosybasebundle.php' => 1, | |
| 'mime.types.php' => 1, | |
| 'phpstorm.yml' => 1, | |
| 'raksuldoctrinesettypebundle.php' => 1, | |
| 'imagetool.php' => 1, | |
| 'dumbo.bat' => 1, | |
| 'example-webpage.php' => 1, | |
| 'example-webpage-new.php' => 1, | |
| 'example-plugin-img-resize.php' => 1, | |
| 'example-plugin-compress.php' => 1, | |
| 'example-nested-loop.php' => 1, | |
| 'example-multiple-template-directories.php' => 1, | |
| 'example-extend-class.php' => 1, | |
| 'example-draw-string.php' => 1, | |
| 'example-bootstrap.php' => 1, | |
| 'example-all.php' => 1, | |
| 'raindropuploadbundle.php' => 1, | |
| 'raindroptwigloaderbundle.php' => 1, | |
| 'raindroptranslationbundle.php' => 1, | |
| 'dumbo' => 1, | |
| 'dumbophp.php' => 1, | |
| 'raindropsoapbundle.php' => 1, | |
| 'fastlivefilterasset.php' => 1, | |
| 'authorise-application.php' => 1, | |
| '.config_blank.json' => 1, | |
| 'albopenidserverbundle.php' => 1, | |
| 'quickstart.sh' => 1, | |
| 'baffordelasticaextrabundle.php' => 1, | |
| 'twbsmaxlength.php' => 1, | |
| 'sidrasset.php' => 1, | |
| 'sidr.php' => 1, | |
| 'jpanelmenuasset.php' => 1, | |
| 'jpanelmenu.php' => 1, | |
| 'html5sortable.php' => 1, | |
| 'guidersasset.php' => 1, | |
| 'guiders.php' => 1, | |
| 'fastlivefilter.php' => 1, | |
| 'swactiverecord.php' => 1, | |
| 'bgswitcherasset.php' => 1, | |
| 'bgswitcher.php' => 1, | |
| 'scenario' => 1, | |
| 'swyedconverterdom.php' => 1, | |
| 'swyedconverter.php' => 1, | |
| 'swworkflowsource.php' => 1, | |
| 'swvalidator.php' => 1, | |
| 'swphpworkflowsource.php' => 1, | |
| 'swnode.php' => 1, | |
| 'swhelper.php' => 1, | |
| 'swexception.php' => 1, | |
| 'swevent.php' => 1, | |
| 'swcomponent.php' => 1, | |
| 'swactiverecordbehavior.php' => 1, | |
| 'raindropsyntaxhighlightbundle.php' => 1, | |
| 'raindroppagebundle.php' => 1, | |
| 'test_individual.php' => 1, | |
| 'driverfactory.php' => 1, | |
| 'tssautomailerbundle.php' => 1, | |
| 'tssassetsinstallwindowsbundle.php' => 1, | |
| 'contributing.mb' => 1, | |
| 'changelog.mb' => 1, | |
| 'inflection.php' => 1, | |
| 'providerinterface.php' => 1, | |
| 'oauthproviderfactory.php' => 1, | |
| 'abstractoauthprovider.php' => 1, | |
| 'abstractformatter.php' => 1, | |
| 'abstractadapter.php' => 1, | |
| 'handlerinterface.php' => 1, | |
| 'abstracthandler.php' => 1, | |
| 'definitionresolver.php' => 1, | |
| 'bundles.php' => 1, | |
| 'example_hook2.php' => 1, | |
| 'categoriesbundle.php' => 1, | |
| 'cakeormbundle.php' => 1, | |
| 'rbac.php' => 1, | |
| 'userdetails.php' => 1, | |
| 'authenticationproviderinterface.php' => 1, | |
| 'abstractrepository.php' => 1, | |
| 'abstractauthenticationprovider.php' => 1, | |
| 'radmasvichjmsintegrationbundle.php' => 1, | |
| 'caramel.php' => 1, | |
| 'licenca' => 1, | |
| 'update_1.1.sql' => 1, | |
| 'handlebars.php' => 1, | |
| 'standardize' => 1, | |
| 'example_hook.php' => 1, | |
| 'sari.php' => 1, | |
| 'raindropmobiledetectbundle.php' => 1, | |
| 'virtalimplixapibundle.php' => 1, | |
| 'activedevice.php' => 1, | |
| 'raindroplocalebundleevents.php' => 1, | |
| 'raindroplocalebundle.php' => 1, | |
| 'raindropimportbundle.php' => 1, | |
| 'raindropgeoipbundle.php' => 1, | |
| 'pangulize' => 1, | |
| 'pangulizer.php' => 1, | |
| 'tweech.php' => 1, | |
| 'amazonstrategy.php' => 1, | |
| 'jsonrpcresponse.php' => 1, | |
| 'jsonrpcrequest.php' => 1, | |
| 'jsonrpccall.php' => 1, | |
| 'virtalgoogleapibundle.php' => 1, | |
| 'settingstrait.php' => 1, | |
| 'rcdualloginwpfosbundle.php' => 1, | |
| 'settingsform.php' => 1, | |
| 'materialdesignliteasset.php' => 1, | |
| 'subconta.php' => 1, | |
| 'basic' => 1, | |
| 'rgoubootstrapbundle.php' => 1, | |
| 'rcphpcrseobundle.php' => 1, | |
| 'rcphpcrreordernodesbundle.php' => 1, | |
| 'rcopensslcryptobundle.php' => 1, | |
| 'rcphpcrrouteeventsbundle.php' => 1, | |
| 'rcphpcrmenunodefromroutesbundle.php' => 1, | |
| 'rcphpcrfileattachinlinebundle.php' => 1, | |
| 'rcphpcrautositemapbundle.php' => 1, | |
| 'rcgooglebundle.php' => 1, | |
| 'rcelasticsearchphpcrproviderbundle.php' => 1, | |
| 'redirect-handler.php' => 1, | |
| 'sidebarasset.php' => 1, | |
| 'beanstalkexception.php' => 1, | |
| 'smallgraph.php' => 1, | |
| 'tocgen.php' => 1, | |
| '.tocgen' => 1, | |
| 'ribcage.php' => 1, | |
| 'donate.php' => 1, | |
| 'buy.php' => 1, | |
| 'complete.php' => 1, | |
| 'checker.yml.dist' => 1, | |
| 'checker.yml' => 1, | |
| 'check-tool' => 1, | |
| 'realtyhubinvoicepainterbundle.php' => 1, | |
| 'realtyhubbootstrapbundle.php' => 1, | |
| 'buildall.cmd' => 1, | |
| 'smallstacked.php' => 1, | |
| 'naked.php' => 1, | |
| 'bases.php' => 1, | |
| 'homepage3.php' => 1, | |
| 'example9.php' => 1, | |
| 'example8.php' => 1, | |
| 'example7.php' => 1, | |
| 'example6.php' => 1, | |
| 'example5.php' => 1, | |
| 'example26.php' => 1, | |
| 'example25.php' => 1, | |
| 'example24.php' => 1, | |
| 'example23.php' => 1, | |
| 'example22.php' => 1, | |
| 'example21.php' => 1, | |
| 'example20.php' => 1, | |
| 'tocgen.sh' => 1, | |
| 'chrono.php' => 1, | |
| 'example18.php' => 1, | |
| 'beautifyhtml.php' => 1, | |
| 'love redkitecms (powered by link)' => 1, | |
| 'redkitelabselfinderbundle.php' => 1, | |
| 'redkitelabsbootstrapbundle.php' => 1, | |
| '.twigjs.yml.dist' => 1, | |
| '.pre-commit.yaml' => 1, | |
| 'redcodecurrencyratebundle.php' => 1, | |
| 'templixexception.php' => 1, | |
| 'templix.php' => 1, | |
| 'markupexception.php' => 1, | |
| 'doctype.php' => 1, | |
| 'cssselector.php' => 1, | |
| 'callermarkup.php' => 1, | |
| 'cdata.php' => 1, | |
| 'abstraction.php' => 1, | |
| 'clicolors.php' => 1, | |
| 'matchinterface.php' => 1, | |
| 'frontcontroller.php' => 1, | |
| 'robots_ssl' => 1, | |
| 'robots_cdn' => 1, | |
| 'redcat.php' => 1, | |
| 'artist' => 1, | |
| '.config.php' => 1, | |
| 'gettext_reader.php' => 1, | |
| '__.php' => 1, | |
| 'gettextemulator.php' => 1, | |
| 'acceptlanguage.php' => 1, | |
| 'password-compat.inc.php' => 1, | |
| 'expanderinterface.php' => 1, | |
| 'calltrait.php' => 1, | |
| 'example19.php' => 1, | |
| 'example17.php' => 1, | |
| 'sidebarnav.php' => 1, | |
| 'jeazyuserbundle.php' => 1, | |
| 'r.js' => 1, | |
| 'razorpay.php' => 1, | |
| 'razmomediabundle.php' => 1, | |
| 'string-buffer.php' => 1, | |
| 'nan.php' => 1, | |
| 'leon.php' => 1, | |
| 'infinity.php' => 1, | |
| 'raynetcrm.php' => 1, | |
| 'license.symfony' => 1, | |
| 'license.slim' => 1, | |
| 'license.phly' => 1, | |
| 'jasmini.phar' => 1, | |
| 'guzzlejsonauth.php' => 1, | |
| 'moderntheme.php' => 1, | |
| 'markdownforms.php' => 1, | |
| 'symfony2plugin.php' => 1, | |
| 'extraplugin.php' => 1, | |
| 'ints.php' => 1, | |
| 'samples.sh' => 1, | |
| 'distill-cli' => 1, | |
| 'clashofclansbundle.php' => 1, | |
| 'ratepaypaymentbundle.php' => 1, | |
| 'ratchetio.php' => 1, | |
| 'papprika.php' => 1, | |
| 'custom-admin-language.php' => 1, | |
| 'rasflashalertbundle.php' => 1, | |
| 'basic_functions.php' => 1, | |
| 'raplbundle.php' => 1, | |
| 'init_autoload.php' => 1, | |
| 'phpthumb.config.php' => 1, | |
| 'example16.php' => 1, | |
| 'reactorcodersymfony2nodesocketbundle.php' => 1, | |
| 'example15.php' => 1, | |
| 'example14.php' => 1, | |
| 'example13.php' => 1, | |
| 'example12.php' => 1, | |
| 'example11.php' => 1, | |
| 'example10.php' => 1, | |
| 'markdownify_extra.php' => 1, | |
| 'markdownify_cli.php' => 1, | |
| 'markdownify.php' => 1, | |
| 'license_lgpl' => 1, | |
| 'realestatesolrbundle.php' => 1, | |
| 'realestateconzapiclientbundle.php' => 1, | |
| 'upgrade-0.3' => 1, | |
| 'reactjs.php' => 1, | |
| 'pico_load_plugins_composer.php' => 1, | |
| 'rdrenthtwigextensionbundle.php' => 1, | |
| 'rdrenthtvragebundle.php' => 1, | |
| 'dmstwigextensionbundle.php' => 1, | |
| 'dmsmeetupapibundle.php' => 1, | |
| 'asgi' => 1, | |
| 'redeyestormpathbundle.php' => 1, | |
| 'applicationfinder.php' => 1, | |
| 'variations_default.php' => 1, | |
| 'rcamchartsbundle.php' => 1, | |
| 'rcccsimplepagebundle.php' => 1, | |
| 'rcccjqueryautocompletebundle.php' => 1, | |
| 'rc2cthecallrbundle.php' => 1, | |
| 'rc2cformtwitterbundle.php' => 1, | |
| 'pico_markdown_forms.php' => 1, | |
| 'consolecontroller.php' => 1, | |
| 'beanstalk.php' => 1, | |
| 'migrate-an-alphalemon-cms-theme-to-redkite-cms' => 1, | |
| 'provisioner_license' => 1, | |
| 'psamattservicebuslitebundle.php' => 1, | |
| 'withmagicmethodtrait.php' => 1, | |
| 'mailfacade.php' => 1, | |
| 'langserviceprovider.php' => 1, | |
| 'langfacade.php' => 1, | |
| 'kerneltrait.php' => 1, | |
| 'viewfilenotfoundexception.php' => 1, | |
| 'servicealiasnotfoundexception.php' => 1, | |
| 'controllernotfoundexception.php' => 1, | |
| 'accessnotallowedexception.php' => 1, | |
| 'slayercommand.php' => 1, | |
| 'proyecto404utilbundle.php' => 1, | |
| 'merge_data.php' => 1, | |
| 'mixpanelextended.php' => 1, | |
| 'jparser.komodoproject' => 1, | |
| 'errorlog.html' => 1, | |
| 'wai-aria.js' => 1, | |
| 'aria-walker-nav-menu.php' => 1, | |
| 'protectimus_otp_authentication.php' => 1, | |
| 'example.pot.json' => 1, | |
| 'prepare_tests.sh' => 1, | |
| 'license.phing' => 1, | |
| 'license.propel' => 1, | |
| 'propelaclbundle.php' => 1, | |
| 'pqsdk.php' => 1, | |
| 'bz_category_sticky.php' => 1, | |
| 'feature_lock.module' => 1, | |
| 'feature_lock.info' => 1, | |
| 'psamattyamlexportbundle.php' => 1, | |
| 'migrate-2.2' => 1, | |
| 'prolixmailchimpbundle.php' => 1, | |
| 'metatitle.php' => 1, | |
| 'pspdfbundle.php' => 1, | |
| 'tagswidget.php' => 1, | |
| 'tinytable4ward.php' => 1, | |
| 'tablewizard4ward.php' => 1, | |
| 'settingshelper.php' => 1, | |
| 'modulesettings.php' => 1, | |
| 'pageerror404_redirect4ward.php' => 1, | |
| 'htaccessredirect4ward.php' => 1, | |
| 'quickjump4ward.php' => 1, | |
| 'tagshelper.php' => 1, | |
| 'relatedhelper.php' => 1, | |
| 'multicategorieshelper.php' => 1, | |
| 'mostreadhelper.php' => 1, | |
| 'commentshelper.php' => 1, | |
| 'migrate-2.3' => 1, | |
| 'categorieshelper.php' => 1, | |
| 'authormenuhelper.php' => 1, | |
| 'archivemenuhelper.php' => 1, | |
| 'contentjslidegallery.php' => 1, | |
| 'contaolivereload.php' => 1, | |
| 'lesscssmod.php' => 1, | |
| 'contentcegroupstop.php' => 1, | |
| 'contentcegroup.php' => 1, | |
| 'modulelightbox4wardautoopen.php' => 1, | |
| 'contentlightbox4ward.php' => 1, | |
| 'policytemplateserviceprovider.php' => 1, | |
| 'serien-loader-client.sublime-project' => 1, | |
| 'psc-cms-word.sublime-project' => 1, | |
| 'psc-cms-boot.sublime-project' => 1, | |
| 'feature_lock.api.php' => 1, | |
| 'restmodelcontroller.php' => 1, | |
| 'vagrant.json' => 1, | |
| 'config-advanced.ini' => 1, | |
| 'datacollectioninterface.php' => 1, | |
| 'assetinterface.php' => 1, | |
| 'assetcomposerinterface.php' => 1, | |
| 'assetcomposer.php' => 1, | |
| 'routemanagerinterface.php' => 1, | |
| 'routeabstract.php' => 1, | |
| 'chainmanagerinterface.php' => 1, | |
| 'chainmanager.php' => 1, | |
| 'chaineventinterface.php' => 1, | |
| 'chaineventabstract.php' => 1, | |
| 'stage.php' => 1, | |
| 'pecl-manager.php' => 1, | |
| 'pear-manager.php' => 1, | |
| 'gearmanpeclmanager.php' => 1, | |
| 'priorityqueue.php' => 1, | |
| 'gearmanpearmanager.php' => 1, | |
| 'gearmanmanager.php' => 1, | |
| 'extactiverecord.php' => 1, | |
| 'extarcontroller.php' => 1, | |
| 'privacyidea.json' => 1, | |
| 'prismicbundle.php' => 1, | |
| 'none_composer_loader.php' => 1, | |
| 'prime' => 1, | |
| 'devlog' => 1, | |
| '.gitmergetool' => 1, | |
| '.docpx' => 1, | |
| 'snapshottablebehaviorobjectbuildermodifier.php' => 1, | |
| 'snapshottablebehavior.php' => 1, | |
| 'datacollectiontrait.php' => 1, | |
| 'mathphp.php' => 1, | |
| 'mongodataconnection.php' => 1, | |
| 'env' => 1, | |
| 'modelloader.php' => 1, | |
| 'modelcontroller.php' => 1, | |
| 'iosmodelinterpreter.php' => 1, | |
| 'generatedrestmodelcontrollerloader.php' => 1, | |
| 'errorresponsedictionary.php' => 1, | |
| 'errorresponse.php' => 1, | |
| 'directorymodelloader.php' => 1, | |
| 'directorycontrollerloader.php' => 1, | |
| 'defaultapplicationmodel.php' => 1, | |
| 'defaultapperrors.php' => 1, | |
| 'dataconnection.php' => 1, | |
| 'controllerloader.php' => 1, | |
| 'pmdocumentationbundle.php' => 1, | |
| 'srbacmodule.php' => 1, | |
| 'example.vcf' => 1, | |
| 'progrupasmsbundle.php' => 1, | |
| 'progrupaedifactbundle.php' => 1, | |
| 'valuemenu.php' => 1, | |
| 'menuoption.php' => 1, | |
| 'menuabstract.php' => 1, | |
| 'actionmenu.php' => 1, | |
| 'uploadurlresponse.php' => 1, | |
| 'b2file.php' => 1, | |
| 'b2.php' => 1, | |
| 'tabledumper.php' => 1, | |
| 'databasedumper.php' => 1, | |
| 'write-test.php' => 1, | |
| 'example3.0.vcf' => 1, | |
| 'example2.1.vcf' => 1, | |
| '.env.defaults' => 1, | |
| 'easyrequest.php' => 1, | |
| 'lazycoding.php' => 1, | |
| 'quan-lang.js' => 1, | |
| 'quartetpaymentwebpaybundle.php' => 1, | |
| 'quartetpaymentmanuallybundle.php' => 1, | |
| 'tendo' => 1, | |
| 'exemplecli.php' => 1, | |
| 'brodevvietipsumbundle.php' => 1, | |
| 'user-profile.php' => 1, | |
| 'quan-userdata.php' => 1, | |
| 'userdata.php' => 1, | |
| 'profilepage.php' => 1, | |
| 'twitter.png' => 1, | |
| 'quan-tweet-to-post.php' => 1, | |
| 'postmeta.php' => 1, | |
| 'quan-language.php' => 1, | |
| 'landing-page.php' => 1, | |
| 'configureexception.php' => 1, | |
| 'landing-page.js' => 1, | |
| 'landingpage.php' => 1, | |
| 'quan-jobs.php' => 1, | |
| 'quan-jobs.js' => 1, | |
| 'opgoogleanalytics.php' => 1, | |
| 'quan-image-caption.php' => 1, | |
| 'quan-blockquote.php' => 1, | |
| 'createcpt.php' => 1, | |
| 'boilerplate.php' => 1, | |
| 'mage_modman_generator.sh' => 1, | |
| 'quaderno_webhook.php' => 1, | |
| 'quaderno_tax.php' => 1, | |
| 'quaderno_recurring.php' => 1, | |
| '.bump-version.php' => 1, | |
| 'mockfunction.php' => 1, | |
| 'quaderno_model.php' => 1, | |
| 'jpgraph.php' => 1, | |
| 'schemando' => 1, | |
| 'autoloadforphpunit.php' => 1, | |
| 'ingest.php' => 1, | |
| 'r1pp3rj4ckgooglebundle.php' => 1, | |
| 'ridpagebundle.php' => 1, | |
| 'ridimagetestcase.php' => 1, | |
| 'ridimagebundle.php' => 1, | |
| 'how to create templates' => 1, | |
| 'rithisaddthisbundle.php' => 1, | |
| 'phpword.php' => 1, | |
| 'cloudsearchsearch.php' => 1, | |
| 'cloudsearchclient.php' => 1, | |
| 'modulenotfoundexception.php' => 1, | |
| 'rtmpstream.class.php' => 1, | |
| 'mockfunctiontest.php' => 1, | |
| 'rtmpsocket.class.php' => 1, | |
| 'rtmppacket.class.php' => 1, | |
| 'rtmpoperation.class.php' => 1, | |
| 'rtmpmessage.class.php' => 1, | |
| 'rtmpclient.class.php' => 1, | |
| 'language.config.php' => 1, | |
| 'wikparser.php' => 1, | |
| 'idlabtoolboxbundle.php' => 1, | |
| 'quiubas.php' => 1, | |
| ' .gitattributes' => 1, | |
| 'readme.cmd' => 1, | |
| 'ztest.php' => 1, | |
| 'splitter.php' => 1, | |
| 'qlfontawesomebundle.php' => 1, | |
| 'quaderno_payment.php' => 1, | |
| 'quaderno_load.php' => 1, | |
| 'urlrule.php' => 1, | |
| 'keeper.php' => 1, | |
| 'introjs.php' => 1, | |
| 'pvesseltableconverterbundle.php' => 1, | |
| 'opc.php' => 1, | |
| 'dns.inc.php' => 1, | |
| 'probesysvalidateschemabundle.php' => 1, | |
| 'godcodesbundle.php' => 1, | |
| 'vcloudsdkforphp-license.docx' => 1, | |
| 'license-cc-by' => 1, | |
| 'phpunit-stubs.xml' => 1, | |
| 'servicefactoryinterface.php' => 1, | |
| 'globalcontainer.php' => 1, | |
| 'punic.php' => 1, | |
| 'wmxml.php' => 1, | |
| 'contract.php' => 1, | |
| 'parseargs.php' => 1, | |
| 'streamer.php' => 1, | |
| 'useragents.php' => 1, | |
| 'nagios.phar' => 1, | |
| 'check_load' => 1, | |
| 'dubtureffmpegbundle.php' => 1, | |
| 'dubturecustomeriobundle.php' => 1, | |
| 'dubtureasyncbundle.php' => 1, | |
| 'git-s3' => 1, | |
| 'pulibundle.php' => 1, | |
| 'pug' => 1, | |
| 'pubnub.com.pem' => 1, | |
| 'storage.json' => 1, | |
| 'charmap.php' => 1, | |
| 'commandline.php' => 1, | |
| 'dynamodbsession.php' => 1, | |
| 'quaderno_json.php' => 1, | |
| 'qimnetupdatetrackerbundle.php' => 1, | |
| 'quaderno_item.php' => 1, | |
| 'quaderno_invoice.php' => 1, | |
| 'quaderno_expense.php' => 1, | |
| 'quaderno_estimate.php' => 1, | |
| 'quaderno_document_item.php' => 1, | |
| 'quaderno_document.php' => 1, | |
| 'quaderno_credit.php' => 1, | |
| 'quaderno_contact.php' => 1, | |
| 'quaderno_class.php' => 1, | |
| 'quaderno_base.php' => 1, | |
| 'vextextension.aux' => 1, | |
| 'rifilemanagerbundle.php' => 1, | |
| 'qimnetupdatetrackertestbundle.php' => 1, | |
| 'qimnettablebundle.php' => 1, | |
| 'entityhiddentypebundle.php' => 1, | |
| 'qimnetsolrclienttestbundle.php' => 1, | |
| 'qimnetsolrclientbundle.php' => 1, | |
| 'qimnetpaginatorbundle.php' => 1, | |
| 'qimnetcrudbundle.php' => 1, | |
| 'videomatacmsimperaviredactorpluginasset.php' => 1, | |
| 'tablematacmsimperaviredactorpluginasset.php' => 1, | |
| 'linkmatacmsimperaviredactorpluginasset.php' => 1, | |
| 'imagematacmsimperaviredactorpluginasset.php' => 1, | |
| 'tita.php' => 1, | |
| 'cview.php' => 1, | |
| 'ccontroller.php' => 1, | |
| 'capplication.php' => 1, | |
| 'autocomplete2.jquery.json' => 1, | |
| 'qckraydibundle.php' => 1, | |
| 'migrate-an-alphalemon-cms-block-to-redkite-cms' => 1, | |
| 'migrate-from-alphalemon-cms-to-redkite-cms' => 1, | |
| 'basecrm.php' => 1, | |
| 'run_test.bat' => 1, | |
| 'jsr_server.h' => 1, | |
| 'jsr_server.c' => 1, | |
| 'jsr_list.h' => 1, | |
| 'jsr_list.c' => 1, | |
| 'jsr_epoll.h' => 1, | |
| 'jsr_epoll.c' => 1, | |
| 'jsr_curl.h' => 1, | |
| 'jsr_curl.c' => 1, | |
| 'jsr_client.h' => 1, | |
| 'jsr_client.c' => 1, | |
| 'jsonrpc.c' => 1, | |
| 'boot-sqlite.php' => 1, | |
| 'boot-mysql.php' => 1, | |
| 'digitalframedatetimepickerbundle.php' => 1, | |
| 'jsr_utils.h' => 1, | |
| 'delete-branches.sh' => 1, | |
| 'ghuntihighchartsphpbundle.php' => 1, | |
| 'fly.yaml' => 1, | |
| 'get-composer.sh' => 1, | |
| 'library.tpl' => 1, | |
| 'lib.uuid.php' => 1, | |
| 'changelog-prefork' => 1, | |
| 'rouffjhowtobundle.php' => 1, | |
| 'rotvulpixtransbankbundle.php' => 1, | |
| 'productvalidator.class.php' => 1, | |
| 'tuckconverterbundle.php' => 1, | |
| 'configformatconverter.php' => 1, | |
| 'phrocco' => 1, | |
| 'jsr_utils.c' => 1, | |
| 'jsr_yajl.c' => 1, | |
| 'root.extensions.composer.json' => 1, | |
| 'bcmath.php' => 1, | |
| 'dutchnumbers.php' => 1, | |
| 'rubenrubiobsimpleapicallerbundle.php' => 1, | |
| 'php_serial.class.php' => 1, | |
| 'postalcode.php' => 1, | |
| 'ostmanytoonebundle.php' => 1, | |
| 'examplecsv.png' => 1, | |
| 'happen.php' => 1, | |
| '_.todo' => 1, | |
| 'redis-purger.php' => 1, | |
| 'purger.php' => 1, | |
| 'nginx-helper.php' => 1, | |
| 'travis_install_dependencies.sh' => 1, | |
| 'timers.class.php' => 1, | |
| 'voucherifyclient.php' => 1, | |
| 'jsr_yajl.h' => 1, | |
| 'voucherbuilder.php' => 1, | |
| 'clientexception.php' => 1, | |
| 'fuelcell.gemspec' => 1, | |
| 'sample.eecli.php' => 1, | |
| 'sample.craft-cli.php' => 1, | |
| 'github-release.sh' => 1, | |
| 'bootstrap-ee3.php' => 1, | |
| 'bootstrap-ee2.php' => 1, | |
| 'yajl.php' => 1, | |
| 'yajl.c' => 1, | |
| 'php_yajl.h' => 1, | |
| 'php_cjson.h' => 1, | |
| 'cjson.c' => 1, | |
| 'php_jsonrpc.h' => 1, | |
| 'root.workbench.composer.json' => 1, | |
| 'pluginable.json' => 1, | |
| 'rudakcontactbundle.php' => 1, | |
| 'global-smtp.php' => 1, | |
| 'document.html' => 1, | |
| 'jsajaxfileuploaderasset.php' => 1, | |
| 'jsajaxfileuploader.php' => 1, | |
| 'jqueryupoadfilepluginasset.php' => 1, | |
| 'jqueryupoadfileplugin.php' => 1, | |
| 'dropzonefileuploaderasset.php' => 1, | |
| 'dropzonefileuploader.php' => 1, | |
| 'rfc2397' => 1, | |
| 'queryable' => 1, | |
| 'rcpaiementcmcicbundle.php' => 1, | |
| 'containerinjector.php' => 1, | |
| 'rresqueautoloader.php' => 1, | |
| 'confighandler.php' => 1, | |
| 'readme_pt_br' => 1, | |
| 'eauthmodule.php' => 1, | |
| 'uberloader.php' => 1, | |
| 'php-excel.class.php' => 1, | |
| 'jquery.zclip.js' => 1, | |
| 'zeroclipboard.swf' => 1, | |
| 'box-calculator.js' => 1, | |
| 'box-calculator-test.js' => 1, | |
| 'tsangularjsbundle.php' => 1, | |
| 'rofilsecurityserviceprovider.php' => 1, | |
| 'rofilbootstraptemplateserviceprovider.php' => 1, | |
| 'rofilcontentserviceprovider.php' => 1, | |
| 'rofilcontentrouteserviceprovider.php' => 1, | |
| 'class.smarty.php' => 1, | |
| 'class.login.php' => 1, | |
| 'bookmarksmodule.php' => 1, | |
| 'filesmodule.php' => 1, | |
| 'rthnotificationbundle.php' => 1, | |
| 'findmodeltrait.php' => 1, | |
| 'rthmotorbikebundle.php' => 1, | |
| 'wp-h5bp-htaccess.php' => 1, | |
| 'h5bp-htaccess.conf' => 1, | |
| 'soil.php' => 1, | |
| 'markdown-on-save.php' => 1, | |
| 'telegrambotapi.class.php' => 1, | |
| 'ltredisbundle.php' => 1, | |
| 'screenshot.jpeg' => 1, | |
| 'example-post.php' => 1, | |
| 'wp-rocket-cli.php' => 1, | |
| 'blinkertest.php' => 1, | |
| 'blinker' => 1, | |
| 'observe.php' => 1, | |
| 'php_56' => 1, | |
| 'likesmodule.php' => 1, | |
| 'php_55' => 1, | |
| 'php_54' => 1, | |
| 'snackbarjsnomatasset.php' => 1, | |
| 'snackbarjsasset.php' => 1, | |
| 'bootmaterialjsasset.php' => 1, | |
| 'bootmaterialcssasset.php' => 1, | |
| 'romaricdrigonorchestrabundle.php' => 1, | |
| 'ainnomixredisbundle.php' => 1, | |
| 'ainnomiximagebundle.php' => 1, | |
| 'mpr.php' => 1, | |
| 'belousovchatbundle.php' => 1, | |
| 'urijsasset.php' => 1, | |
| 'usersmodule.php' => 1, | |
| 'pagesmodule.php' => 1, | |
| 'rudakblogbundle.php' => 1, | |
| 'rudakdisclaimerbundle.php' => 1, | |
| '.projections.json' => 1, | |
| 'datetimei18nbehavior.php' => 1, | |
| 'example-proxy-class.php' => 1, | |
| 'unsavedformwidget.php' => 1, | |
| 'yiismart.php' => 1, | |
| 'smartwebmodule.php' => 1, | |
| 'smartformmodel.php' => 1, | |
| 'smartdbcriteria.php' => 1, | |
| 'smartcontroller.php' => 1, | |
| 'smartconsolecommand.php' => 1, | |
| 'smartactiverecord.php' => 1, | |
| 'qtip2.php' => 1, | |
| 'yiiphpthumb.php' => 1, | |
| 'fullcalendareventgroup.php' => 1, | |
| 'i18nbehavior.php' => 1, | |
| 'viewaction.php' => 1, | |
| 'campfire.php' => 1, | |
| 'updateaction.php' => 1, | |
| 'deleteaction.php' => 1, | |
| 'createaction.php' => 1, | |
| 'vcode.php' => 1, | |
| 'sysinfo.php' => 1, | |
| 'russellkutilsbundle.php' => 1, | |
| 'gofsalesbundle.php' => 1, | |
| 'gofproductsbundle.php' => 1, | |
| 'russellkgallerybundle.php' => 1, | |
| 'russellkcategorybundle.php' => 1, | |
| 'gofcartbundle.php' => 1, | |
| 'countdownasset.php' => 1, | |
| 'countdown.php' => 1, | |
| 'sparklingadyenbundle.php' => 1, | |
| 'ruudkcampfireexceptionbundle.php' => 1, | |
| 'stripehelper.php' => 1, | |
| 'oauth2-readme' => 1, | |
| 'schemadump' => 1, | |
| 'db_config_example.json' => 1, | |
| 'phpbench' => 1, | |
| 'docmd' => 1, | |
| 'pupbundle.php' => 1, | |
| 'rybakitnavigationbundle.php' => 1, | |
| 'dandelion.sample.yml' => 1, | |
| 'mixin.php' => 1, | |
| 'emitter.php' => 1, | |
| 'aware.php' => 1, | |
| 'loci.php' => 1, | |
| 'chromosome.php' => 1, | |
| 'razorviewrenderer.php' => 1, | |
| 'eventbrite.php' => 1, | |
| 'ruudkmolliebundle.php' => 1, | |
| 'simplegeneticalgorithm.php' => 1, | |
| '_mgc-event.php' => 1, | |
| 'markupgooglecalendar.module' => 1, | |
| 'googleclientapi.module' => 1, | |
| 'vocabularybundle.php' => 1, | |
| 'atomcmsbundle.php' => 1, | |
| 'deployable' => 1, | |
| 'test-console' => 1, | |
| 'jsonxml.xsd' => 1, | |
| 'framework.json' => 1, | |
| 'ruudymetroniccrudgeneratorbundle.php' => 1, | |
| 'sparklingvatbundle.php' => 1, | |
| 'ruudkpostmarkbundle.php' => 1, | |
| 'ruudkmoneybirdbundle.php' => 1, | |
| 'buttonsgroupinput.php' => 1, | |
| 'stripeform.php' => 1, | |
| 'layout_exemple' => 1, | |
| 'probability.php' => 1, | |
| 'test.11nk5.php' => 1, | |
| 'env.php.orig' => 1, | |
| 'test.vehicles.php' => 1, | |
| 'test.session.php' => 1, | |
| 'test.fuelups.php' => 1, | |
| 'test.fuelup.php' => 1, | |
| 'test.edit.php' => 1, | |
| 'env.php.original' => 1, | |
| 'kakubundle.php' => 1, | |
| 'htmlsectionfield.php' => 1, | |
| 'rudakpartnerbundle.php' => 1, | |
| 'urlmaker.php' => 1, | |
| 'syllabeur.php' => 1, | |
| 'namer.php' => 1, | |
| 'test.br-bounces.php' => 1, | |
| 'fakecontentgenerator.php' => 1, | |
| 'customcanonicalizer.php' => 1, | |
| 'cityhelper.php' => 1, | |
| 'baconipsum.php' => 1, | |
| 'rudakslugbundle.php' => 1, | |
| 'rudakrssbundle.php' => 1, | |
| 'rudakresizerbundle.php' => 1, | |
| 'rudakownloggerbundle.php' => 1, | |
| 'rudakmenubundle.php' => 1, | |
| 'rudakmaintenancebundle.php' => 1, | |
| 'rudakgallerybundle.php' => 1, | |
| 'fakedatageneratorbundle.php' => 1, | |
| 'rudakfacturebundle.php' => 1, | |
| 'test.br-autohelpdesk.php' => 1, | |
| 'test.gherkin.feature.php' => 1, | |
| 'stripecheckoutcustom.php' => 1, | |
| 'ruianseobundle.php' => 1, | |
| 'stripecheckout.php' => 1, | |
| 'ipbehavior.php' => 1, | |
| 'csvexporter.php' => 1, | |
| 'multipleimportstrategy.php' => 1, | |
| 'csvreader.php' => 1, | |
| 'csvimporter.php' => 1, | |
| 'baseimportstrategy.php' => 1, | |
| 'arimportstrategy.php' => 1, | |
| 'runcomeanvalidationbundle.php' => 1, | |
| 'smsproxy.php' => 1, | |
| 'portal.php' => 1, | |
| 'appserviceprovider.php' => 1, | |
| 'daplar' => 1, | |
| 'threema-msgapi-tool.php' => 1, | |
| 'test.gherkin.tablenode.php' => 1, | |
| 'resourceutil.php' => 1, | |
| 'moduleutil.php' => 1, | |
| 'old.composer.json' => 1, | |
| 'readme-jshrink' => 1, | |
| 'magicminifier.php' => 1, | |
| 'defaultcontroller.php' => 1, | |
| 'robo.php' => 1, | |
| 'rubiuscontentfulbundle.php' => 1, | |
| 'rubiusdatatablesbundle.php' => 1, | |
| 'locaload' => 1, | |
| 'autoload-dev.php' => 1, | |
| 'test.volume.php' => 1, | |
| 'test.temperature.php' => 1, | |
| 'test.mileage.php' => 1, | |
| 'class.geoip.php' => 1, | |
| 'symfonycontainerwithzffallback.php' => 1, | |
| 'redkitecmsbundle.php' => 1, | |
| 'rezzzasecuritybundle.php' => 1, | |
| 'rguservoicebundle.php' => 1, | |
| 'rgolarkbundle.php' => 1, | |
| 'rgmusculabundle.php' => 1, | |
| 'guibundle.php' => 1, | |
| 'awtbundle.php' => 1, | |
| 'guzzleservicedesc2to3.php' => 1, | |
| 'exportexcelbundle.php' => 1, | |
| 'functionaltests.xml' => 1, | |
| 'rfedmundsbundle.php' => 1, | |
| 'imagemagick.php' => 1, | |
| 'rezzzacommandbusbundle.php' => 1, | |
| 'rezzzashortybundle.php' => 1, | |
| 'rezzzasepabundle.php' => 1, | |
| 'rezzzarulerbundle.php' => 1, | |
| 'rhapsodyblogbundle.php' => 1, | |
| 'rezzzaprocessonebundle.php' => 1, | |
| 'rezzzapaymentbe2billbundle.php' => 1, | |
| 'rezzzamodelviolationloggerbundle.php' => 1, | |
| 'rezzzamailextrabundle.php' => 1, | |
| 'rezzzamailchimpbundle.php' => 1, | |
| 'rezzzalocalevoterbundle.php' => 1, | |
| 'rezzzajobflowbundle.php' => 1, | |
| 'rezzzaflickrbundle.php' => 1, | |
| 'slirconfig-sample.class.php' => 1, | |
| 'phpunit-debug.sh' => 1, | |
| 'wiki' => 1, | |
| 'example_simple.php' => 1, | |
| 'revinatesequencebundle.php' => 1, | |
| 'uservoicehelper.php' => 1, | |
| 'rhapsodybootstrapbundle.php' => 1, | |
| 'polygonalgraph.jquery.json' => 1, | |
| 'gnu-agpl-3.0' => 1, | |
| 'extendedcontroller.php' => 1, | |
| 'adaptiveview.php' => 1, | |
| 'wp-oo-nonces-plugin.php' => 1, | |
| 'pluggable-functions.php' => 1, | |
| 'rofil-2.php' => 1, | |
| 'rofi' => 1, | |
| 'rofiltemplatemasterbundle.php' => 1, | |
| 'instruction' => 1, | |
| 'oauth2client.php' => 1, | |
| 'rhosocial_test.bat' => 1, | |
| 'rhosocial_test' => 1, | |
| 'rhosocial.bat' => 1, | |
| 'rhosocial' => 1, | |
| 'index.phtml' => 1, | |
| 'rhapsodycommonsbundle.php' => 1, | |
| 'toaster.php' => 1, | |
| 'bitbucket.php' => 1, | |
| 'mozart.php' => 1, | |
| 'rheckmp3bundle.php' => 1, | |
| 'rheckdatatablebundle.php' => 1, | |
| 'rheckaccesscontrolbundle.php' => 1, | |
| 'rhapsodywikibundle.php' => 1, | |
| 'rhapsodysocialevents.php' => 1, | |
| 'rhapsodysocialbundle.php' => 1, | |
| 'rhapsodysetupbundle.php' => 1, | |
| 'rhapsodyphingbundle.php' => 1, | |
| 'rhapsodyforumevents.php' => 1, | |
| 'rhapsodyforumbundle.php' => 1, | |
| 'rhapsodycryptobundle.php' => 1, | |
| 'polygonalgraphwidget.js' => 1, | |
| 'compy.yml' => 1, | |
| 'pixelavengersextravalidatorbundle.php' => 1, | |
| 'jquery.checkboxes.js' => 1, | |
| 'dapsldapbundle.php' => 1, | |
| 'replication.services.yml' => 1, | |
| 'replication.info.yml' => 1, | |
| 'replication.drush.inc' => 1, | |
| 'replicator' => 1, | |
| 'git-deployer.sublime-project' => 1, | |
| 'najidevjavascriptdatabundle.php' => 1, | |
| 'sql23-09-15.sql' => 1, | |
| '.build.yaml' => 1, | |
| 'seo_generator.php' => 1, | |
| 'docker-laravel.sublime-project' => 1, | |
| 'dashboard.css' => 1, | |
| 'jquery.timestamper.js' => 1, | |
| 'redsuns-timeline.php' => 1, | |
| 'easysysconnectormanager.php' => 1, | |
| 'quickfaq.php' => 1, | |
| 'email-config-sample.php' => 1, | |
| 'html_diff.php' => 1, | |
| 'nodes.php' => 1, | |
| 'rednoseyuibundle.php' => 1, | |
| 'rednosekerberosbundle.php' => 1, | |
| 'rednosecombohandlerbundle.php' => 1, | |
| 'rednoseapidocbundle.php' => 1, | |
| 'redmonsterannouncementbundle.php' => 1, | |
| 'redkitelabsthemeenginebundle.php' => 1, | |
| 'upgrade-to-symfony-2.3' => 1, | |
| 'upgrade-from-redkite-cms-1-1-1' => 1, | |
| 'update-from-redkite-cms-beta-1' => 1, | |
| 'serverloadbundle.php' => 1, | |
| 'remdaneasysysconnectorbundle.php' => 1, | |
| 'emysqlmutex.php' => 1, | |
| 'config.sample.json' => 1, | |
| 'efilemutex.php' => 1, | |
| 'edbmutex.php' => 1, | |
| 'ruleset.xml.dist' => 1, | |
| 'pharse_xml2array.php' => 1, | |
| 'pharse_tokenizer.php' => 1, | |
| 'pharse_selector_html.php' => 1, | |
| 'pharse_parser_html.php' => 1, | |
| 'pharse_node_html.php' => 1, | |
| 'pharse_formatter.php' => 1, | |
| 'pharse.php' => 1, | |
| 'filetableparser.php' => 1, | |
| 'researchsquarestrategy.php' => 1, | |
| 'phpnsc' => 1, | |
| 'reoringimagebundle.php' => 1, | |
| 'remedgeyandextranslatebundle.php' => 1, | |
| 'renusmediabundle.php' => 1, | |
| 'renuslasttweetbundle.php' => 1, | |
| 'themebootstrapbundle.php' => 1, | |
| 'phpexcelformatter.php' => 1, | |
| 'phpdoc.bat' => 1, | |
| 'depipe.yml.dist' => 1, | |
| 'configen' => 1, | |
| 'routeros_api.class.php' => 1, | |
| 'maremetlbundle.php' => 1, | |
| '.qualitychecker.yml.dist' => 1, | |
| '.qualitychecker.yml' => 1, | |
| 'bootstrapdatepicker.php' => 1, | |
| 'smartloader.php' => 1, | |
| 'riakbundle.php' => 1, | |
| 'restfulrouter.php' => 1, | |
| 'ricbradiscogsbundle.php' => 1, | |
| 'containerbridge.php' => 1, | |
| 'license.newbsd' => 1, | |
| 'rbadminbundle.php' => 1, | |
| 'doyoubuzzstrategy.php' => 1, | |
| 'ext-neptune.js' => 1, | |
| 'ext-neptune-debug.js' => 1, | |
| 'ext-neptune-debug-w-comments.js' => 1, | |
| 'timecircles.jquery.json' => 1, | |
| 'soap-wsa.php' => 1, | |
| 'soap-server-wsse.php' => 1, | |
| 'wp_import.php' => 1, | |
| 'html_to_markdown.php' => 1, | |
| 'slim.concept-class' => 1, | |
| 'r47twitter.php' => 1, | |
| 'r47sensioconnect.php' => 1, | |
| 'phpunittests.xml.dist' => 1, | |
| 'rbblogbundle.php' => 1, | |
| 'phpmanipulator.xml' => 1, | |
| 'checker.sh' => 1, | |
| 'git_contributor-activity.png' => 1, | |
| 'frontend.png' => 1, | |
| 'test.dat' => 1, | |
| 'project.sh' => 1, | |
| 'bcrypt_generator.php' => 1, | |
| 'xf' => 1, | |
| 'tinymceelfinderpopupaction.php' => 1, | |
| 'serverfileinputelfinderpopupaction.php' => 1, | |
| 'elfinderhelper.php' => 1, | |
| 'themoneyconverterexchangerates.php' => 1, | |
| 'redimlive.php' => 1, | |
| 'rbadminbundle___.php' => 1, | |
| 'rbbowerbundle.php' => 1, | |
| 'rnijveldsf2codebundle.php' => 1, | |
| 'parser.y' => 1, | |
| 'rodgermdstravaclientbundle.php' => 1, | |
| 'sofortbundle.php' => 1, | |
| 'contestnominationsbundle.php' => 1, | |
| 'rodgermduniquenotnullentitybundle.php' => 1, | |
| 'rodgermdsftoolsbundle.php' => 1, | |
| 'rodgermdmailchimpwrapperbundle.php' => 1, | |
| 'rodgermdibanapidebundle.php' => 1, | |
| 'rodgermdcompassbundle.php' => 1, | |
| 'pwgen.php' => 1, | |
| 'stc.php' => 1, | |
| 'short-tag-converter' => 1, | |
| 'growlnotifier.php' => 1, | |
| 'dbusnotifier.php' => 1, | |
| 'rodchynelephantbundle.php' => 1, | |
| 'rbcorebundle.php' => 1, | |
| 'tecbotamfbundle.php' => 1, | |
| 'rbuserbundle.php' => 1, | |
| 'rbtransbundle.php' => 1, | |
| 'rbshopbundle.php' => 1, | |
| 'rbproductbundle.php' => 1, | |
| 'rbproductadminbundle.php' => 1, | |
| 'rborderbundle.php' => 1, | |
| 'rborderadminbundle.php' => 1, | |
| 'rbnotebundle.php' => 1, | |
| 'rbmenubundle.php' => 1, | |
| 'rbfrontbundle.php' => 1, | |
| 'rbfixbundle.php' => 1, | |
| 'rbfixadminbundle.php' => 1, | |
| 'rbdevbundle.php' => 1, | |
| 'giftvoucher.php' => 1, | |
| 'steamstrategy.php' => 1, | |
| 'ricbrakissmetricsbundle.php' => 1, | |
| 'liveui.php' => 1, | |
| 'rithiswebsiteindexbundle.php' => 1, | |
| 'rithisbootstrapbundle.php' => 1, | |
| 'rutkaifeatureflipperbundle.php' => 1, | |
| 'sphinx-tool.php' => 1, | |
| 'help-img.png' => 1, | |
| 'banhmi-framework.php' => 1, | |
| 'ringophpredmonbundle.php' => 1, | |
| 'gh-pages_deploy.sh' => 1, | |
| 'oz.sql' => 1, | |
| 'bootstrap-paginator.latte' => 1, | |
| 'riki34symfonyangularentitiesbundle.php' => 1, | |
| 'sail-theme.yaml' => 1, | |
| 'liveui_html_page.php' => 1, | |
| 'class.liveui.php' => 1, | |
| 'yahoojpstrategy.php' => 1, | |
| 'magentoconnect.html' => 1, | |
| 'numbers2wordsbundle.php' => 1, | |
| 'notificatobundle.php' => 1, | |
| 'wiki.php' => 1, | |
| 'socialsecuritynumbervalidator.php' => 1, | |
| 'socialsecuritynumber.php' => 1, | |
| 'test-extensions.php' => 1, | |
| 'sassloader.php' => 1, | |
| 'tokenizerasset.php' => 1, | |
| 'box.json.sample' => 1, | |
| 'rdfjobdefinitionformatbundle.php' => 1, | |
| 'defaultautoload.php' => 1, | |
| 'ricbrarobotstxtbundle.php' => 1, | |
| 'mixistrategy.php' => 1, | |
| 'helper_functions.php' => 1, | |
| 'redditstrategy.php' => 1, | |
| 'letterexception.php' => 1, | |
| 'rmzamoraoauthbundle.php' => 1, | |
| 'rmzamorajquerybundle.php' => 1, | |
| 'rmzamoraformextensionbundle.php' => 1, | |
| 'rmzamorabootstrapbundle.php' => 1, | |
| 'cryptxxtea.php' => 1, | |
| 'ulogin.php' => 1, | |
| 'socicon.php' => 1, | |
| 'si.php' => 1, | |
| 'rbacmigration.php' => 1, | |
| 'rbacfactory.php' => 1, | |
| 'powermigration.php' => 1, | |
| 'viewletter.php' => 1, | |
| 'rawletter.php' => 1, | |
| 'letter.php' => 1, | |
| 'yuccainsituupdaterbundle.php' => 1, | |
| 'ionicon.php' => 1, | |
| 'fa.php' => 1, | |
| 'cdnassetbundle.php' => 1, | |
| 'imagewrapper.php' => 1, | |
| 'favicon.php' => 1, | |
| 'nmadflybundle.php' => 1, | |
| '.travis.database.yml' => 1, | |
| 'saxfactory.php' => 1, | |
| 'raisenowsaxbundle.php' => 1, | |
| 'randomkeybehavior.php' => 1, | |
| 'data-sample.php' => 1, | |
| 'ip.lib.php' => 1, | |
| 'combine.sh' => 1, | |
| 'readme_without_lines' => 1, | |
| 'errorhandlerbundle.php' => 1, | |
| 'build.views.xml' => 1, | |
| 'rzblockbundle.php' => 1, | |
| 'mopabarcodebundle.php' => 1, | |
| 'localasset.php' => 1, | |
| 'backboneasset.php' => 1, | |
| 'philippeaelliguikitbundle.php' => 1, | |
| 'kitpagesgooglemapsbundle.php' => 1, | |
| 'wp-ajax-helper.php' => 1, | |
| 'widget-output-filters.php' => 1, | |
| 'vagrant_transient.phar' => 1, | |
| 'sanitize.phar' => 1, | |
| 'sanitize.json' => 1, | |
| 'mnsqueue.php' => 1, | |
| 'readme-symfony-standard' => 1, | |
| 'mopawsseauthenticationbundle.php' => 1, | |
| 'moparemoteupdatebundle.php' => 1, | |
| 'i18nurlmanager.php' => 1, | |
| 'jqmobileasset.php' => 1, | |
| 'geophp.inc' => 1, | |
| 'widgetfy.php' => 1, | |
| 'tman.example' => 1, | |
| 'pharmonic' => 1, | |
| 'imageprocessing.php' => 1, | |
| 'fileprocessing.php' => 1, | |
| 'footerwidget.php' => 1, | |
| 'headerwidget.php' => 1, | |
| 'brood' => 1, | |
| 'install-nosudo' => 1, | |
| 'windows' => 1, | |
| 'db_model.erm' => 1, | |
| 'sansiscorebasebundle.php' => 1, | |
| 'yii2dynatable.php' => 1, | |
| 'yiijquerytoc.php' => 1, | |
| 'philgeolocationbundle.php' => 1, | |
| 'yii2pinitasset.php' => 1, | |
| 'p2bootstrapbundle.php' => 1, | |
| 'core-builder.xml' => 1, | |
| 'yiiwymeditor.php' => 1, | |
| 'yii2visjs.php' => 1, | |
| 'yii2tooltipsterasset.php' => 1, | |
| 'yii2tooltipster.php' => 1, | |
| 'yii2toolbarbuttonasset.php' => 1, | |
| 'yii2toolbarbutton.php' => 1, | |
| 'yii2snapsvg.php' => 1, | |
| 'yii2sly.php' => 1, | |
| 'slyasset.php' => 1, | |
| 'yii2slidebars.php' => 1, | |
| 'slidebarsasset.php' => 1, | |
| 'yii2pinit.php' => 1, | |
| 'yii2textareaautosize.php' => 1, | |
| 'yii2masonryasset.php' => 1, | |
| 'yii2masonry.php' => 1, | |
| 'yii2imagesloadedasset.php' => 1, | |
| 'yii2instafeedasset.php' => 1, | |
| 'yii2instafeed.php' => 1, | |
| 'yii2imagesliderasset.php' => 1, | |
| 'yii2imageslider.php' => 1, | |
| 'yii2fullpagejsasset.php' => 1, | |
| 'yii2fullpagejs.php' => 1, | |
| 'yii2fullcalendarscheduler.php' => 1, | |
| 'yii2feedback.php' => 1, | |
| 'yii2extblocksitasset.php' => 1, | |
| 'yii2extblocksit.php' => 1, | |
| 'yii2elfinder.php' => 1, | |
| 'philguzzlebundle.php' => 1, | |
| 'philbasebundle.php' => 1, | |
| 'mediastorageinterface.php' => 1, | |
| 'phpdoctor.html' => 1, | |
| 'performervagrantbundle.php' => 1, | |
| 'performerreruserbundle.php' => 1, | |
| 'perficocorebundle.php' => 1, | |
| 'domcreator.php' => 1, | |
| 'google-places.png' => 1, | |
| 'beet' => 1, | |
| 'yiidebugcacheproxy.php' => 1, | |
| 'yiicsol.php' => 1, | |
| 'sagesignerbundle.php' => 1, | |
| 'peg.php' => 1, | |
| 'peg.bat' => 1, | |
| 'peg' => 1, | |
| 'phpdoc.php' => 1, | |
| 'phpdoctor.tags.html' => 1, | |
| 'message.png' => 1, | |
| 'pkj-page-source.pot' => 1, | |
| 'pkj-page-source-nb_no.po' => 1, | |
| 'pkj-page-source-nb_no.mo' => 1, | |
| 'linuxbackups' => 1, | |
| 'siterfrontendeditingbundle.php' => 1, | |
| 'loaddatabase.php' => 1, | |
| 'limp' => 1, | |
| 'appcache.manifest' => 1, | |
| 'assets-database.sspak' => 1, | |
| 'api-0.1.0' => 1, | |
| 'release-1.0.0a5' => 1, | |
| 'release-1.0.0a4' => 1, | |
| 'release-1.0.0a3' => 1, | |
| 'leo.png' => 1, | |
| 'concurrent.png' => 1, | |
| 'qrcode2.png' => 1, | |
| 'pagevisibilityasset.php' => 1, | |
| 'qrcode.png' => 1, | |
| 'ruiantwitterbootstrapbundle.php' => 1, | |
| 'prgportabledocumentbundle.php' => 1, | |
| 'ineatconseildynamicbundle.php' => 1, | |
| 'commandexception.php' => 1, | |
| 'pfhomesteadbundle.php' => 1, | |
| 'webfinger.php' => 1, | |
| 'bondoraapi.php' => 1, | |
| 'statsd-console' => 1, | |
| 'starcraftconnectionlayerbundle.php' => 1, | |
| 'cargallerycorebundle.php' => 1, | |
| 'blizzardapibundle.php' => 1, | |
| 'petitpflotbundle.php' => 1, | |
| 'goreblogbundle.php' => 1, | |
| 'dot.png' => 1, | |
| 'paginationpagerbundle.php' => 1, | |
| 'clipcloptest.php' => 1, | |
| 'clipclop.php' => 1, | |
| 'credittransfer.php' => 1, | |
| 'yii2getid3.php' => 1, | |
| 'scorchasset.php' => 1, | |
| 'cities' => 1, | |
| 'cidr_optim' => 1, | |
| 'arraytransformer.php' => 1, | |
| 'perimetercachebundle.php' => 1, | |
| 'vhost.dist.conf' => 1, | |
| 'output-sample.png' => 1, | |
| 'watcher.gif' => 1, | |
| 'usage.png' => 1, | |
| 'googlegeocoding.php' => 1, | |
| 'p2ratchetbundle.php' => 1, | |
| 'release-1.0.0a1' => 1, | |
| 'file.source.txt.twig' => 1, | |
| 'update-components.php' => 1, | |
| 'stree.sh' => 1, | |
| 'page_header.xsl' => 1, | |
| 'package.html.twig' => 1, | |
| 'method.html.twig' => 1, | |
| 'search.xsl' => 1, | |
| 'parse_markers.xsl' => 1, | |
| 'menu.xsl' => 1, | |
| 'markers.xsl' => 1, | |
| 'file.xsl' => 1, | |
| 'classgraph.xsl' => 1, | |
| 'ajax_search.php' => 1, | |
| 'interface.html.twig' => 1, | |
| 'file.html.twig' => 1, | |
| 'phpassert' => 1, | |
| 'report_parse_markers.xsl' => 1, | |
| 'report_markers.xsl' => 1, | |
| 'report_deprecated.xsl' => 1, | |
| 'helpers.xsl' => 1, | |
| 'graph_class.xsl' => 1, | |
| 'api-doc.xsl' => 1, | |
| 'vcrvcrbundle.php' => 1, | |
| 'main.sh' => 1, | |
| 'php_riak_stub.iml' => 1, | |
| 'resquebundle.php' => 1, | |
| '.alias' => 1, | |
| 'pletnevprojectmanagerbundle.php' => 1, | |
| 'jautoload.php' => 1, | |
| 'run_examples.php' => 1, | |
| 'subscriptions.php' => 1, | |
| 'luguibundle.php' => 1, | |
| 'phpbrew.asc' => 1, | |
| 'namiadminbundle.php' => 1, | |
| 'entityrepository.php' => 1, | |
| 'doctrinehelper.php' => 1, | |
| 'gearsdoc' => 1, | |
| 'flags.png' => 1, | |
| 'flags.css' => 1, | |
| 'fixer.bat' => 1, | |
| 'bootstrap.dist.php' => 1, | |
| 'update-constants.php' => 1, | |
| 'sonarqube-ant-task-2.4.jar' => 1, | |
| 'phpcq.main.xml' => 1, | |
| 'license.bsd-3-clause' => 1, | |
| 'revert.php' => 1, | |
| 'phpbrew' => 1, | |
| 'tracking.php' => 1, | |
| 'readme.pt-br' => 1, | |
| 'viewonline_helper.php' => 1, | |
| 'version_helper.php' => 1, | |
| 'user_loader.php' => 1, | |
| 'symfony_request.php' => 1, | |
| 'recursive_dot_prefix_filter_iterator.php' => 1, | |
| 'path_helper.php' => 1, | |
| 'file_downloader.php' => 1, | |
| 'error_collector.php' => 1, | |
| 'content_visibility.php' => 1, | |
| 'config_php_file.php' => 1, | |
| 'class_loader.php' => 1, | |
| 'phpbbsessionsauthbundle.php' => 1, | |
| 'versions.php' => 1, | |
| 'curl.xml' => 1, | |
| 'lugstoragebundle.php' => 1, | |
| 'p2securitybundle.php' => 1, | |
| 'phoxy.js' => 1, | |
| 'singletone.ejs' => 1, | |
| 'require.ejs' => 1, | |
| 'head.ejs' => 1, | |
| 'empty.ejs' => 1, | |
| 'echo.ejs' => 1, | |
| 'each.ejs' => 1, | |
| 'delay.ejs' => 1, | |
| 'data_download.ejs' => 1, | |
| 'chain.ejs' => 1, | |
| 'virtual_namespace_helper.php' => 1, | |
| 'rpc_string_parser.php' => 1, | |
| 'phoxy_return_worker.php' => 1, | |
| 'phoxy.php' => 1, | |
| 'enjs.php' => 1, | |
| 'abstractcachepool.php' => 1, | |
| 'coldstart.php' => 1, | |
| 'enjs.js' => 1, | |
| 'repositoryserviceprovider.php' => 1, | |
| 'whmhypebundle.php' => 1, | |
| 'namedparameters.php' => 1, | |
| 'cqchecks.json' => 1, | |
| 'settings.dist.yml' => 1, | |
| 'phillip' => 1, | |
| '.phillip.yml' => 1, | |
| 'voterinterface.php' => 1, | |
| 'voteableinterface.php' => 1, | |
| 'voteinterface.php' => 1, | |
| 'votealgorithminterface.php' => 1, | |
| 'php-doc notes' => 1, | |
| 'hasexpirationdateinterface.php' => 1, | |
| 'lugregistrybundle.php' => 1, | |
| 'taggableiteminterface.php' => 1, | |
| 'lugadminbundle.php' => 1, | |
| 'httplugfactory.php' => 1, | |
| 'httplugbundle.php' => 1, | |
| 'helix' => 1, | |
| 'documenting' => 1, | |
| '.php_cs_psr2r' => 1, | |
| 'commonvalueobjectbundle.php' => 1, | |
| 'generate_messages.sh' => 1, | |
| 'voidcachepool.php' => 1, | |
| 'taggablepooltrait.php' => 1, | |
| 'taggablepoolinterface.php' => 1, | |
| 'taggablepsr6pooladapter.php' => 1, | |
| 'taggablepsr6itemadapter.php' => 1, | |
| 'psr6sessionhandler.php' => 1, | |
| 'apccachepool.php' => 1, | |
| 'rediscachepool.php' => 1, | |
| 'prediscachepool.php' => 1, | |
| 'namespacedcachepool.php' => 1, | |
| 'mongodbcachepool.php' => 1, | |
| 'memcachedcachepool.php' => 1, | |
| 'memcachecachepool.php' => 1, | |
| 'hierarchicalpoolinterface.php' => 1, | |
| 'hierarchicalcachepooltrait.php' => 1, | |
| 'filesystemcachepool.php' => 1, | |
| 'doctrinecachebridge.php' => 1, | |
| 'doctrinecachepool.php' => 1, | |
| 'cachepoolchain.php' => 1, | |
| 'arraycachepool.php' => 1, | |
| 'apcucachepool.php' => 1, | |
| 'release-1.0.0a2' => 1, | |
| 'release-1.0.0b5' => 1, | |
| 'nami.postman_collection' => 1, | |
| 'how-to-test' => 1, | |
| 'openpayudomain.php' => 1, | |
| 'openpayubase.php' => 1, | |
| 'palapimagetagbundle.php' => 1, | |
| 'test.properties' => 1, | |
| 'serviceinjection.php' => 1, | |
| 'functionaltestcase.php' => 1, | |
| 'imap.php' => 1, | |
| 'remotefileloaderinterface.php' => 1, | |
| 'remotefileloaderfactory.php' => 1, | |
| 'partkeeprremotefileloaderbundle.php' => 1, | |
| 'nousableremotefileloaderexception.php' => 1, | |
| 'curlloader.php' => 1, | |
| 'mailobfuscator.php' => 1, | |
| 'persiandatepickerasset.php' => 1, | |
| 'openpayuoauth.php' => 1, | |
| 'persiandatepicker.php' => 1, | |
| 'sendloop.php' => 1, | |
| 'exam.php' => 1, | |
| 'twuzzleclient.php' => 1, | |
| 'parkjitwitterloginbundle.php' => 1, | |
| 'bundle-readme' => 1, | |
| 'parasyslogreaderbundle.php' => 1, | |
| 'cs-ruleset.xml' => 1, | |
| 'paramonovavspresshtmlcompress.php' => 1, | |
| 'errata' => 1, | |
| 'pharaoh' => 1, | |
| 'phpbuiltinwebserver.php' => 1, | |
| 'presenterexception.php' => 1, | |
| 'openpayunetwork.php' => 1, | |
| 'pasintercmsbundle.php' => 1, | |
| 'noticeserviceprovider.php' => 1, | |
| 'page_example.info.yml' => 1, | |
| 'signrequestinterface.php' => 1, | |
| 'signrequest.php' => 1, | |
| 'registerresponseinterface.php' => 1, | |
| 'registerresponse.php' => 1, | |
| 'registerrequestinterface.php' => 1, | |
| 'registerrequest.php' => 1, | |
| 'authenticationresponseinterface.php' => 1, | |
| 'authenticationresponse.php' => 1, | |
| 'travis.bootstrap.php' => 1, | |
| 'page_example.routing.yml' => 1, | |
| 'page_example.permissions.yml' => 1, | |
| 'page_example.module' => 1, | |
| 'page_example.links.menu.yml' => 1, | |
| 'mcgroovinmultivariatetestsbundle.php' => 1, | |
| 'pasinterredisohmbundle.php' => 1, | |
| 'postinstall.php' => 1, | |
| 'exacttargetlaravelconfig.php' => 1, | |
| 'flatline' => 1, | |
| 'requests.php' => 1, | |
| 'oca.php' => 1, | |
| 'patlenaingasjqueryuibundle.php' => 1, | |
| 'patlenaingasjquerybundle.php' => 1, | |
| 'phpdoc2rst.php' => 1, | |
| 'patgod85phpdoc2rstbundle.php' => 1, | |
| 'bgpersonabundle.php' => 1, | |
| 'license.tcpdf' => 1, | |
| 'base2dbarcode.php' => 1, | |
| 'base1dbarcode.php' => 1, | |
| 'barcodebundle.php' => 1, | |
| 'presentable.php' => 1, | |
| 'noticefacade.php' => 1, | |
| 'u2f_interface.php' => 1, | |
| 'mediadb.php' => 1, | |
| 'box_catalog_navigation.css' => 1, | |
| 'box_catalog_limited_content.css' => 1, | |
| 'box_catalog_azlist.css' => 1, | |
| 'box_calendar.css' => 1, | |
| 'basic.css' => 1, | |
| 'dist.papaya.php' => 1, | |
| 'dist.build.properties' => 1, | |
| 'xmltree.php' => 1, | |
| 'phrases.php' => 1, | |
| 'msgbox.php' => 1, | |
| 'modglyph.php' => 1, | |
| 'mediamime.php' => 1, | |
| 'mediafilebrw.php' => 1, | |
| 'log_auth.php' => 1, | |
| 'box_categteaser.css' => 1, | |
| 'linktypes.php' => 1, | |
| 'inc.version.php' => 1, | |
| 'inc.glyphs.php' => 1, | |
| 'inc.func.php' => 1, | |
| 'inc.footer.php' => 1, | |
| 'inc.conf.php' => 1, | |
| 'inc.auth.php' => 1, | |
| 'inc.application.php' => 1, | |
| 'imggen.php' => 1, | |
| 'glyphview.php' => 1, | |
| 'end.php' => 1, | |
| 'cronexec.php' => 1, | |
| 'boxes.php' => 1, | |
| 'box_catalog_related_list.css' => 1, | |
| 'box_contact_list.css' => 1, | |
| 'mailableinterface.php' => 1, | |
| 'page_faq.css' => 1, | |
| 'global.css' => 1, | |
| 'tinymce.css' => 1, | |
| 'page_wiki.css' => 1, | |
| 'page_thumbs.css' => 1, | |
| 'page_stickers.css' => 1, | |
| 'page_sitemap.css' => 1, | |
| 'page_quiz.css' => 1, | |
| 'page_poll.css' => 1, | |
| 'page_mnogo.css' => 1, | |
| 'page_include.css' => 1, | |
| 'page_forum.css' => 1, | |
| 'page_files.css' => 1, | |
| 'page_feedback.css' => 1, | |
| 'page_community.css' => 1, | |
| 'box_contact_online.css' => 1, | |
| 'page_catalog.css' => 1, | |
| 'page_calendar.css' => 1, | |
| 'ie7.css' => 1, | |
| 'ie6win.css' => 1, | |
| 'default48.jpg' => 1, | |
| 'default100.jpg' => 1, | |
| 'colors.css' => 1, | |
| 'box_stickers.css' => 1, | |
| 'box_quiz.css' => 1, | |
| 'box_poll.css' => 1, | |
| 'box_navigation.css' => 1, | |
| 'box_mnogo.css' => 1, | |
| 'box_linkdb.css' => 1, | |
| 'box_forum.css' => 1, | |
| 'u2f.php' => 1, | |
| 'index.dist.php' => 1, | |
| 'release-1.0.0b4' => 1, | |
| 'amqp_exchange.h' => 1, | |
| 'build-phing.xml' => 1, | |
| 'combinatorics.php' => 1, | |
| 'sync-php4' => 1, | |
| 'logon.php' => 1, | |
| 'live_phpunit.sh.example' => 1, | |
| 'example_subset_ruleset.xml' => 1, | |
| 'samlbundle.php' => 1, | |
| 'test-report.sh' => 1, | |
| 'php_amqp.h' => 1, | |
| 'php7_support.h' => 1, | |
| 'php5_support.h' => 1, | |
| 'amqp_queue.h' => 1, | |
| 'amqp_queue.c' => 1, | |
| 'amqp_exchange.c' => 1, | |
| 'local.win.properties' => 1, | |
| 'amqp_envelope.h' => 1, | |
| 'amqp_envelope.c' => 1, | |
| 'amqp_connection_resource.h' => 1, | |
| 'amqp_connection_resource.c' => 1, | |
| 'amqp_connection.h' => 1, | |
| 'amqp_connection.c' => 1, | |
| 'amqp_channel.h' => 1, | |
| 'amqp_channel.c' => 1, | |
| 'amqp.c' => 1, | |
| 'snidetravisbundle.php' => 1, | |
| 'snidetravinizerbundle.php' => 1, | |
| 'snidescrutinizerbundle.php' => 1, | |
| 'snidemonitorbundle.php' => 1, | |
| 'fo-custom.xsl' => 1, | |
| 'license_plugins' => 1, | |
| 'pcaws4authbundle.php' => 1, | |
| 'make-pear-bundle.php' => 1, | |
| 'release-1.0.0b3' => 1, | |
| 'release-1.0.0b2' => 1, | |
| 'release-1.0.0b1' => 1, | |
| 'release-0.2.1' => 1, | |
| 'release-0.2.0' => 1, | |
| 'release-0.1.3' => 1, | |
| 'release-0.1.2' => 1, | |
| 'release-0.1.1' => 1, | |
| 'test-modified.php' => 1, | |
| 'template.spec' => 1, | |
| 'package.dtd' => 1, | |
| 'package-manpages.xml' => 1, | |
| 'package-errorstack.xml' => 1, | |
| 'make-installpear-nozlib-phar.php' => 1, | |
| 'package_pfm1.php' => 1, | |
| 'make-gopear-phar.php' => 1, | |
| 'make-command-xml.php' => 1, | |
| 'install-pear' => 1, | |
| 'install-pear.php' => 1, | |
| 'go-pear-phar.php' => 1, | |
| 'go-pear-list.php' => 1, | |
| 'catalog' => 1, | |
| 'readme.contributing' => 1, | |
| 'makefile.frag' => 1, | |
| 'copy-from-pear-core.sh' => 1, | |
| 'license-bsd' => 1, | |
| 'package_plugins.xml' => 1, | |
| 'package_plugins.php' => 1, | |
| 'package_pfm1.xml' => 1, | |
| 'snideextraformbundle.php' => 1, | |
| 'vars.less' => 1, | |
| 'rest-api-plugin-endpoints.php' => 1, | |
| 'select2adminlteasset.php' => 1, | |
| 'paynet_processor_aggregate.php' => 1, | |
| 'paynet.xml' => 1, | |
| 'paynet.php' => 1, | |
| 'guzzleclient.php' => 1, | |
| 'requestexample' => 1, | |
| 'tk_tm.csv' => 1, | |
| 'listingview.php' => 1, | |
| 'listingfactory.php' => 1, | |
| 'listing.php' => 1, | |
| 'datatableslistingbundle.php' => 1, | |
| 'run_specs' => 1, | |
| 'enviromenteavbundle.php' => 1, | |
| 'selector.png' => 1, | |
| 'modelselectorasset.php' => 1, | |
| 'php_loc' => 1, | |
| 'modelselector.php' => 1, | |
| 'kuceramonologextensionsbundle.php' => 1, | |
| 'dgisapibundle.php' => 1, | |
| 'dgsphinxsearch.php' => 1, | |
| 'nestedsetsquerytrait.php' => 1, | |
| 'nestedintervalsquerytrait.php' => 1, | |
| 'nestedintervalsbehavior.php' => 1, | |
| 'materializedpathquerytrait.php' => 1, | |
| 'autotreetrait.php' => 1, | |
| 'adjacencylistquerytrait.php' => 1, | |
| 'wikicreole.php' => 1, | |
| 'badasstubeexample.php' => 1, | |
| 'sql_for_db_creation.sql' => 1, | |
| 'update.sql' => 1, | |
| 'run-server.bat' => 1, | |
| 'padding.less' => 1, | |
| 'menufy.jquery.js' => 1, | |
| 'objects.less' => 1, | |
| 'margin.less' => 1, | |
| 'list.less' => 1, | |
| 'font.less' => 1, | |
| 'common.less' => 1, | |
| 'clear.less' => 1, | |
| 'animation.less' => 1, | |
| 'vhax.jquery.js' => 1, | |
| 'vha.jquery.js' => 1, | |
| 'responsify.jquery.js' => 1, | |
| 'openify.jquery.js' => 1, | |
| 'navigateto.jquery.js' => 1, | |
| 'movify.jquery.js' => 1, | |
| 'httpify.js' => 1, | |
| 'pbebasebundle.php' => 1, | |
| 'heighten.jquery.js' => 1, | |
| 'devicify.js' => 1, | |
| 'developify.jquery.js' => 1, | |
| 'pcdummyajaxcompletebundle.php' => 1, | |
| 'mbtuserbundle.php' => 1, | |
| 'pcastrotigretsecuritybundle.php' => 1, | |
| 'whatsappresponse.php' => 1, | |
| 'whatsappapi.php' => 1, | |
| 'userserviceplugin.php' => 1, | |
| 'pbhtechnocommunicatorbundle.php' => 1, | |
| 'fork.php' => 1, | |
| 'users.example.yml' => 1, | |
| 'screenshot-top-menu.png' => 1, | |
| 'screenshot-top-menu-with-directly-loaded-locations.png' => 1, | |
| 'namicorebundle.php' => 1, | |
| 'link_header.php' => 1, | |
| 'build.securepages.xml' => 1, | |
| 'pmapasswordencoderbundle.php' => 1, | |
| 'jquery.countdown-ca.js' => 1, | |
| 'jquery.countdown-bs.js' => 1, | |
| 'jquery.countdown-bn.js' => 1, | |
| 'jquery.countdown-bg.js' => 1, | |
| 'jquery.countdown-ar.js' => 1, | |
| 'countdownled.png' => 1, | |
| 'countdownglowing.gif' => 1, | |
| 'countdownbasic.html' => 1, | |
| 'pmzeroclipboardbundle.php' => 1, | |
| 'pmyubikeyotpbundle.php' => 1, | |
| 'pmtoolbundle.php' => 1, | |
| 'pmmonitoringbundle.php' => 1, | |
| 'pmgoogleauthenticatorbundle.php' => 1, | |
| 'keypadbasic.html' => 1, | |
| 'jquery.countdown-cy.js' => 1, | |
| 'keypad.png' => 1, | |
| 'jquery.keypad.min.js' => 1, | |
| 'jquery.keypad.js' => 1, | |
| 'jquery.keypad.css' => 1, | |
| 'jquery.keypad.alt.css' => 1, | |
| 'jquery.keypad-tr.js' => 1, | |
| 'jquery.keypad-pt-br.js' => 1, | |
| 'jquery.keypad-nl.js' => 1, | |
| 'jquery.keypad-it.js' => 1, | |
| 'jquery.keypad-fr.js' => 1, | |
| 'jquery.keypad-es.js' => 1, | |
| 'jquery.keypad-de.js' => 1, | |
| 'jquery.keypad-cs.js' => 1, | |
| 'jquery.countdown-cs.js' => 1, | |
| 'jquery.countdown-da.js' => 1, | |
| 'ppvbasebundle.php' => 1, | |
| 'jquery.countdown-kn.js' => 1, | |
| 'jquery.countdown-sk.js' => 1, | |
| 'jquery.countdown-ru.js' => 1, | |
| 'jquery.countdown-ro.js' => 1, | |
| 'jquery.countdown-pt-br.js' => 1, | |
| 'jquery.countdown-pl.js' => 1, | |
| 'jquery.countdown-nl.js' => 1, | |
| 'jquery.countdown-nb.js' => 1, | |
| 'jquery.countdown-my.js' => 1, | |
| 'jquery.countdown-ms.js' => 1, | |
| 'jquery.countdown-ml.js' => 1, | |
| 'jquery.countdown-lv.js' => 1, | |
| 'jquery.countdown-lt.js' => 1, | |
| 'jquery.countdown-ko.js' => 1, | |
| 'jquery.countdown-ja.js' => 1, | |
| 'jquery.countdown-de.js' => 1, | |
| 'jquery.countdown-it.js' => 1, | |
| 'jquery.countdown-id.js' => 1, | |
| 'jquery.countdown-hy.js' => 1, | |
| 'jquery.countdown-hu.js' => 1, | |
| 'jquery.countdown-hr.js' => 1, | |
| 'jquery.countdown-he.js' => 1, | |
| 'jquery.countdown-gu.js' => 1, | |
| 'jquery.countdown-gl.js' => 1, | |
| 'jquery.countdown-fr.js' => 1, | |
| 'jquery.countdown-fi.js' => 1, | |
| 'jquery.countdown-fa.js' => 1, | |
| 'jquery.countdown-et.js' => 1, | |
| 'jquery.countdown-es.js' => 1, | |
| 'jquery.countdown-el.js' => 1, | |
| 'jquery.keypad-ca.js' => 1, | |
| 'cdz' => 1, | |
| 'jquery.countdown-sq.js' => 1, | |
| 'basex.php' => 1, | |
| 'sorting.php' => 1, | |
| 'errorsummary.php' => 1, | |
| 'planit.php' => 1, | |
| 'configurations.php' => 1, | |
| 'carbon-field-number.php' => 1, | |
| 'carbon_field_number.php' => 1, | |
| 'quickquery.php' => 1, | |
| 'qq.utils.php' => 1, | |
| 'urldispatcher.php' => 1, | |
| 'siteaccessfactory.php' => 1, | |
| 'siteaccess.php' => 1, | |
| 'fc.php' => 1, | |
| 'basexfactory.php' => 1, | |
| 'assertxpathmatch.php' => 1, | |
| 'shell-config.rc' => 1, | |
| 'accumulator.php' => 1, | |
| 'kindeditor.js' => 1, | |
| 'kindeditor-min.js' => 1, | |
| 'kindeditor-all.js' => 1, | |
| 'kindeditor-all-min.js' => 1, | |
| 'services_json.php' => 1, | |
| 'kindeditoraction.php' => 1, | |
| 'plantuml.php' => 1, | |
| 'syliustaxonomiesbundle.php' => 1, | |
| 'syliuspromotionsbundle.php' => 1, | |
| 'syliuspaymentsbundle.php' => 1, | |
| 'syliuspaymentevents.php' => 1, | |
| 'pjentityextendbundle.php' => 1, | |
| 'platform' => 1, | |
| 'platformsh.php' => 1, | |
| 'pluessdoctrinetrxbundle.php' => 1, | |
| 'createsettingtablemigration.php' => 1, | |
| 'phpiredis_functions.php' => 1, | |
| 'validationexception.hh' => 1, | |
| 'messagebag.hh' => 1, | |
| 'build-win.xml' => 1, | |
| 'plehatronlimoncellobundle.php' => 1, | |
| 'class.mysqli.php' => 1, | |
| 'msysgitçš„é…ç½®åšä¸æ–‡æ”¯æœ' => 1, | |
| 'git常用命令' => 1, | |
| 'git五分é’ÿ教程' => 1, | |
| 'uploadsaction.php' => 1, | |
| 'settingsmigration.php' => 1, | |
| 'settingform.php' => 1, | |
| 'settingaction.php' => 1, | |
| 'relativeselect2asset.php' => 1, | |
| 'magento-build.php' => 1, | |
| 'relativeselect2.php' => 1, | |
| 'httperror.php' => 1, | |
| 'eastereggaction.php' => 1, | |
| 'datalogmigration.php' => 1, | |
| 'datalogform.php' => 1, | |
| 'datalogbehavior.php' => 1, | |
| 'datalog.php' => 1, | |
| 'copyattributesbehavior.php' => 1, | |
| 'platinumpixssimplepaginationbundle.php' => 1, | |
| 'platinumpixsgoogleclosurelibrarybundle.php' => 1, | |
| 'platinumpixsawsbundle.php' => 1, | |
| 'bootstrap1.php' => 1, | |
| 'my_yii2_adv (1).sql' => 1, | |
| 'magento-deploy.php' => 1, | |
| 'jquery.countdown-sl.js' => 1, | |
| 'jquery.countdown-sr-sr.js' => 1, | |
| 'adyengatewayfactory.php' => 1, | |
| 'googleanalyticsapi.php' => 1, | |
| 'polish.sh' => 1, | |
| 'function_smarty_modifier_ago.php' => 1, | |
| 'atom.png' => 1, | |
| 'test.cmd' => 1, | |
| 'super-cpt-loader.php' => 1, | |
| '_ide_helper.php.sample' => 1, | |
| 'parrots-logo-250.png' => 1, | |
| 'wechatsdk.php' => 1, | |
| 'wechataction.php' => 1, | |
| 'qiyesdk.php' => 1, | |
| 'subdomainurlmanager.php' => 1, | |
| 'redisfilter.php' => 1, | |
| 'saeassetmanager.php' => 1, | |
| 'test_services.json' => 1, | |
| 'composer.list' => 1, | |
| 'requestcore.class.php' => 1, | |
| 'examples.yml' => 1, | |
| 'transmission-cli.dist.yml' => 1, | |
| 'phpunit_without_commands.xml' => 1, | |
| 'pchatmodule.php' => 1, | |
| 'chatwithoutnodeassets.php' => 1, | |
| 'chatassets.php' => 1, | |
| 'phpunit-imagick.xml' => 1, | |
| 'phpunit-gmagick.xml' => 1, | |
| 'plrapibundle.php' => 1, | |
| 'bernardschedulerbundle.php' => 1, | |
| 'pmxrrdbundle.php' => 1, | |
| 'polygramphpcrbundle.php' => 1, | |
| 'yql.php' => 1, | |
| 'desperadoxmlbundle.php' => 1, | |
| 'apimethods.php' => 1, | |
| 'prestainitializerbundle.php' => 1, | |
| 'build.securelogin.xml' => 1, | |
| 'build.overlay.xml' => 1, | |
| 'build.maint.xml' => 1, | |
| 'build.error.xml' => 1, | |
| 'build.environment_indicator.xml' => 1, | |
| 'build.devel.xml' => 1, | |
| 'build.acquia.xml' => 1, | |
| 'behat.local.yml' => 1, | |
| 'readme_remove_cms' => 1, | |
| 'prestasonatanavigationbundle.php' => 1, | |
| 'prestasonataadminextendedbundle.php' => 1, | |
| 'prestasitemapbundle.php' => 1, | |
| 'prestapimpmysonatabundle.php' => 1, | |
| 'prestadeploymentbundle.php' => 1, | |
| 'pwasset.php' => 1, | |
| 'prestacomposerpublicbundle.php' => 1, | |
| 'prestacmsuserbundle.php' => 1, | |
| 'prestacmsthemebasicbundle.php' => 1, | |
| 'prestacmssocialbundle.php' => 1, | |
| 'prestacmssitemapbridgebundle.php' => 1, | |
| 'prestacmsmediabundle.php' => 1, | |
| 'prestacmsfaqbundle.php' => 1, | |
| 'prestacmscorebundle.php' => 1, | |
| 'prestacmscontactbundle.php' => 1, | |
| 'prestacmsckeditorbundle.php' => 1, | |
| 'templates.vars.json.travis' => 1, | |
| 'templates.vars.json.init' => 1, | |
| 'buttonajax.php' => 1, | |
| 'videojs.php' => 1, | |
| 'polyfonypaymentbundle.php' => 1, | |
| 'chatworkbundle.php' => 1, | |
| 'jquery.countdown-sr.js' => 1, | |
| 'class-clockworkexception.php' => 1, | |
| 'error_trace.php' => 1, | |
| 'elastic_search.php' => 1, | |
| 'default_forward.php' => 1, | |
| 'debug_store.php' => 1, | |
| 'debug_console.php' => 1, | |
| 'debug_cli.php' => 1, | |
| 'cache_header.php' => 1, | |
| 'cacheheaderhelper.php' => 1, | |
| 'app_action_router.php' => 1, | |
| 'file_sign.php' => 1, | |
| 'original.html' => 1, | |
| 'adr.png' => 1, | |
| 'pminnieurspritesbundle.php' => 1, | |
| 'class-clockwork.php' => 1, | |
| 'file_info.php' => 1, | |
| 'flexible-orm.doxyfile' => 1, | |
| 'kbw.countdown.jquery.json' => 1, | |
| 'jquery.countdown.min.js' => 1, | |
| 'jquery.countdown.js' => 1, | |
| 'jquery.countdown.css' => 1, | |
| 'jquery.countdown-zh-tw.js' => 1, | |
| 'jquery.countdown-zh-cn.js' => 1, | |
| 'jquery.countdown-vi.js' => 1, | |
| 'jquery.countdown-uz.js' => 1, | |
| 'jquery.countdown-uk.js' => 1, | |
| 'jquery.countdown-tr.js' => 1, | |
| 'jquery.countdown-th.js' => 1, | |
| 'jquery.countdown-sv.js' => 1, | |
| 'fast_route.php' => 1, | |
| 'file_list.php' => 1, | |
| 'vaddybundle.php' => 1, | |
| 'view_html.php' => 1, | |
| 'aws-ses-wp-mail.php' => 1, | |
| 'polemdepartementsbundle.php' => 1, | |
| 'polemmultipassbundle.php' => 1, | |
| 'modulecontaopiwikvisitoroptout.php' => 1, | |
| 'pokpooldbmbundle.php' => 1, | |
| 'blackuserbundle.php' => 1, | |
| 'foursquarestrategy.php' => 1, | |
| 'flickrstrategy.php' => 1, | |
| 'vendor' => 1, | |
| 'hello.html' => 1, | |
| 'yo_swagger.php' => 1, | |
| 'view_react.php' => 1, | |
| 'view_json.php' => 1, | |
| 'view_config_helper.php' => 1, | |
| 'flickr.php' => 1, | |
| 'view_cli.php' => 1, | |
| 'tmp.php' => 1, | |
| 'supervisor.php' => 1, | |
| 'static_map.php' => 1, | |
| 'ssdb.php' => 1, | |
| 'rethinkdb.php' => 1, | |
| 'otp.php' => 1, | |
| 'googleauthenticator' => 1, | |
| 'minions.php' => 1, | |
| 'latlon.php' => 1, | |
| 'http_auth.php' => 1, | |
| 'html_parser.php' => 1, | |
| 'clean.sh' => 1, | |
| 'getenv.php' => 1, | |
| 'paymillgatewayfactory.php' => 1, | |
| 'zerion_autoload.php' => 1, | |
| 'shopify.php' => 1, | |
| 'dbexport.php' => 1, | |
| 'sequences.php' => 1, | |
| 'schemas.php' => 1, | |
| 'privileges.php' => 1, | |
| 'operators.php' => 1, | |
| 'opclasses.php' => 1, | |
| 'multiactionform.js' => 1, | |
| 'links.js' => 1, | |
| 'intro.php' => 1, | |
| 'indexes.php' => 1, | |
| 'indexes.js' => 1, | |
| 'groups.php' => 1, | |
| 'functions.js' => 1, | |
| 'fulltext.php' => 1, | |
| 'dataimport.php' => 1, | |
| 'sqledit.php' => 1, | |
| 'dataexport.php' => 1, | |
| 'conversions.php' => 1, | |
| 'constraints.php' => 1, | |
| 'colproperties.php' => 1, | |
| 'casts.php' => 1, | |
| 'all_db.php' => 1, | |
| 'ajax-ac-insert.php' => 1, | |
| 'aggregates.php' => 1, | |
| 'translators' => 1, | |
| 'developers' => 1, | |
| 'textviewmodel.php' => 1, | |
| 'permutationviewmodel.php' => 1, | |
| 'abstractviewmodel.php' => 1, | |
| 'servers.php' => 1, | |
| 'tables.js' => 1, | |
| 'streamserver.php' => 1, | |
| 'extensionmanager.php' => 1, | |
| 'boundform.php' => 1, | |
| 'defaultroutes.php' => 1, | |
| 'configurable.php' => 1, | |
| 'recursiveassetfinder.php' => 1, | |
| 'assetserver.php' => 1, | |
| 'pushar.php' => 1, | |
| 'phpugltwitterbootstrapbundle.php' => 1, | |
| 'dimetimetrackerfrontendbundle.php' => 1, | |
| 'dimetimetrackerbundle.php' => 1, | |
| 'dimereportbundle.php' => 1, | |
| 'noahglaserentitybundle.php' => 1, | |
| 'noahglaserpaginationbundle.php' => 1, | |
| 'passthru.php' => 1, | |
| 'extensioninterface.php' => 1, | |
| 'tablespaces.php' => 1, | |
| 'containerhelper.php' => 1, | |
| 'read_config.php' => 1, | |
| 'phpsysinfo3.xsd' => 1, | |
| 'phpsysinfo.xslt' => 1, | |
| 'phpsysinfo.ini.new' => 1, | |
| 'readme_plugin' => 1, | |
| 'prophecytestcase.php' => 1, | |
| 'magicscopesbehavior.php' => 1, | |
| 'magicactivequery.php' => 1, | |
| 'app.phpsgi' => 1, | |
| 'grumphp.yml.dist' => 1, | |
| 'viewproperties.php' => 1, | |
| 'triggers.php' => 1, | |
| 'tblproperties.php' => 1, | |
| 'wrapperclient.php' => 1, | |
| 'streamclientoptionstrait.php' => 1, | |
| 'unboundform.php' => 1, | |
| 'benchmark-plural.php' => 1, | |
| 'aredisset.php' => 1, | |
| 'aredissession.php' => 1, | |
| 'aredisrecord.php' => 1, | |
| 'aredismutex.php' => 1, | |
| 'aredislogroute.php' => 1, | |
| 'aredislist.php' => 1, | |
| 'aredisiterableentity.php' => 1, | |
| 'aredishash.php' => 1, | |
| 'aredisentity.php' => 1, | |
| 'arediscounter.php' => 1, | |
| 'aredisconnection.php' => 1, | |
| 'aredischannel.php' => 1, | |
| 'arediscache.php' => 1, | |
| 'benchmark-context.php' => 1, | |
| 'aredisstatepersister.php' => 1, | |
| 'mvexportformbundle.php' => 1, | |
| 'mverrorlogbundle.php' => 1, | |
| 'mvcrudgeneratorresourcesbundle.php' => 1, | |
| 'mvcrudgeneratorbundle.php' => 1, | |
| 'mvcontactbundle.php' => 1, | |
| 'mvblogbundle.php' => 1, | |
| 'mvfreesmsapibundle.php' => 1, | |
| 'constants.php.dist' => 1, | |
| 'cp.php' => 1, | |
| 'lucidframe' => 1, | |
| 'assets-legendary.sublime-workspace' => 1, | |
| 'assets-legendary.sublime-project' => 1, | |
| 'webmention.php' => 1, | |
| 'aredissortedset.php' => 1, | |
| 'abstractaresponder.php' => 1, | |
| 'streamclient.php' => 1, | |
| 'filepermissions.php' => 1, | |
| 'swrappermanager.php' => 1, | |
| 'sresource.php' => 1, | |
| 'sfiltermanager.php' => 1, | |
| 'logdatacontext.php' => 1, | |
| 'resourcemaptrait.php' => 1, | |
| 'resourcemapresolver.php' => 1, | |
| 'pathstacktrait.php' => 1, | |
| 'pathstackresolver.php' => 1, | |
| 'aggregatetrait.php' => 1, | |
| 'aggregateloader.php' => 1, | |
| 'reqmethod.php' => 1, | |
| 'browserrequestoptions.php' => 1, | |
| 'browseroptions.php' => 1, | |
| 'exeprocutedpipes.php' => 1, | |
| 'functoraresponder.php' => 1, | |
| 'exeprocuted.php' => 1, | |
| 'exeproc.php' => 1, | |
| 'exedescriptor.php' => 1, | |
| 'eventstrait.php' => 1, | |
| 'eventbuilder.php' => 1, | |
| 'baseevents.php' => 1, | |
| 'containerserviceinitializer.php' => 1, | |
| 'freflection.php' => 1, | |
| 'abstractaresolver.php' => 1, | |
| 'anamedresolver.php' => 1, | |
| 'sapiservice.php' => 1, | |
| 'sapihttp.php' => 1, | |
| 'sapicli.php' => 1, | |
| 'abstractsapi.php' => 1, | |
| 'recordsetform.php' => 1, | |
| 'paginatedrecordset.php' => 1, | |
| 'socials.yml' => 1, | |
| 'widgetserviceprovider.php' => 1, | |
| 'applicationerror.php' => 1, | |
| 'loader_metno.php' => 1, | |
| 'metnosymbol.php' => 1, | |
| 'metnoprecipitation.php' => 1, | |
| 'metnoforecast.php' => 1, | |
| 'metnofactory.php' => 1, | |
| 'metnoday.php' => 1, | |
| 'metnocustomsymbol.php' => 1, | |
| 'metno.php' => 1, | |
| 'pinkfirebundle.php' => 1, | |
| 'pinkeenapidebugbundle.php' => 1, | |
| 'apievents.php' => 1, | |
| 'moneybundle.php' => 1, | |
| 'widgetfacade.php' => 1, | |
| 'pslabyrinthbundle.php' => 1, | |
| 'themesserviceprovider.php' => 1, | |
| 'themefacade.php' => 1, | |
| 'shortcodeserviceprovider.php' => 1, | |
| 'shortcodefacade.php' => 1, | |
| 'presentabletrait.php' => 1, | |
| '.env.testing.php' => 1, | |
| 'pingen.php' => 1, | |
| 'arteober2doctrinebundle.php' => 1, | |
| 'install_php_weak_ext.sh' => 1, | |
| 'uuid-stub.php' => 1, | |
| 'pinanoselect2bundle.php' => 1, | |
| 'pinanodatatablesbundle.php' => 1, | |
| 'pinanobootstrap3bundle.php' => 1, | |
| 'fatalerror.php' => 1, | |
| 'antqapayubundle.php' => 1, | |
| 'license-faq' => 1, | |
| 'db-pdosql.php' => 1, | |
| 'searchengines.yml' => 1, | |
| 'sample-merlion.php' => 1, | |
| 'merlionwsdlclass.php' => 1, | |
| 'merlionclassmap.php' => 1, | |
| 'merlionautoload.php' => 1, | |
| 'cfb.php' => 1, | |
| 'pirastruformbuilderbundle.php' => 1, | |
| 'loop-limiter.sh' => 1, | |
| 'limiter.sql' => 1, | |
| 'limiter-script.php' => 1, | |
| 'limiter-console.php' => 1, | |
| 'limiter-config.php' => 1, | |
| 'limiter-browser.php' => 1, | |
| 'db-mongo.php' => 1, | |
| 'antqapaymentevents.php' => 1, | |
| 'cms' => 1, | |
| '-' => 1, | |
| 'xteamslackmessengerbundle.php' => 1, | |
| 'xteamhighfiveslackbundle.php' => 1, | |
| 'object_def.php' => 1, | |
| 'pmdworkflowbundle.php' => 1, | |
| 'statemachineinterface.php' => 1, | |
| 'statemachine.php' => 1, | |
| 'pmdstatemachinebundle.php' => 1, | |
| 'pmdroutingbundle.php' => 1, | |
| 'pmdresourceresolverbundle.php' => 1, | |
| 'pmdfrontendbundle.php' => 1, | |
| 'pmddoctrinebundle.php' => 1, | |
| 'antqadataexporterbundle.php' => 1, | |
| 'dkim.php' => 1, | |
| '3rd-party-licenses' => 1, | |
| 'recordset.php' => 1, | |
| 'log_firebugjson.php' => 1, | |
| '.travis.xml' => 1, | |
| 'frypestrategy.php' => 1, | |
| 'pi.courier.php' => 1, | |
| 'ff_pdo_tests.class.php' => 1, | |
| 'ff_pdo.class.php' => 1, | |
| 'tool.php' => 1, | |
| 'layout.example.html' => 1, | |
| 'action.example.php' => 1, | |
| 'license_ardent' => 1, | |
| 'docker-compose.override-dist.yml' => 1, | |
| 'tnetstring.php' => 1, | |
| 'testdox.html' => 1, | |
| 'result.xml' => 1, | |
| 'code-standard.xml' => 1, | |
| 'smoneyapi.php' => 1, | |
| 'readme-zh-cn' => 1, | |
| 'serialcolumntrait.php' => 1, | |
| 'kartikserialcolumn.php' => 1, | |
| 'auth.tmp' => 1, | |
| 'vimeo.tmp' => 1, | |
| 'mail-input.sh' => 1, | |
| 'nginx.example.conf' => 1, | |
| 'apache.example.htaccess' => 1, | |
| 'templateexception.php' => 1, | |
| 'partialhelper.php' => 1, | |
| 'partial.php' => 1, | |
| 'applicationexception.php' => 1, | |
| 'treerecordset.php' => 1, | |
| 'picosssmoneybundle.php' => 1, | |
| 'picosssonataextraadminbundle.php' => 1, | |
| 'area.xml' => 1, | |
| 'coordinatespickerasset.php' => 1, | |
| 'userprofile.php' => 1, | |
| 'fbbotapp.php' => 1, | |
| 'key-value-api.php' => 1, | |
| 'wkhtmltopdf-i386' => 1, | |
| 'wkhtmltopdf-amd64' => 1, | |
| 'andreyboloninchartjsbundle.php' => 1, | |
| 'pilotogonepaymentbundle.php' => 1, | |
| 'jungithemebundle.php' => 1, | |
| 'sfynxspecificationbundle.php' => 1, | |
| 'sfynxcurrencybundle.php' => 1, | |
| 'sfynxcircuitbreakerbundle.php' => 1, | |
| 'sfynxcachebundle.php' => 1, | |
| 'locationpickerwidget.php' => 1, | |
| 'coordinatespicker.php' => 1, | |
| 'picossmangopaybundle.php' => 1, | |
| 'nailthumbasset.php' => 1, | |
| 'nailthumb.php' => 1, | |
| 'pickleblogbundle.php' => 1, | |
| 'pierrrememcachedbundle.php' => 1, | |
| 'memcachedfactory.php' => 1, | |
| 'pierrreencrypterbundle.php' => 1, | |
| 'pierrreautomaticvalidatorbundle.php' => 1, | |
| 'rollandimagickbundle.php' => 1, | |
| 'site.dtd' => 1, | |
| 'di.phar' => 1, | |
| 'travis-composer-configure' => 1, | |
| 'piecevalidationdirectoryloaderbundle.php' => 1, | |
| 'piecequestetrabundle.php' => 1, | |
| 'picossyousignbundle.php' => 1, | |
| 'rzadminbundle.php' => 1, | |
| 'rzbootstrapbundle.php' => 1, | |
| 'salutation.sublime-project' => 1, | |
| 'helperinterface.php' => 1, | |
| 'example_v3.php' => 1, | |
| 'example_v2_template.php' => 1, | |
| 'example_v2.php' => 1, | |
| '.env_sample' => 1, | |
| 'senailibraryreportbundle.php' => 1, | |
| 'slevltreeextensionbundle.php' => 1, | |
| 'demo.jpg' => 1, | |
| 'goto-source.php' => 1, | |
| 'pharstub.php' => 1, | |
| 'resize.php' => 1, | |
| 'jalali.php' => 1, | |
| 'seifferthelperbundle.php' => 1, | |
| 'helperset.php' => 1, | |
| 'helperbroker.php' => 1, | |
| '.travis_nginx.conf' => 1, | |
| 'seiffertcrowdrestbundle.php' => 1, | |
| 'crowd.php' => 1, | |
| 'seiffertcrowdauthbundle.php' => 1, | |
| 'seiffertcontrollerhelperbundle.php' => 1, | |
| 'seiffertconsoleextrabundle.php' => 1, | |
| 'commandregistry.php' => 1, | |
| 'authorsextension.php' => 1, | |
| 'authorregistry.php' => 1, | |
| 'httpfull.php' => 1, | |
| 'ews.php' => 1, | |
| 'seferovdeployerbundle.php' => 1, | |
| 'seferovblogbundle.php' => 1, | |
| 'seferovawsbundle.php' => 1, | |
| 'deptrac.php' => 1, | |
| 'sensiobuzzbundle.php' => 1, | |
| 'seegnobootstrapbundle.php' => 1, | |
| 'esphinxquery.php' => 1, | |
| 'fsvsortablecollectiontypebundle.php' => 1, | |
| 'nbitranslationbundle.php' => 1, | |
| 'sligittoolsbundle.php' => 1, | |
| 'sliextjslocalizationbundle.php' => 1, | |
| 'sliextjsintegrationbundle.php' => 1, | |
| 'slidoctrineentitydatamapperbundle.php' => 1, | |
| 'slidoctrinearrayquerybuilderbundle.php' => 1, | |
| 'sliauxbundle.php' => 1, | |
| 'sliexpanderbundle.php' => 1, | |
| 'sphinxapi-2.1.1.php' => 1, | |
| 'sphinxapi-2.0.9.php' => 1, | |
| 'esphinxsearchcriteria.php' => 1, | |
| 'esphinxresult.php' => 1, | |
| 'esphinxmysqlconnection.php' => 1, | |
| 'sensiodistributionbundle.php' => 1, | |
| 'esphinxexception.php' => 1, | |
| 'esphinxbaseconnection.php' => 1, | |
| 'esphinxapiconnection.php' => 1, | |
| 'rowparser.php' => 1, | |
| 'rownode.php' => 1, | |
| 'columnparser.php' => 1, | |
| 'columnnode.php' => 1, | |
| 'buildphp' => 1, | |
| 'mobile_detect.php' => 1, | |
| 'mobile_detect.json' => 1, | |
| 'connectserviceprovider.php' => 1, | |
| 'sensiolabsdoctrinequerystatisticsbundle.php' => 1, | |
| 'sensiolabsconnectbundle.php' => 1, | |
| 'sensioframeworkextrabundle.php' => 1, | |
| 'seegnotestbundle.php' => 1, | |
| 'sedrouteexporterbundle.php' => 1, | |
| 'repo.go' => 1, | |
| 'pediatric-physical-therapy.csl' => 1, | |
| 'physiological-and-biochemical-zoology.csl' => 1, | |
| 'phyllomedusa.csl' => 1, | |
| 'phycological-research.csl' => 1, | |
| 'philosophiques.csl' => 1, | |
| 'philosophia-scientiae.csl' => 1, | |
| 'philippika.csl' => 1, | |
| 'pharmacoepidemiology-and-drug-safety.csl' => 1, | |
| 'petit-chicago-author-date.csl' => 1, | |
| 'perspectives-on-politics.csl' => 1, | |
| 'permafrost-and-periglacial-processes.csl' => 1, | |
| 'periodontology-2000.csl' => 1, | |
| 'peerj.csl' => 1, | |
| 'pediatric-research.csl' => 1, | |
| 'pediatric-blood-and-cancer.csl' => 1, | |
| 'plant-biology.csl' => 1, | |
| 'pediatric-anesthesia.csl' => 1, | |
| 'pediatric-allergy-and-immunology.csl' => 1, | |
| 'past-and-present.csl' => 1, | |
| 'parasitology.csl' => 1, | |
| 'paleobiology.csl' => 1, | |
| 'palaios.csl' => 1, | |
| 'palaeontology.csl' => 1, | |
| 'palaeontologia-electronica.csl' => 1, | |
| 'pain.csl' => 1, | |
| 'padagogische-hochschule-vorarlberg.csl' => 1, | |
| 'padagogische-hochschule-heidelberg.csl' => 1, | |
| 'padagogische-hochschule-fachhochschule-nordwestschweiz.csl' => 1, | |
| 'oxford-university-press-scimed-numeric.csl' => 1, | |
| 'pisa-university-press.csl' => 1, | |
| 'plant-pathology.csl' => 1, | |
| 'secotrustsabredavbundle.php' => 1, | |
| 'primary-care-clinics-in-office-practice.csl' => 1, | |
| 'secotrustroutestatisticsbundle.php' => 1, | |
| 'secotrusthtmlinspectorbundle.php' => 1, | |
| 'dipper.php' => 1, | |
| 'psychosomatics.csl' => 1, | |
| 'psychological-medicine.csl' => 1, | |
| 'psychiatry-and-clinical-neurosciences.csl' => 1, | |
| 'psychiatric-services.csl' => 1, | |
| 'psychiatric-clinics-of-north-america.csl' => 1, | |
| 'proteomics.csl' => 1, | |
| 'protein-science.csl' => 1, | |
| 'protein-engineering-design-and-selection.csl' => 1, | |
| 'proinflow.csl' => 1, | |
| 'proceedings-of-the-royal-society-b.csl' => 1, | |
| 'presses-universitaires-de-rennes.csl' => 1, | |
| 'plant-physiology.csl' => 1, | |
| 'preslia.csl' => 1, | |
| 'pour-reussir-note.csl' => 1, | |
| 'poultry-science.csl' => 1, | |
| 'population.csl' => 1, | |
| 'population-space-and-place.csl' => 1, | |
| 'pontifical-gregorian-university.csl' => 1, | |
| 'pontifical-biblical-institute.csl' => 1, | |
| 'pontifical-athenaeum-regina-apostolorum.csl' => 1, | |
| 'politische-vierteljahresschrift.csl' => 1, | |
| 'political-studies.csl' => 1, | |
| 'polish-legal.csl' => 1, | |
| 'podzemna-voda.csl' => 1, | |
| 'pnas.csl' => 1, | |
| 'plos.csl' => 1, | |
| 'normalizerinterface.php' => 1, | |
| 'repo_test.go' => 1, | |
| 'oxford-university-press-humsoc.csl' => 1, | |
| 'themegroup.class.php' => 1, | |
| 'tannauserbundleevents.php' => 1, | |
| 'tannauserbundle.php' => 1, | |
| 'sfbrouteactivebundle.php' => 1, | |
| 'seyoneajaxcrudbundle.php' => 1, | |
| 'seyonteamspeak3viewerbundle.php' => 1, | |
| 'seyonphpbb3userbundle.php' => 1, | |
| 'seyonphpbb3adminbundle.php' => 1, | |
| 'seyonnodejschatbundle.php' => 1, | |
| 'sexyboysinflexiblebundle.php' => 1, | |
| 'twittermanager.class.php' => 1, | |
| 'tinymceexcerpt.class.php' => 1, | |
| 'themeutils.class.php' => 1, | |
| 'themehelpers.class.php' => 1, | |
| 'testsmanager.class.php' => 1, | |
| 'tannaproductbundleevents.php' => 1, | |
| 'templatechecker.class.php' => 1, | |
| 'substitutiontemplate.class.php' => 1, | |
| 'specialofferssnippetcached.class.php' => 1, | |
| 'specialofferssnippetajax.class.php' => 1, | |
| 'specialofferssnippet.class.php' => 1, | |
| 'singleton.class.php' => 1, | |
| 'simplemetabox.class.php' => 1, | |
| 'simplefieldsquickconfig.class.php' => 1, | |
| 'showcaseslider.class.php' => 1, | |
| 'showtitlethumbexcerptwalkernavmenu.class.php' => 1, | |
| 'showitemexcerptwalkernavmenu.class.php' => 1, | |
| 'shortcodefortabs.class.php' => 1, | |
| 'runtimeinfos.class.php' => 1, | |
| 'tannaproductbundle.php' => 1, | |
| 'sfsadminbundle.php' => 1, | |
| 'removespaceswalkernavmenu.class.php' => 1, | |
| 'settings_backup.php' => 1, | |
| 'datetimeconverter.php' => 1, | |
| 'fenomadapter.php' => 1, | |
| 'shcloudopenstackbundle.php' => 1, | |
| 'brunopsselect24entitybundle.php' => 1, | |
| 'license-ja' => 1, | |
| 'sogenombundle.php' => 1, | |
| 'wp-cli.local.yml' => 1, | |
| '.gitignore-sample' => 1, | |
| '.deployignore' => 1, | |
| 'nepali.datepicker.js' => 1, | |
| 'nepali.datepicker.css' => 1, | |
| 'shanejquerybundle.php' => 1, | |
| '.pharorver.example.json' => 1, | |
| 'imapsource.php' => 1, | |
| 'testvishal.php' => 1, | |
| 'a4-junghans.pdf' => 1, | |
| 'junk.php' => 1, | |
| 'recommenderbundle.php' => 1, | |
| 'recommender.php' => 1, | |
| 'php_browscap.ini' => 1, | |
| 'gilleshacksessionbundle.php' => 1, | |
| 'adldap2bundle.php' => 1, | |
| 'ucotwigextensionsbundle.php' => 1, | |
| 'sspguardbundle.php' => 1, | |
| 'jsonbundle.php' => 1, | |
| 'demo.csv' => 1, | |
| 'sglfltsbundle.php' => 1, | |
| 'dataprovideriterator.php' => 1, | |
| 'expioneo4jfixturesbundle.php' => 1, | |
| 'responsiveimagesmanager.class.php' => 1, | |
| 'photogallerythumbwithfancybox.class.php' => 1, | |
| 'pluginguestcomments.class.php' => 1, | |
| 'htmlintegratorbootstrapasset.php' => 1, | |
| 'automaticassetsmanager.class.php' => 1, | |
| 'ajaximagegenerator.class.php' => 1, | |
| 'legacy.php' => 1, | |
| 'sescandellpaymentbitpaybundle.php' => 1, | |
| 'sescandellsimplenewsletterbundle.php' => 1, | |
| 'sescandellcontextrestrictorbundle.php' => 1, | |
| 'sgcli.phar' => 1, | |
| 'servergroveshellaliasbundle.php' => 1, | |
| 'servergrovelocalebundle.php' => 1, | |
| 'servergrovekbbundle.php' => 1, | |
| 'sgcontrolbundle.php' => 1, | |
| 'seriusmediabundle.php' => 1, | |
| 'includefileextra.php' => 1, | |
| 'htmlintegratorasset.php' => 1, | |
| 'classautoloader.class.php' => 1, | |
| 'arraysearch.php' => 1, | |
| 'rudate.php' => 1, | |
| 'filepath.php' => 1, | |
| '.editorcondig' => 1, | |
| 'alborada.scheduler.js' => 1, | |
| 'alborada.scheduler.css' => 1, | |
| 'ororedisbundle.php' => 1, | |
| 'socialwidget.php' => 1, | |
| 'socialasset.php' => 1, | |
| 'semaminifierbundle.php' => 1, | |
| 'sergeymvidequebundle.php' => 1, | |
| 'sergeymreceiptbundle.php' => 1, | |
| 'create_guset_user.sql' => 1, | |
| 'bootstrapcarousel.class.php' => 1, | |
| 'debugutils.class.php' => 1, | |
| 'oneimageforall.class.php' => 1, | |
| 'imagepreload.class.php' => 1, | |
| 'offersmanager.class.php' => 1, | |
| 'newbloginitializator.class.php' => 1, | |
| 'minigallerythumbslinktobig.class.php' => 1, | |
| 'minigallerybigimagewiththumbs.class.php' => 1, | |
| 'metaboxescontroller.class.php' => 1, | |
| 'metaboxinfo.class.php' => 1, | |
| 'mergedslideshow.class.php' => 1, | |
| 'mediamanager.class.php' => 1, | |
| 'loremipsumdictionary.class.php' => 1, | |
| 'lipsumgenerator.class.php' => 1, | |
| 'linksmanager.class.php' => 1, | |
| 'levelwalkernavmenu.class.php' => 1, | |
| 'imageprogressiveloading.class.php' => 1, | |
| 'imagegenerator.class.php' => 1, | |
| 'defaultassets.class.php' => 1, | |
| 'htmlhelper.class.php' => 1, | |
| 'hotelmanager.class.php' => 1, | |
| 'headhelper.class.php' => 1, | |
| 'hashanchorwalkernavmenu.class.php' => 1, | |
| 'generatordictionary.class.php' => 1, | |
| 'gaussianmath.class.php' => 1, | |
| 'galleryhelper.class.php' => 1, | |
| 'gmapdataretriever.example.json' => 1, | |
| 'gmapdataretriever.class.php' => 1, | |
| 'forcedownload.class.php' => 1, | |
| 'featurewithassets.class.php' => 1, | |
| 'escaperoute.class.php' => 1, | |
| 'emptyassets.class.php' => 1, | |
| 'defaultassetscdn.class.php' => 1, | |
| 'oxford-university-press-scimed-author-date.csl' => 1, | |
| 'oxford-the-university-of-new-south-wales.csl' => 1, | |
| 'jsrenderasset.php' => 1, | |
| 'journal-of-roman-archaeology-b.csl' => 1, | |
| 'journal-of-the-american-ceramic-society.csl' => 1, | |
| 'journal-of-the-american-association-of-laboratory-animal-science.csl' => 1, | |
| 'journal-of-the-american-academy-of-orthopaedic-surgeons.csl' => 1, | |
| 'journal-of-the-air-and-waste-management-association.csl' => 1, | |
| 'journal-of-studies-on-alcohol-and-drugs.csl' => 1, | |
| 'journal-of-strength-and-conditioning-research.csl' => 1, | |
| 'journal-of-spinal-disorders-and-techniques.csl' => 1, | |
| 'journal-of-social-archaeology.csl' => 1, | |
| 'journal-of-sleep-research.csl' => 1, | |
| 'journal-of-simulation.csl' => 1, | |
| 'journal-of-shoulder-and-elbow-surgery.csl' => 1, | |
| 'journal-of-separation-science.csl' => 1, | |
| 'journal-of-science-and-medicine-in-sport.csl' => 1, | |
| 'journal-of-roman-archaeology-a.csl' => 1, | |
| 'journal-of-the-american-college-of-surgeons.csl' => 1, | |
| 'journal-of-rheumatology.csl' => 1, | |
| 'journal-of-retailing.csl' => 1, | |
| 'journal-of-reconstructive-microsurgery.csl' => 1, | |
| 'journal-of-psychiatry-and-neuroscience.csl' => 1, | |
| 'journal-of-psychiatric-and-mental-health-nursing.csl' => 1, | |
| 'journal-of-product-innovation-management.csl' => 1, | |
| 'journal-of-pollination-ecology.csl' => 1, | |
| 'journal-of-plant-nutrition-and-soil-science.csl' => 1, | |
| 'journal-of-physical-therapy-science.csl' => 1, | |
| 'journal-of-phycology.csl' => 1, | |
| 'journal-of-pharmacy-and-pharmacology.csl' => 1, | |
| 'journal-of-petrology.csl' => 1, | |
| 'journal-of-perinatal-medicine.csl' => 1, | |
| 'journal-of-the-american-college-of-cardiology.csl' => 1, | |
| 'journal-of-the-american-society-of-brewing-chemists.csl' => 1, | |
| 'journal-of-peace-research.csl' => 1, | |
| 'journal-of-zoology.csl' => 1, | |
| 'kritische-ausgabe.csl' => 1, | |
| 'korean-journal-of-anesthesiology.csl' => 1, | |
| 'kommunikation-und-recht.csl' => 1, | |
| 'kolner-zeitschrift-fur-soziologie-und-sozialpsychologie.csl' => 1, | |
| 'knee-surgery-sports-traumatology-arthroscopy.csl' => 1, | |
| 'kindheit-und-entwicklung.csl' => 1, | |
| 'kidney-research-and-clinical-practice.csl' => 1, | |
| 'kidney-international.csl' => 1, | |
| 'karger-journals.csl' => 1, | |
| 'karger-journals-author-date.csl' => 1, | |
| 'juristische-zitierweise.csl' => 1, | |
| 'juristische-schulung.csl' => 1, | |
| 'journalistica.csl' => 1, | |
| 'journal-of-zoo-and-wildlife-medicine.csl' => 1, | |
| 'journal-of-the-american-society-of-nephrology.csl' => 1, | |
| 'journal-of-wildlife-diseases.csl' => 1, | |
| 'journal-of-visualized-experiments.csl' => 1, | |
| 'journal-of-veterinary-cardiology.csl' => 1, | |
| 'journal-of-vertebrate-paleontology.csl' => 1, | |
| 'journal-of-vegetation-science.csl' => 1, | |
| 'journal-of-urban-and-environmental-engineering.csl' => 1, | |
| 'journal-of-universal-computer-science.csl' => 1, | |
| 'journal-of-tropical-ecology.csl' => 1, | |
| 'journal-of-thrombosis-and-haemostasis.csl' => 1, | |
| 'journal-of-the-royal-anthropological-institute.csl' => 1, | |
| 'journal-of-the-electrochemical-society.csl' => 1, | |
| 'journal-of-the-brazilian-chemical-society.csl' => 1, | |
| 'journal-of-the-association-for-information-systems.csl' => 1, | |
| 'journal-of-the-american-water-resources-association.csl' => 1, | |
| 'journal-of-peptide-science.csl' => 1, | |
| 'journal-of-paleontology.csl' => 1, | |
| 'kth-royal-institute-of-technology-school-of-computer-science-and-communication.csl' => 1, | |
| 'journal-of-field-ornithology.csl' => 1, | |
| 'journal-of-hypertension.csl' => 1, | |
| 'journal-of-human-evolution.csl' => 1, | |
| 'journal-of-hospital-infection.csl' => 1, | |
| 'journal-of-hearing-science.csl' => 1, | |
| 'journal-of-glaciology.csl' => 1, | |
| 'journal-of-geriatric-psychiatry-and-neurology.csl' => 1, | |
| 'journal-of-genetic-engineering-and-biotechnology.csl' => 1, | |
| 'journal-of-frailty-and-aging.csl' => 1, | |
| 'journal-of-forensic-sciences.csl' => 1, | |
| 'journal-of-forensic-and-legal-medicine.csl' => 1, | |
| 'journal-of-food-protection.csl' => 1, | |
| 'journal-of-fish-diseases.csl' => 1, | |
| 'journal-of-finance.csl' => 1, | |
| 'journal-of-experimental-botany.csl' => 1, | |
| 'journal-of-industrial-ecology.csl' => 1, | |
| 'journal-of-evolutionary-biology.csl' => 1, | |
| 'journal-of-european-public-policy.csl' => 1, | |
| 'journal-of-endodontics.csl' => 1, | |
| 'journal-of-elections-public-opinion-and-parties.csl' => 1, | |
| 'journal-of-dental-research.csl' => 1, | |
| 'journal-of-crohns-and-colitis.csl' => 1, | |
| 'journal-of-crohns-and-colitis-supplements.csl' => 1, | |
| 'journal-of-consumer-research.csl' => 1, | |
| 'journal-of-computational-chemistry.csl' => 1, | |
| 'journal-of-common-market-studies.csl' => 1, | |
| 'journal-of-combinatorics.csl' => 1, | |
| 'journal-of-clinical-oncology.csl' => 1, | |
| 'journal-of-chiropractic-medicine.csl' => 1, | |
| 'journal-of-industrial-and-engineering-chemistry.csl' => 1, | |
| 'journal-of-infection.csl' => 1, | |
| 'journal-of-orthopaedics-trauma-and-rehabilitation.csl' => 1, | |
| 'journal-of-molecular-endocrinology.csl' => 1, | |
| 'journal-of-orthopaedic-trauma.csl' => 1, | |
| 'journal-of-orthopaedic-research.csl' => 1, | |
| 'journal-of-oral-and-maxillofacial-surgery.csl' => 1, | |
| 'journal-of-nutrition.csl' => 1, | |
| 'journal-of-neurotrauma.csl' => 1, | |
| 'journal-of-neurosurgery.csl' => 1, | |
| 'journal-of-neuroscience-and-neuroengineering.csl' => 1, | |
| 'journal-of-neurophysiology.csl' => 1, | |
| 'journal-of-neurological-disorders.csl' => 1, | |
| 'journal-of-neurochemistry.csl' => 1, | |
| 'journal-of-nanoscience-and-nanotechnology.csl' => 1, | |
| 'journal-of-music-technology-and-education.csl' => 1, | |
| 'journal-of-morphology.csl' => 1, | |
| 'journal-of-minimally-invasive-gynecology.csl' => 1, | |
| 'journal-of-infectious-diseases.csl' => 1, | |
| 'journal-of-medical-internet-research.csl' => 1, | |
| 'journal-of-medical-genetics.csl' => 1, | |
| 'journal-of-management.csl' => 1, | |
| 'journal-of-management-information-systems.csl' => 1, | |
| 'journal-of-mammalogy.csl' => 1, | |
| 'journal-of-magnetic-resonance-imaging.csl' => 1, | |
| 'journal-of-lipid-research.csl' => 1, | |
| 'journal-of-investigative-dermatology.csl' => 1, | |
| 'journal-of-international-business-studies.csl' => 1, | |
| 'journal-of-internal-medicine.csl' => 1, | |
| 'journal-of-interactive-marketing.csl' => 1, | |
| 'journal-of-integrated-omics.csl' => 1, | |
| 'journal-of-institutional-and-theoretical-economics.csl' => 1, | |
| 'journal-of-information-technology.csl' => 1, | |
| 'kth-royal-institute-of-technology-school-of-computer-science-and-communication-sv.csl' => 1, | |
| 'landes-bioscience-journals.csl' => 1, | |
| 'oxford-studies-on-the-roman-economy.csl' => 1, | |
| 'nature-no-et-al.csl' => 1, | |
| 'neurology.csl' => 1, | |
| 'neurology-india.csl' => 1, | |
| 'neurologia.csl' => 1, | |
| 'neurologia-argentina.csl' => 1, | |
| 'neuroimaging-clinics-of-north-america.csl' => 1, | |
| 'neue-juristische-wochenschrift.csl' => 1, | |
| 'nephrology-dialysis-transplantation.csl' => 1, | |
| 'nehet.csl' => 1, | |
| 'nccr-mediality.csl' => 1, | |
| 'navigation.csl' => 1, | |
| 'nature.csl' => 1, | |
| 'nature-publishing-group-vancouver.csl' => 1, | |
| 'nature-no-superscript.csl' => 1, | |
| 'nature-neuroscience-brief-communications.csl' => 1, | |
| 'neurorehabilitation-and-neural-repair.csl' => 1, | |
| 'national-science-foundation-grant-proposals.csl' => 1, | |
| 'national-library-of-medicine-grant-proposals.csl' => 1, | |
| 'national-institute-of-health-research.csl' => 1, | |
| 'national-archives-of-australia.csl' => 1, | |
| 'nano-biomedicine-and-engineering.csl' => 1, | |
| 'myrmecological-news.csl' => 1, | |
| 'mycologia.csl' => 1, | |
| 'mutagenesis.csl' => 1, | |
| 'multiple-sclerosis-journal.csl' => 1, | |
| 'multidisciplinary-digital-publishing-institute.csl' => 1, | |
| 'moorlands-college.csl' => 1, | |
| 'moore-theological-college.csl' => 1, | |
| 'mondes-en-developpement.csl' => 1, | |
| 'neuropsychopharmacology.csl' => 1, | |
| 'neuroreport.csl' => 1, | |
| 'molecular-psychiatry-letters.csl' => 1, | |
| 'optometry-and-vision-science.csl' => 1, | |
| 'oxford-studies-in-ancient-philosophy.csl' => 1, | |
| 'oxford-centre-for-mission-studies-harvard.csl' => 1, | |
| 'oxford-art-journal.csl' => 1, | |
| 'owbarth-verlag.csl' => 1, | |
| 'osterreichische-zeitschrift-fur-politikwissenschaft.csl' => 1, | |
| 'oscola.csl' => 1, | |
| 'oscola-no-ibid.csl' => 1, | |
| 'oryx.csl' => 1, | |
| 'orthopedic-clinics-of-north-america.csl' => 1, | |
| 'ornitologia-neotropical.csl' => 1, | |
| 'organization.csl' => 1, | |
| 'organization-science.csl' => 1, | |
| 'oral-diseases.csl' => 1, | |
| 'ophthalmology.csl' => 1, | |
| 'neurosurgery-clinics-of-north-america.csl' => 1, | |
| 'onderstepoort-journal-of-veterinary-research.csl' => 1, | |
| 'oikos.csl' => 1, | |
| 'occupational-medicine.csl' => 1, | |
| 'obesity.csl' => 1, | |
| 'nucleic-acids-research.csl' => 1, | |
| 'nowa-audiofonologia.csl' => 1, | |
| 'northeastern-naturalist.csl' => 1, | |
| 'norma-portuguesa-405.csl' => 1, | |
| 'new-zealand-veterinary-journal.csl' => 1, | |
| 'new-zealand-plant-protection.csl' => 1, | |
| 'new-testament-studies.csl' => 1, | |
| 'new-solutions.csl' => 1, | |
| 'new-phytologist.csl' => 1, | |
| 'new-harts-rules-the-oxford-style-guide.csl' => 1, | |
| 'molecular-therapy.csl' => 1, | |
| 'molecular-plant-pathology.csl' => 1, | |
| 'language-in-society.csl' => 1, | |
| 'liver-international.csl' => 1, | |
| 'mcgill-en.csl' => 1, | |
| 'mcdonald-institute-monographs.csl' => 1, | |
| 'mathematics-and-computers-in-simulation.csl' => 1, | |
| 'mastozoologia-neotropical.csl' => 1, | |
| 'manchester-university-press.csl' => 1, | |
| 'mammal-review.csl' => 1, | |
| 'magnetic-resonance-materials-in-physics-biology-and-medicine.csl' => 1, | |
| 'magnetic-resonance-in-medicine.csl' => 1, | |
| 'macromolecular-reaction-engineering.csl' => 1, | |
| 'lund-university-school-of-economics-and-management.csl' => 1, | |
| 'london-south-bank-university-numeric.csl' => 1, | |
| 'lluelles.csl' => 1, | |
| 'lluelles-no-ibid.csl' => 1, | |
| 'limnology-and-oceanography.csl' => 1, | |
| 'medecine-sciences.csl' => 1, | |
| 'leviathan.csl' => 1, | |
| 'lettres-et-sciences-humaines-fr.csl' => 1, | |
| 'lethaia.csl' => 1, | |
| 'les-journees-de-la-recherche-porcine.csl' => 1, | |
| 'les-journees-de-la-recherche-avicole.csl' => 1, | |
| 'leidraad-voor-juridische-auteurs.csl' => 1, | |
| 'le-tapuscrit-note.csl' => 1, | |
| 'le-tapuscrit-author-date.csl' => 1, | |
| 'le-mouvement-social.csl' => 1, | |
| 'law-and-society-review.csl' => 1, | |
| 'latin-american-research-review.csl' => 1, | |
| 'latin-american-perspectives.csl' => 1, | |
| 'language.csl' => 1, | |
| 'mcgill-fr.csl' => 1, | |
| 'media-culture-and-society.csl' => 1, | |
| 'molecular-plant-microbe-interactions.csl' => 1, | |
| 'mis-quarterly.csl' => 1, | |
| 'molecular-microbiology.csl' => 1, | |
| 'molecular-metabolism.csl' => 1, | |
| 'molecular-ecology.csl' => 1, | |
| 'molecular-biology-of-the-cell.csl' => 1, | |
| 'molecular-biology-and-evolution.csl' => 1, | |
| 'molecular-and-cellular-proteomics.csl' => 1, | |
| 'mohr-siebeck-recht.csl' => 1, | |
| 'modern-language-association.csl' => 1, | |
| 'modern-language-association-with-url.csl' => 1, | |
| 'modern-language-association-underline.csl' => 1, | |
| 'modern-language-association-6th-edition-note.csl' => 1, | |
| 'modern-humanities-research-association.csl' => 1, | |
| 'modern-humanities-research-association-author-date.csl' => 1, | |
| 'mineralogical-magazine.csl' => 1, | |
| 'medical-dosimetry.csl' => 1, | |
| 'middle-east-critique.csl' => 1, | |
| 'microscopy-and-microanalysis.csl' => 1, | |
| 'microbial-drug-resistance.csl' => 1, | |
| 'metropolitiques.csl' => 1, | |
| 'methods-of-information-in-medicine.csl' => 1, | |
| 'methods-in-ecology-and-evolution.csl' => 1, | |
| 'meteorological-applications.csl' => 1, | |
| 'meteoritics-and-planetary-science.csl' => 1, | |
| 'metallurgical-and-materials-transactions.csl' => 1, | |
| 'memorias-do-instituto-oswaldo-cruz.csl' => 1, | |
| 'melbourne-school-of-theology.csl' => 1, | |
| 'medicine-and-science-in-sports-and-exercise.csl' => 1, | |
| 'medical-physics.csl' => 1, | |
| 'medical-history.csl' => 1, | |
| 'easy.php' => 1, | |
| 'qrcode-terminal' => 1, | |
| 'journal-of-chemistry-and-chemical-engineering.csl' => 1, | |
| 'themecomponent.php' => 1, | |
| 'app-web.php' => 1, | |
| 'app-console.php' => 1, | |
| 'app-config.php' => 1, | |
| 'changelog-old' => 1, | |
| 'yasharewidget.php' => 1, | |
| 'yashasset.php' => 1, | |
| 'vkcommunitywidget.php' => 1, | |
| 'vkcommunityassetinnerfile.php' => 1, | |
| 'vkcommunityasset.php' => 1, | |
| 'vkcommentswidget.php' => 1, | |
| 'vkasset.php' => 1, | |
| 'viewcomponentsettings.php' => 1, | |
| 'viewcomponent.php' => 1, | |
| 'cmsseomodule.php' => 1, | |
| 'atroposasset.php' => 1, | |
| 'cmsseocomponent.php' => 1, | |
| 'cmssearchmodule.php' => 1, | |
| 'cmssearchcomponent.php' => 1, | |
| 'intlformatter.php' => 1, | |
| 'exchangeratescbrf.php' => 1, | |
| 'cmsmarketplacemodule.php' => 1, | |
| 'cmsmarketplacecomponent.php' => 1, | |
| 'mailersettings.php' => 1, | |
| 'logdbtarget.php' => 1, | |
| 'i18ndbmodule.php' => 1, | |
| 'i18ndbcomponent.php' => 1, | |
| 'cmssettingsexternallinkscomponent.php' => 1, | |
| 'cmsexternallinkscomponent.php' => 1, | |
| 'auto-config.php' => 1, | |
| 'boomerangasset.php' => 1, | |
| 'dbdumpercomponent.php' => 1, | |
| 'skillbertogitbundle.php' => 1, | |
| 'onesky' => 1, | |
| 'sevenoneskybundle.php' => 1, | |
| 'magebuild.phar' => 1, | |
| 'skimiaangularbundle.php' => 1, | |
| 'jquery.form.min.js' => 1, | |
| 'update-3.0' => 1, | |
| 'update-2.0' => 1, | |
| 'update-1.0' => 1, | |
| 'commandhandler.php' => 1, | |
| 'skillbertosonatapagemenubundle.php' => 1, | |
| 'skillbertosonataextendedadminbundle.php' => 1, | |
| 'skillbertoroutingextrabundle.php' => 1, | |
| 'skillbertolesscssbundle.php' => 1, | |
| 'skillbertoconsoleextendbundle.php' => 1, | |
| 'cubeasset.php' => 1, | |
| 'skillatwigmarkdownbundle.php' => 1, | |
| 'execute.php' => 1, | |
| 'highstock.php' => 1, | |
| 'highmaps.php' => 1, | |
| 'proxmoxcomponent.php' => 1, | |
| 'httpbasicauthcomponent.php' => 1, | |
| 'googleapicomponent.php' => 1, | |
| 'externallinksmodule.php' => 1, | |
| 'externallinkscomponent.php' => 1, | |
| 'ckeditorpresets.php' => 1, | |
| 'unifyasset.php' => 1, | |
| 'tshopasset.php' => 1, | |
| 'smartyasset.php' => 1, | |
| 'smartyadminasset.php' => 1, | |
| 'dbdumpermodule.php' => 1, | |
| '_settingsfrom.php' => 1, | |
| 'typeserializer.php' => 1, | |
| 'zmqbroker.php' => 1, | |
| 'areachart.php' => 1, | |
| 'fuzzydatebehavior.php' => 1, | |
| 'datelineasset.php' => 1, | |
| 'dateline.php' => 1, | |
| 'bandoneonasset.php' => 1, | |
| 'bandoneon.php' => 1, | |
| '_alphatrait.php' => 1, | |
| 'arraydataprovider.php' => 1, | |
| 'alphapager.php' => 1, | |
| 'spec4php.php' => 1, | |
| 'spec4php.bat' => 1, | |
| 'sixdaysopcachebundle.php' => 1, | |
| 'zmqworker.php' => 1, | |
| 'whereparser.php' => 1, | |
| 'columnchart.php' => 1, | |
| 'cachehelper.php' => 1, | |
| 'cacheactivequery.php' => 1, | |
| 'activequerycachehelper.php' => 1, | |
| 'smtoolsplugin.php' => 1, | |
| 'kphoensitemapbundle.php' => 1, | |
| 'framework2.sql' => 1, | |
| 'siriuslabaccountmanagerbundle.php' => 1, | |
| 'textutils.php' => 1, | |
| 'bvrbundle.php' => 1, | |
| 'sircampgooglemapformtypebundle.php' => 1, | |
| 'siphocpdfbundle.php' => 1, | |
| 'vadmin.php' => 1, | |
| 'listjs.php' => 1, | |
| 'bubblechart.php' => 1, | |
| 'geochart.php' => 1, | |
| 'cmsauthclientsettings.php' => 1, | |
| 'jquery.jqicon.js' => 1, | |
| 'cmsauthclientmodule.php' => 1, | |
| 'cmsauthclientcollection.php' => 1, | |
| 'settingsassetsautocompress.php' => 1, | |
| 'cmsagentmodule.php' => 1, | |
| 'cmsagentcomponent.php' => 1, | |
| 'daemonsbundle.php' => 1, | |
| 'fix_syle.sh' => 1, | |
| 'fix_style.sh' => 1, | |
| 'skautisbundle.php' => 1, | |
| 'min.jquery.jqdesktop.js' => 1, | |
| 'jquery.jqwindow.js' => 1, | |
| 'jquery.jqtaskbar.js' => 1, | |
| 'jquery.jqlayout.js' => 1, | |
| 'jquery.jqdesktop.js' => 1, | |
| 'linechart.php' => 1, | |
| 'jqdesktop.jquery.json' => 1, | |
| 'telexasset.php' => 1, | |
| 'telex.php' => 1, | |
| 'tagsuggestaction.php' => 1, | |
| 'tageditorasset.php' => 1, | |
| 'tageditor.php' => 1, | |
| 'tagbehavior.php' => 1, | |
| 'symbolpicker.php' => 1, | |
| 'symbolcolorsasset.php' => 1, | |
| 'spatialhelper.php' => 1, | |
| 'uploaderasset.php' => 1, | |
| 'illustration.php' => 1, | |
| 'illustrated.php' => 1, | |
| 'scatterchart.php' => 1, | |
| 'onesky.phar' => 1, | |
| 'rpcbundle.php' => 1, | |
| 'chatjs.php' => 1, | |
| 'monologbridge.php' => 1, | |
| 'linux0uidcontentfinderbundle.php' => 1, | |
| 'staticwp.php' => 1, | |
| 'whoopsbridge.php' => 1, | |
| 'viewmanager.php' => 1, | |
| 'servicefactory.php' => 1, | |
| 'ruleinterface.php' => 1, | |
| 'mimetypestore.php' => 1, | |
| 'errorstore.php' => 1, | |
| 'rsscollector.php' => 1, | |
| 'articleextractor.php' => 1, | |
| 'routerfactory.php' => 1, | |
| 'routebuildertrait.php' => 1, | |
| 'httpmethod.php' => 1, | |
| 'listenerpriorityqueue.php' => 1, | |
| 'default-avatar.png' => 1, | |
| 'listenerinterface.php' => 1, | |
| 'callbacklistener.php' => 1, | |
| 'servicedependency.php' => 1, | |
| 'dependencyinterface.php' => 1, | |
| 'helperregistry.php' => 1, | |
| 'helpcommand.php' => 1, | |
| 'dataobject.php' => 1, | |
| 'cakebridge.php' => 1, | |
| 'memcachedcache.php' => 1, | |
| 'memcachecache.php' => 1, | |
| 'arraycache.php' => 1, | |
| 'abstractcache.php' => 1, | |
| 'eventstore.php' => 1, | |
| 'smacharahtml2pdfbundle.php' => 1, | |
| 'smadasymfonytoolsbundle.php' => 1, | |
| 'apigen-config.neon' => 1, | |
| 'ezimagecropbundle.php' => 1, | |
| 'controller_front.php' => 1, | |
| 'controller_back.php' => 1, | |
| 'standardloader.php' => 1, | |
| 'standardformatter.php' => 1, | |
| 'iformatter.php' => 1, | |
| 'control.php' => 1, | |
| 'echartasset.php' => 1, | |
| 'echart.php' => 1, | |
| 'bar.php' => 1, | |
| 'phpunit_hhvm.sh' => 1, | |
| 'phpunit-coverage.bat' => 1, | |
| 'phpunit_smarty.php' => 1, | |
| 'smartivehandlebarsbundle.php' => 1, | |
| 'ezcontenttypemanagerbundle.php' => 1, | |
| 'smadasymfonytypeextrasbundle.php' => 1, | |
| 'flashmessage.php' => 1, | |
| 'monologlogroute.php' => 1, | |
| 'monologerrorhandler.php' => 1, | |
| 'monologcomponent.php' => 1, | |
| 'codemelli.php' => 1, | |
| 'jalali_date.php' => 1, | |
| 'magentoexception.php' => 1, | |
| 'magentoevents.php' => 1, | |
| 'magentobundle.php' => 1, | |
| 'drushrc.php.sample' => 1, | |
| 'cerbere.info' => 1, | |
| 'sample.yml' => 1, | |
| 'ajaxasset.php' => 1, | |
| 'smallteamimagebundle.php' => 1, | |
| 'custom.ini' => 1, | |
| 'cahngelog' => 1, | |
| 'skonsoftlftpdeployementbundle.php' => 1, | |
| 'abstracttransactionalproducer.php' => 1, | |
| 'zh_hk.csv.20160221' => 1, | |
| 'zh_hk.csv' => 1, | |
| 'demo_database.sqlite' => 1, | |
| 'skydiablophpseclibbundle.php' => 1, | |
| 'phpseclibautoloadersf21.php' => 1, | |
| 'phpseclibautoloadersf20.php' => 1, | |
| 'crypt_random.interface' => 1, | |
| 'skuolasitemapbundle.php' => 1, | |
| 'bcapi.class.php' => 1, | |
| 'skphp.php' => 1, | |
| 'skrzbunnybundle.php' => 1, | |
| 'bunnymanager.php' => 1, | |
| 'bunnyexception.php' => 1, | |
| 'abstractproducer.php' => 1, | |
| 'zh_hk.csv.20160320' => 1, | |
| 'skrzautowiringbundle.php' => 1, | |
| 'scaffolding.html' => 1, | |
| 'javascript.html' => 1, | |
| 'getting-started.html' => 1, | |
| 'extend.html' => 1, | |
| 'customize.html' => 1, | |
| 'components.html' => 1, | |
| 'base-css.html' => 1, | |
| 'skonsoftvehiclemanagerbundle.php' => 1, | |
| 'skonsofttranslatorbundle.php' => 1, | |
| 'skonsoftredirectorbundle.php' => 1, | |
| 'skonsoftpostaladdressbundle.php' => 1, | |
| 'skonsoftcompanyhierarchybundle.php' => 1, | |
| 'zh_hk.csv.20160222' => 1, | |
| 'license-cc0' => 1, | |
| 'out' => 1, | |
| 'class.router.php' => 1, | |
| 'recordlist.php' => 1, | |
| '.scruninizer.yml' => 1, | |
| 'singletoninterface.php' => 1, | |
| 'basesingleton.php' => 1, | |
| 'basemethods.php' => 1, | |
| 'examplelogger.php' => 1, | |
| 'phpstan.neon' => 1, | |
| 'performance.php' => 1, | |
| 'sleepy.php' => 1, | |
| 'router.web.config' => 1, | |
| 'router.htaccess' => 1, | |
| 'class.template.php' => 1, | |
| 'class.sm.php' => 1, | |
| 'class.hooks.php' => 1, | |
| 'license-unlicense' => 1, | |
| 'class.debug.php' => 1, | |
| 'fancyguytodomvcclientbundle.php' => 1, | |
| 'update0.4.0' => 1, | |
| 'eovzmicrosofttranslatorapiclientbundle.php' => 1, | |
| 'hellowordplsimpleentitygeneratorbundle.php' => 1, | |
| 'environment.ini' => 1, | |
| 'update_app' => 1, | |
| 'init_update_app' => 1, | |
| 'bp-default-data.php' => 1, | |
| 'spdx-licenses.json' => 1, | |
| 'service_listing.php' => 1, | |
| 'template.twig' => 1, | |
| 'mimetypes.json' => 1, | |
| 'customize.json' => 1, | |
| 'chatroom.php' => 1, | |
| 'whatsappjs.php' => 1, | |
| 'zphp_jg.jpg' => 1, | |
| 'ltmain.sh' => 1, | |
| 'zmq_device.lo' => 1, | |
| 'zmq_device.c' => 1, | |
| 'zmq_clock.lo' => 1, | |
| 'zmq_clock.c' => 1, | |
| 'zmq.lo' => 1, | |
| 'zmq.la' => 1, | |
| 'zmq.c' => 1, | |
| 'php_zmq_private.h' => 1, | |
| 'php_zmq_pollset.h' => 1, | |
| 'php_zmq.h' => 1, | |
| 'php-zmq.spec' => 1, | |
| 'mkinstalldirs' => 1, | |
| 'missing' => 1, | |
| 'libtool' => 1, | |
| 'zmq_fd_stream.lo' => 1, | |
| 'install-sh' => 1, | |
| 'configure.in' => 1, | |
| 'config.sub' => 1, | |
| 'config.status' => 1, | |
| 'config.nice' => 1, | |
| 'config.log' => 1, | |
| 'config.h.in' => 1, | |
| 'config.h' => 1, | |
| 'config.guess' => 1, | |
| 'aclocal.m4' => 1, | |
| 'acinclude.m4' => 1, | |
| 'makefile.objects' => 1, | |
| 'makefile.global' => 1, | |
| 'zmq_fd_stream.c' => 1, | |
| 'zmq_pollset.c' => 1, | |
| '.deps' => 1, | |
| 'pugpig_logging.php' => 1, | |
| 'phploc.bat' => 1, | |
| 'phpcpd.php' => 1, | |
| 'phpcpd.bat' => 1, | |
| 'sw' => 1, | |
| 'timber-rewrite-image-domain.php' => 1, | |
| 'croissant-sane-setup.php' => 1, | |
| 'croissant-admin-theme.php' => 1, | |
| 'shortlist-manifest-generator.php' => 1, | |
| 'pugpig_url_rewrites.php' => 1, | |
| 'pugpig_settings.php' => 1, | |
| 'pugpig_notifications_wordpress.php' => 1, | |
| 'pugpig_metaboxes.php' => 1, | |
| 'pugpig_manifests_wordpress.php' => 1, | |
| 'pugpig_html_manifest.php' => 1, | |
| 'zmq_pollset.lo' => 1, | |
| 'pugpig_filesystem.php' => 1, | |
| 'pugpig_change_hooks.php' => 1, | |
| 'pugpig_article_rewrite.php' => 1, | |
| 'pugpig_admin.php' => 1, | |
| 'pugpig_ad_bundles.php' => 1, | |
| 'old_pugpig.php' => 1, | |
| 'acf-typography.php' => 1, | |
| 'eula_en' => 1, | |
| 'eula' => 1, | |
| 'viewbundle.php' => 1, | |
| 'errorbundle.php' => 1, | |
| 'twitchapibundle.php' => 1, | |
| 'zmq_sockopt.lo' => 1, | |
| 'zmq_sockopt.c' => 1, | |
| 'makefile.fragments' => 1, | |
| 'timelinebundle.php' => 1, | |
| 'sami-md.cfg.php' => 1, | |
| 'httpauth.php' => 1, | |
| 'markupsolariumbundle.php' => 1, | |
| 'xml_doc.php' => 1, | |
| 'xml_curl.php' => 1, | |
| 'xml_api_call.php' => 1, | |
| 'urlsearchparams.php' => 1, | |
| 'systemcall.php' => 1, | |
| 'server_event.php' => 1, | |
| 'searchparams.php' => 1, | |
| 'namespacedfunction.php' => 1, | |
| 'magic_object.php' => 1, | |
| 'magic_cache.php' => 1, | |
| 'jsoncurl.php' => 1, | |
| 'ieconditionalcomment.php' => 1, | |
| 'html_element.php' => 1, | |
| 'hostbase-ansible.phar' => 1, | |
| 'html_el.php' => 1, | |
| 'html_doc.php' => 1, | |
| 'githubwebhook.php' => 1, | |
| 'exceptionlog.php' => 1, | |
| 'error_reporter.php' => 1, | |
| 'error_event.php' => 1, | |
| 'creative_commons_license.php' => 1, | |
| 'acimagepng.php' => 1, | |
| 'acimagejpg.php' => 1, | |
| 'acimagegif.php' => 1, | |
| 'acimage.php' => 1, | |
| 'accolor.php' => 1, | |
| 'seocontroller.php' => 1, | |
| 'haproxycc.phar' => 1, | |
| 'hostbase-manifest.json' => 1, | |
| 'keepassphp-cli.php' => 1, | |
| 'httpexceptiontest.php' => 1, | |
| 'ajaxopen.php' => 1, | |
| 'phpfun.php' => 1, | |
| 'statementbuilderinterface.php' => 1, | |
| 'objectcontainerinterface.php' => 1, | |
| 'jsonobjectcontainer.php' => 1, | |
| 'psr4autoloader.php' => 1, | |
| 'shivasversioningbundle.php' => 1, | |
| 'shivasbouncerbundle.php' => 1, | |
| 'shivasphealbundle.php' => 1, | |
| 'shiroyukiroutebundle.php' => 1, | |
| 'nature.functiontest.php' => 1, | |
| 'configuretest.php' => 1, | |
| 'curltest.php' => 1, | |
| 'apptest.php' => 1, | |
| 'hostbase.phar' => 1, | |
| 'nature.function.php' => 1, | |
| 'templatedesignerlayoutbundle.php' => 1, | |
| 'legendary_creatures_from_japan.json' => 1, | |
| 'dotdeb.list' => 1, | |
| 'docker-test.sh' => 1, | |
| 'docker-run.sh' => 1, | |
| 'docker-build.sh' => 1, | |
| 'loaderio-runner' => 1, | |
| 'heroku_create' => 1, | |
| 'spallocinebundle.php' => 1, | |
| 'noshreminder' => 1, | |
| 'noshfax' => 1, | |
| 'noshbackup' => 1, | |
| '.google1' => 1, | |
| 'phploc.php' => 1, | |
| 'sami.cfg.php' => 1, | |
| 'whatsapp.php' => 1, | |
| 'maintenance.html.template' => 1, | |
| 'webbot.php' => 1, | |
| 'superthumb.jpg' => 1, | |
| 'validate.sh' => 1, | |
| 'run-caketests.php' => 1, | |
| 'urlcheck.php' => 1, | |
| 'spider.php' => 1, | |
| 'simgroepconcurrentspiderbundle.php' => 1, | |
| 'persistabledocument.php' => 1, | |
| 'invalidcontentexception.php' => 1, | |
| 'crawljob.php' => 1, | |
| 'terena_ssl_ca.pem' => 1, | |
| 'mollom-captcha-player.swf' => 1, | |
| '.platform.yml' => 1, | |
| 'maintenance.htaccess.template' => 1, | |
| 'gumdrop.php' => 1, | |
| 'git-deploy.sh' => 1, | |
| 'environment.template' => 1, | |
| 'capfile.template' => 1, | |
| '_configure_database.php' => 1, | |
| 'node_web.yml' => 1, | |
| 'node_ha.yml' => 1, | |
| 'node_deploynaut.yml' => 1, | |
| 'framework.patch' => 1, | |
| 'dependent-modules' => 1, | |
| 'buildfile.xml' => 1, | |
| 'symlinktask.php' => 1, | |
| 'silverstripetesttask.php' => 1, | |
| 'silverstripedeploytask.php' => 1, | |
| 'launch.sh' => 1, | |
| 'travis_build.sh' => 1, | |
| 'loadmodulestask.php' => 1, | |
| 'simplethingsformextrabundle.php' => 1, | |
| 'ageapibundle.php' => 1, | |
| 'sinencoallopasspaymentbundle.php' => 1, | |
| 'sinencoallopassapibundle.php' => 1, | |
| 'sineflowelasticsearchbundle.php' => 1, | |
| 'gifcreator.php' => 1, | |
| '.simpspector.yml' => 1, | |
| 'stripeevents.php' => 1, | |
| 'simplewebstripebundle.php' => 1, | |
| 'simplewebsaasbundle.php' => 1, | |
| 'saasevents.php' => 1, | |
| 'simplewebbugsnagbundle.php' => 1, | |
| 'simpspector.yml' => 1, | |
| 'simplethingssolrbundle.php' => 1, | |
| 'simplethingsdistributionbundle.php' => 1, | |
| 'atom.xml.twig' => 1, | |
| 'simplesms.php' => 1, | |
| 'alipaybundle.php' => 1, | |
| 'deployer' => 1, | |
| 'mvc.sql' => 1, | |
| 'quickrbac.php' => 1, | |
| 'baseassetbundle.php' => 1, | |
| 'slamewhitelabelbundle.php' => 1, | |
| 'justgageassets.php' => 1, | |
| 'justgage.php' => 1, | |
| 'anonymoususercomponent.php' => 1, | |
| 'sitemap.xsl' => 1, | |
| 'sitemap.xml.twig' => 1, | |
| 'search_db.json.twig' => 1, | |
| 'page_db.json.twig' => 1, | |
| 'silverstripebuildtask.php' => 1, | |
| 'copyfolderstask.php' => 1, | |
| 'workflux.xsd' => 1, | |
| 'ndy' => 1, | |
| 'sikindustriesbundlestrobauserbundle.php' => 1, | |
| 'sikindustriesbundlesfacebookbundle.php' => 1, | |
| 'header.png' => 1, | |
| 'ico.php' => 1, | |
| 'start-redis-servers.sh' => 1, | |
| 'installdefaultapp.php' => 1, | |
| 'phpunit_db_config.travis.sqlite.php' => 1, | |
| 'phpunit_db_config.travis.mysql.php' => 1, | |
| 'phpunit_db_config.php.dist' => 1, | |
| 'siciarekphotogallerybundle.php' => 1, | |
| 'getresponseapibundle.php' => 1, | |
| 'siciarekchatbundle.php' => 1, | |
| 'properties.cnf.dist' => 1, | |
| 'trashquerybehavior.php' => 1, | |
| 'lumoon' => 1, | |
| 'trashquery.php' => 1, | |
| 'trashbehavior.php' => 1, | |
| 'translitinput.php' => 1, | |
| 'standartcontroller.php' => 1, | |
| 'urlcolumn.php' => 1, | |
| 'translatetrait.php' => 1, | |
| 'formfooter.php' => 1, | |
| 'userdatabehavior.php' => 1, | |
| 'lockedbehavior.php' => 1, | |
| 'dynamicquery.php' => 1, | |
| 'beforequerytrait.php' => 1, | |
| '_intellij_phpunit_launcher.php' => 1, | |
| 'laravelblog' => 1, | |
| 'browserconfig.xml' => 1, | |
| 'lessc-adminlte' => 1, | |
| 'applypatchestask.php' => 1, | |
| 'monologserviceprovider.php' => 1, | |
| 'sisocontentloaderbundle.php' => 1, | |
| 'castanet.php' => 1, | |
| 'removetemplates.sh' => 1, | |
| 's3-expand' => 1, | |
| 'opsworks-deploy' => 1, | |
| 'local.env.dist' => 1, | |
| 'ecs-deploy' => 1, | |
| 'vardumperserviceprovider.php' => 1, | |
| 'twigserviceprovider.php' => 1, | |
| 'swiftmailerserviceprovider.php' => 1, | |
| 'servicecontrollerserviceprovider.php' => 1, | |
| 'securityserviceprovider.php' => 1, | |
| 'remembermeserviceprovider.php' => 1, | |
| 'localeserviceprovider.php' => 1, | |
| 'jenkins.yml' => 1, | |
| 'httpkernelserviceprovider.php' => 1, | |
| 'httpfragmentserviceprovider.php' => 1, | |
| 'httpcacheserviceprovider.php' => 1, | |
| 'exceptionhandlerserviceprovider.php' => 1, | |
| 'doctrineserviceprovider.php' => 1, | |
| 'csrfserviceprovider.php' => 1, | |
| 'assetserviceprovider.php' => 1, | |
| 'eventlistenerproviderinterface.php' => 1, | |
| 'controllerproviderinterface.php' => 1, | |
| 'bootableproviderinterface.php' => 1, | |
| 'read_me.html' => 1, | |
| 'amfphp_updates.php' => 1, | |
| 'lessc' => 1, | |
| '.karma' => 1, | |
| 'journal-of-child-and-adolescent-psychopharmacology.csl' => 1, | |
| 'journal-of-cellular-and-molecular-medicine.csl' => 1, | |
| 'rzcalendarbundle.php' => 1, | |
| 'locales-hr-hr.xml' => 1, | |
| 'locales-nn-no.xml' => 1, | |
| 'locales-nl-nl.xml' => 1, | |
| 'locales-nb-no.xml' => 1, | |
| 'locales-mn-mn.xml' => 1, | |
| 'locales-lv-lv.xml' => 1, | |
| 'locales-lt-lt.xml' => 1, | |
| 'locales-ko-kr.xml' => 1, | |
| 'locales-km-kh.xml' => 1, | |
| 'locales-ja-jp.xml' => 1, | |
| 'locales-it-it.xml' => 1, | |
| 'locales-is-is.xml' => 1, | |
| 'locales-id-id.xml' => 1, | |
| 'locales-hu-hu.xml' => 1, | |
| 'locales-he-il.xml' => 1, | |
| 'locales-pt-br.xml' => 1, | |
| 'locales-fr-fr.xml' => 1, | |
| 'locales-fr-ca.xml' => 1, | |
| 'locales-fi-fi.xml' => 1, | |
| 'locales-fa-ir.xml' => 1, | |
| 'locales-eu.xml' => 1, | |
| 'locales-et-ee.xml' => 1, | |
| 'locales-es-mx.xml' => 1, | |
| 'locales-es-es.xml' => 1, | |
| 'locales-es-cl.xml' => 1, | |
| 'locales-en-us.xml' => 1, | |
| 'locales-en-gb.xml' => 1, | |
| 'locales-el-gr.xml' => 1, | |
| 'locales-de-de.xml' => 1, | |
| 'locales-pl-pl.xml' => 1, | |
| 'locales-pt-pt.xml' => 1, | |
| 'locales-de-at.xml' => 1, | |
| 'acm-sigchi-proceedings-extended-abstract-format.csl' => 1, | |
| 'acta-polytechnica.csl' => 1, | |
| 'acta-philosophica.csl' => 1, | |
| 'acta-pharmaceutica.csl' => 1, | |
| 'acta-pharmaceutica-sinica-b.csl' => 1, | |
| 'acta-palaeontologica-polonica.csl' => 1, | |
| 'acta-ophthalmologica.csl' => 1, | |
| 'acta-neurochirurgica.csl' => 1, | |
| 'acta-naturae.csl' => 1, | |
| 'acta-anaesthesiologica-taiwanica.csl' => 1, | |
| 'acta-anaesthesiologica-scandinavica.csl' => 1, | |
| 'acs-nano.csl' => 1, | |
| 'acm-siggraph.csl' => 1, | |
| 'acm-sigchi-proceedings.csl' => 1, | |
| 'acm-sig-proceedings.csl' => 1, | |
| 'locales-ro-ro.xml' => 1, | |
| 'acm-sig-proceedings-long-author-list.csl' => 1, | |
| 'academy-of-management-review.csl' => 1, | |
| 'locales.json' => 1, | |
| 'locales-zh-tw.xml' => 1, | |
| 'locales-zh-cn.xml' => 1, | |
| 'locales-vi-vn.xml' => 1, | |
| 'locales-uk-ua.xml' => 1, | |
| 'locales-tr-tr.xml' => 1, | |
| 'locales-th-th.xml' => 1, | |
| 'locales-sv-se.xml' => 1, | |
| 'locales-sr-rs.xml' => 1, | |
| 'locales-sl-si.xml' => 1, | |
| 'locales-sk-sk.xml' => 1, | |
| 'locales-ru-ru.xml' => 1, | |
| 'locales-de-ch.xml' => 1, | |
| 'locales-da-dk.xml' => 1, | |
| 'acta-societatis-botanicorum-poloniae.csl' => 1, | |
| 'adminpage.php' => 1, | |
| 'djjob.php' => 1, | |
| 'phpwee.php' => 1, | |
| 'abstractquery.php' => 1, | |
| 'iniconfig.php' => 1, | |
| 'extending' => 1, | |
| 'metricbundle.php' => 1, | |
| 'pimprestashopconnectorbundle.php' => 1, | |
| 'frozone.jpg' => 1, | |
| 'twitterstreambundle.php' => 1, | |
| 'requestevents.php' => 1, | |
| 'load-composer.php' => 1, | |
| 'postmetabox.php' => 1, | |
| 'boxespage.php' => 1, | |
| 'url-query.php' => 1, | |
| 'crosswalkquery.php' => 1, | |
| 'side.php' => 1, | |
| 'side-user.php' => 1, | |
| 'side-post.php' => 1, | |
| 'side-attachment.php' => 1, | |
| 'shortcodes.php' => 1, | |
| 'reciprocal-connection-type.php' => 1, | |
| 'query-user.php' => 1, | |
| 'query-post.php' => 1, | |
| 'list-renderer.php' => 1, | |
| 'item-user.php' => 1, | |
| 'item-post.php' => 1, | |
| 'item-attachment.php' => 1, | |
| 'item-any.php' => 1, | |
| 'crosswalk.php' => 1, | |
| 'crosswalkresponse.php' => 1, | |
| 'locales-cy-gb.xml' => 1, | |
| 'changelog-4.6' => 1, | |
| 'locales-cs-cz.xml' => 1, | |
| 'locales-ca-ad.xml' => 1, | |
| 'locales-bg-bg.xml' => 1, | |
| 'locales-ar.xml' => 1, | |
| 'locales-af-za.xml' => 1, | |
| 'generate-api-local.sh' => 1, | |
| 'changelog-5.4' => 1, | |
| 'changelog-5.3' => 1, | |
| 'changelog-5.2' => 1, | |
| 'changelog-5.1' => 1, | |
| 'changelog-5.0' => 1, | |
| 'changelog-4.8' => 1, | |
| 'changelog-4.7' => 1, | |
| 'changelog-4.5' => 1, | |
| 'dbunit' => 1, | |
| 'changelog-4.4' => 1, | |
| 'changelog-4.3' => 1, | |
| 'changelog-4.2' => 1, | |
| 'changelog-4.1' => 1, | |
| 'phptok' => 1, | |
| 'phploc' => 1, | |
| 'phpdcd' => 1, | |
| 'phpcpd' => 1, | |
| 'phpcov' => 1, | |
| 'changelog-3.3' => 1, | |
| 'changelog-2.2' => 1, | |
| 'pdepend-process' => 1, | |
| 'hhvm-wrapper' => 1, | |
| 'de-legacy-fy' => 1, | |
| 'acta-psychiatrica-scandinavica.csl' => 1, | |
| 'acta-universitatis-agriculturae-sueciae.csl' => 1, | |
| 'indeterminate-connection-type.php' => 1, | |
| 'annual-review-of-nuclear-and-particle-science.csl' => 1, | |
| 'apa-no-ampersand.csl' => 1, | |
| 'apa-fr-universite-de-montreal.csl' => 1, | |
| 'apa-fr-provost.csl' => 1, | |
| 'apa-cv.csl' => 1, | |
| 'apa-annotated-bibliography.csl' => 1, | |
| 'apa-5th-edition.csl' => 1, | |
| 'antiquity.csl' => 1, | |
| 'anticancer-research.csl' => 1, | |
| 'antarctic-science.csl' => 1, | |
| 'annual-reviews.csl' => 1, | |
| 'annual-reviews-without-titles.csl' => 1, | |
| 'annual-reviews-author-date.csl' => 1, | |
| 'annual-reviews-alphabetical.csl' => 1, | |
| 'annual-review-of-medicine.csl' => 1, | |
| 'apa-single-spaced.csl' => 1, | |
| 'annual-review-of-astronomy-and-astrophysics.csl' => 1, | |
| 'annals-of-the-association-of-american-geographers.csl' => 1, | |
| 'annals-of-oncology.csl' => 1, | |
| 'annals-of-neurology.csl' => 1, | |
| 'annals-of-botany.csl' => 1, | |
| 'annals-of-biomedical-engineering.csl' => 1, | |
| 'annals-of-applied-biology.csl' => 1, | |
| 'annales.csl' => 1, | |
| 'annalen-des-naturhistorischen-museums-in-wien.csl' => 1, | |
| 'animal-welfare.csl' => 1, | |
| 'angiologia.csl' => 1, | |
| 'angewandte-chemie.csl' => 1, | |
| 'anesthesiology.csl' => 1, | |
| 'apa-no-doi-no-issue.csl' => 1, | |
| 'apa-tr.csl' => 1, | |
| 'analytical-sciences.csl' => 1, | |
| 'asa-cssa-sssa.csl' => 1, | |
| 'associacao-nacional-de-pesquisa-e-ensino-em-transportes.csl' => 1, | |
| 'associacao-brasileira-de-normas-tecnicas.csl' => 1, | |
| 'associacao-brasileira-de-normas-tecnicas-usp-fmvz.csl' => 1, | |
| 'associacao-brasileira-de-normas-tecnicas-ufpr.csl' => 1, | |
| 'associacao-brasileira-de-normas-tecnicas-ufmg-face-initials.csl' => 1, | |
| 'associacao-brasileira-de-normas-tecnicas-ufmg-face-full.csl' => 1, | |
| 'associacao-brasileira-de-normas-tecnicas-ufjf.csl' => 1, | |
| 'associacao-brasileira-de-normas-tecnicas-note.csl' => 1, | |
| 'associacao-brasileira-de-normas-tecnicas-ipea.csl' => 1, | |
| 'associacao-brasileira-de-normas-tecnicas-eceme.csl' => 1, | |
| 'asian-studies-review.csl' => 1, | |
| 'asia-and-the-pacific-policy-studies.csl' => 1, | |
| 'asaio-journal.csl' => 1, | |
| 'arzneimitteltherapie.csl' => 1, | |
| 'apa.csl' => 1, | |
| 'arthritis-and-rheumatism.csl' => 1, | |
| 'artery-research.csl' => 1, | |
| 'art-history.csl' => 1, | |
| 'archivos-de-la-sociedad-espanola-de-oftalmologia.csl' => 1, | |
| 'archives-of-physical-medicine-and-rehabilitation.csl' => 1, | |
| 'archiv-fur-geschichte-der-philosophie.csl' => 1, | |
| 'archiv-fur-die-civilistische-praxis.csl' => 1, | |
| 'archeologie-medievale.csl' => 1, | |
| 'archaeometry.csl' => 1, | |
| 'arachnology.csl' => 1, | |
| 'arachne.csl' => 1, | |
| 'aquatic-living-resources.csl' => 1, | |
| 'aquatic-conservation.csl' => 1, | |
| 'applied-spectroscopy.csl' => 1, | |
| 'anesthesia-and-analgesia.csl' => 1, | |
| 'american-veterinary-medical-association.csl' => 1, | |
| 'administrative-science-quarterly.csl' => 1, | |
| 'ameghiniana.csl' => 1, | |
| 'american-geophysical-union.csl' => 1, | |
| 'american-fisheries-society.csl' => 1, | |
| 'american-chemical-society.csl' => 1, | |
| 'american-chemical-society-with-titles.csl' => 1, | |
| 'american-chemical-society-with-titles-sentence-case.csl' => 1, | |
| 'american-chemical-society-with-titles-sentence-case-doi.csl' => 1, | |
| 'american-chemical-society-with-titles-page-first.csl' => 1, | |
| 'american-chemical-society-with-titles-no-et-al.csl' => 1, | |
| 'american-chemical-society-page-first.csl' => 1, | |
| 'american-chemical-society-author-date.csl' => 1, | |
| 'american-association-of-petroleum-geologists.csl' => 1, | |
| 'american-association-for-cancer-research.csl' => 1, | |
| 'american-anthropological-association.csl' => 1, | |
| 'ambio.csl' => 1, | |
| 'american-institute-of-aeronautics-and-astronautics.csl' => 1, | |
| 'alternatives-to-animal-experimentation.csl' => 1, | |
| 'allergy.csl' => 1, | |
| 'allergology-international.csl' => 1, | |
| 'alexandria-journal-of-medicine.csl' => 1, | |
| 'aids.csl' => 1, | |
| 'aging-cell.csl' => 1, | |
| 'african-zoology.csl' => 1, | |
| 'african-journal-of-emergency-medicine.csl' => 1, | |
| 'advances-in-complex-systems.csl' => 1, | |
| 'advances-in-alzheimers-disease.csl' => 1, | |
| 'advanced-materials.csl' => 1, | |
| 'advanced-functional-materials.csl' => 1, | |
| 'advanced-engineering-materials.csl' => 1, | |
| 'american-heart-association.csl' => 1, | |
| 'american-institute-of-physics.csl' => 1, | |
| 'american-sociological-association.csl' => 1, | |
| 'american-medical-association-alphabetical.csl' => 1, | |
| 'american-society-of-mechanical-engineers.csl' => 1, | |
| 'american-society-of-civil-engineers.csl' => 1, | |
| 'american-society-for-pharmacology-and-experimental-therapeutics.csl' => 1, | |
| 'american-society-for-microbiology.csl' => 1, | |
| 'american-political-science-association.csl' => 1, | |
| 'american-phytopathological-society.csl' => 1, | |
| 'american-physiological-society.csl' => 1, | |
| 'american-physics-society.csl' => 1, | |
| 'american-mineralogist.csl' => 1, | |
| 'american-meteorological-society.csl' => 1, | |
| 'american-medical-association.csl' => 1, | |
| 'american-medical-association-no-url.csl' => 1, | |
| 'american-medical-association-no-et-al.csl' => 1, | |
| 'american-marketing-association.csl' => 1, | |
| 'american-journal-of-agricultural-economics.csl' => 1, | |
| 'american-journal-of-surgical-pathology.csl' => 1, | |
| 'american-journal-of-respiratory-and-critical-care-medicine.csl' => 1, | |
| 'american-journal-of-primatology.csl' => 1, | |
| 'american-journal-of-political-science.csl' => 1, | |
| 'american-journal-of-plant-sciences.csl' => 1, | |
| 'american-journal-of-orthodontics-and-dentofacial-orthopedics.csl' => 1, | |
| 'american-journal-of-neuroradiology.csl' => 1, | |
| 'american-journal-of-medical-genetics.csl' => 1, | |
| 'american-journal-of-human-genetics.csl' => 1, | |
| 'american-journal-of-health-behavior.csl' => 1, | |
| 'american-journal-of-epidemiology.csl' => 1, | |
| 'american-journal-of-clinical-pathology.csl' => 1, | |
| 'american-journal-of-botany.csl' => 1, | |
| 'american-journal-of-archaeology.csl' => 1, | |
| 'indeterminate-directed-connection-type.php' => 1, | |
| 'direction-strategy.php' => 1, | |
| 'association-for-computing-machinery.csl' => 1, | |
| 'tinybox2.js' => 1, | |
| 'network.php' => 1, | |
| 'emailstatus.php' => 1, | |
| 'ya_search.js' => 1, | |
| 'yasearch.php' => 1, | |
| 'iurl.php' => 1, | |
| 'smscua.php' => 1, | |
| 'scalecontroller.php' => 1, | |
| 'letsads.php' => 1, | |
| 'mixin.less' => 1, | |
| 'media.less' => 1, | |
| 'lessc.php' => 1, | |
| 'esputnik.php' => 1, | |
| 'coffeescript.php' => 1, | |
| 'tinybox.js' => 1, | |
| 'badcowaddressbundle.php' => 1, | |
| 'tinybox.css' => 1, | |
| 'smoothscroll.js' => 1, | |
| 'sjsslider.js' => 1, | |
| 'select.less' => 1, | |
| 'select.js' => 1, | |
| 'searchfilter.js' => 1, | |
| 'sjsmd5.js' => 1, | |
| 'sjslighbox.js' => 1, | |
| 'trim.js' => 1, | |
| 'sizzle.js' => 1, | |
| 'events.js' => 1, | |
| 'dom.js' => 1, | |
| 'compatibility.js' => 1, | |
| 'helloworld.class.php' => 1, | |
| '__fff__.php' => 1, | |
| '_samsonjs.js' => 1, | |
| 'inputswitch.php' => 1, | |
| 'definitions.php' => 1, | |
| 'simplefilter.php' => 1, | |
| 'spresssitemapxml.php' => 1, | |
| 'xmpp-enabled.php' => 1, | |
| 'juick-xp.php' => 1, | |
| 'license.fixtures' => 1, | |
| 'wcurl.php' => 1, | |
| 'wp-less.php' => 1, | |
| 'sparkpost-wp-mail.php' => 1, | |
| 'storageasset.php' => 1, | |
| 'themebootstrap.php' => 1, | |
| 'itemselectasset.php' => 1, | |
| 'itemselect.php' => 1, | |
| 'gridkeyval.php' => 1, | |
| 'social.html' => 1, | |
| 'daterangecolumn.php' => 1, | |
| 'fieldsetasset.php' => 1, | |
| 'ckeditorpackagepluginasset.php' => 1, | |
| 'browserasset.php' => 1, | |
| 'manytomanybehavior.php' => 1, | |
| 'areaasset.php' => 1, | |
| 'area.php' => 1, | |
| 'tag-and-release.sh' => 1, | |
| 'traverser.php' => 1, | |
| 'genealogy.php' => 1, | |
| 'genealogy.i18n.php' => 1, | |
| 'genealogy.i18n.magic.php' => 1, | |
| 'jimdojimflowprintticketbundle.php' => 1, | |
| 'swift-mail.php' => 1, | |
| 'binder.js' => 1, | |
| 'shoppingcartitem.php' => 1, | |
| 'mainform.java' => 1, | |
| 'rzredirectbundle.php' => 1, | |
| 'olixserverbundle.php' => 1, | |
| 'olixsecuritybundle.php' => 1, | |
| 'olixformsextbootstrapbundle.php' => 1, | |
| 'olixdatatablesbootstrapbundle.php' => 1, | |
| 'saadtazigchartbundle.php' => 1, | |
| 'rzusersecuritybundle.php' => 1, | |
| 'rzuserevents.php' => 1, | |
| 'rzuserbundle.php' => 1, | |
| 'rztimelinebundle.php' => 1, | |
| 'rztaxonomiesbundle.php' => 1, | |
| 'rzseobundle.php' => 1, | |
| 'rzsearchbundle.php' => 1, | |
| 'rzpiwikbundle.php' => 1, | |
| 'rzpagebundle.php' => 1, | |
| 'sdresthookbundle.php' => 1, | |
| 'rzoauthbundle.php' => 1, | |
| 'rznewsbundle.php' => 1, | |
| 'rzmediabundle.php' => 1, | |
| 'rzjquerybundle.php' => 1, | |
| 'rzgoogleapiclientbundle.php' => 1, | |
| 'rzformatterbundle.php' => 1, | |
| 'rzfieldtypebundle.php' => 1, | |
| 'rzdoctrineormadminbundle.php' => 1, | |
| 'rzcorebundle.php' => 1, | |
| 'rzcommentbundle.php' => 1, | |
| 'rzcodemirrorbundle.php' => 1, | |
| 'rzclassificationbundle.php' => 1, | |
| 'rzckeditorbundle.php' => 1, | |
| 'olixtestbundle.php' => 1, | |
| 'sachoocrudgenbundle.php' => 1, | |
| 'cmssearch.less' => 1, | |
| 'salbertsrecaptcha2bundle.php' => 1, | |
| 'cmssearch.js' => 1, | |
| 'samsoncms.sql.gz' => 1, | |
| 'psql.sql' => 1, | |
| 'config.bat' => 1, | |
| 'versioner' => 1, | |
| 'webshellasset.php' => 1, | |
| 'jqueryterminalasset.php' => 1, | |
| 'phpgsb.class.php' => 1, | |
| 'lookup.php' => 1, | |
| 'listupdater.php' => 1, | |
| 'savant3.php' => 1, | |
| 'jdatetime.class.php' => 1, | |
| 'tableprinter.php' => 1, | |
| 'wp_bootstrap_navwalker.php' => 1, | |
| 'operationstate.php' => 1, | |
| '.brackets.json' => 1, | |
| 'test-sshkey' => 1, | |
| 'config.sh.sample' => 1, | |
| 'run-inspections' => 1, | |
| 'tomatomatombundle.php' => 1, | |
| 'linkedin_3.2.0.1.class.php' => 1, | |
| 'logger.class.php' => 1, | |
| 'juithemeselectwidget.php' => 1, | |
| 'juithemeselectasset.php' => 1, | |
| 'juithemeselect.js' => 1, | |
| 'actrack' => 1, | |
| 'basic-http-authentication.php' => 1, | |
| 'operationstatemanager.php' => 1, | |
| 'operationstateexception.php' => 1, | |
| 'test_bridge.php' => 1, | |
| 'architect.log' => 1, | |
| 'directed-connection-type.php' => 1, | |
| 'p3widgetsmodule.php' => 1, | |
| 'samples_docs.php' => 1, | |
| 'createtest.php' => 1, | |
| 'release-list' => 1, | |
| 'sugared-sami' => 1, | |
| 'sugared-phpunit' => 1, | |
| 'sugared-phpmd' => 1, | |
| 'sugared-phpcs' => 1, | |
| 'sugared-phpcbf' => 1, | |
| 'schnittstabil-phpunit-starter' => 1, | |
| 'giic-config.php' => 1, | |
| 'sakilamodule.php' => 1, | |
| 'ckeditorconfiguratormodule.php' => 1, | |
| 'phinflector.php' => 1, | |
| 'p3pagesmodule.php' => 1, | |
| 'phlop' => 1, | |
| 'p3mediamodule.php' => 1, | |
| 'p3adminmodule.php' => 1, | |
| 'emultithememanager.php' => 1, | |
| 'giic.xsl' => 1, | |
| 'giic.php' => 1, | |
| 'shellcolors.php' => 1, | |
| 'giiccommand.php' => 1, | |
| 'giicapplication.php' => 1, | |
| 'edatabasecommand.php' => 1, | |
| 'jmstwigjsbundle.php' => 1, | |
| 'jmssecurityextrabundle.php' => 1, | |
| 'jmspaymentpaypalbundle.php' => 1, | |
| 'jmspaymentcorebundle.php' => 1, | |
| 'samples_views.php' => 1, | |
| 'phlop.json' => 1, | |
| 'jmsdiextrabundle.php' => 1, | |
| '.htaccess-sample' => 1, | |
| 'determinate-connection-type.php' => 1, | |
| 'connection-type.php' => 1, | |
| 'connection-type-factory.php' => 1, | |
| 'scribepheanstalkbundle.php' => 1, | |
| 'pheanstalklocator.php' => 1, | |
| 'code-climate-coverage.sh' => 1, | |
| 'ant.properties' => 1, | |
| 'pom-main.xml' => 1, | |
| 'scribestripebundle.php' => 1, | |
| 'scribeclockworkbundle.php' => 1, | |
| 'zuolikebundle.php' => 1, | |
| 'generate-config.sh' => 1, | |
| 'remote-uploads.sh' => 1, | |
| 'database-update.sh' => 1, | |
| 'hookrunner.php' => 1, | |
| 'database-prepare.sh' => 1, | |
| 'database-import.sh' => 1, | |
| 'database-export.sh' => 1, | |
| 'tzid.json' => 1, | |
| 'timezone_dump.php' => 1, | |
| 'timezone-select-screenshot.png' => 1, | |
| 'scorpiosphinxsearchbundle.php' => 1, | |
| 'scoreyacinderellasdkbundle.php' => 1, | |
| 'phpunit_onlyreduceruntime.xml' => 1, | |
| 'phpunit_onlyenvironment.xml' => 1, | |
| 'scigrouptinymcepluploadfilemanagerbundle.php' => 1, | |
| 'traits.php' => 1, | |
| 'facades.php' => 1, | |
| 'precommit.yml' => 1, | |
| 'jmsgoogleclosurebundle.php' => 1, | |
| 'jmsdebuggingbundle.php' => 1, | |
| 'architect.log.1' => 1, | |
| 'mediaapibundle.php' => 1, | |
| 'rutvalidatorasset.php' => 1, | |
| 'rutvalidator.php' => 1, | |
| 'rutformatbehavior.php' => 1, | |
| 'excelview.php' => 1, | |
| 'test3.php' => 1, | |
| 'layout.macro' => 1, | |
| 'example-template3.macro' => 1, | |
| 'example-template2.macro' => 1, | |
| 'example-template.php' => 1, | |
| 'example-element1.php' => 1, | |
| 'ods.php' => 1, | |
| 'pclzip.php' => 1, | |
| 'nanophp' => 1, | |
| 'applog.log' => 1, | |
| 'rutwidgetasset.php' => 1, | |
| 'ahservicearchivingbundle.php' => 1, | |
| 'history.js' => 1, | |
| 'santhapanepalidateconverterbundle.php' => 1, | |
| 'monstabox.php' => 1, | |
| 'lotteryresultbundle.php' => 1, | |
| '.pomm_cli_bootstrap.php' => 1, | |
| 'sangkilbiz.backup' => 1, | |
| 'sangkilbiz-3 data model.architect' => 1, | |
| 'init_db_schema_only.sql' => 1, | |
| 'init_db_data_only3.sql' => 1, | |
| 'init_db_data_only2.sql' => 1, | |
| 'init_db_data_only.sql' => 1, | |
| 'db_schemas.sql' => 1, | |
| 'rutwidget.php' => 1, | |
| 'jquery.rut.js' => 1, | |
| 'jmscommandbundle.php' => 1, | |
| 'scandiopaginatorbundle.php' => 1, | |
| 'jmsaopbundle.php' => 1, | |
| 'api-key.local.php.dist' => 1, | |
| 'asins.php' => 1, | |
| 'flexiblecallback.php' => 1, | |
| 'local-config.php.dist' => 1, | |
| 'readme_fork' => 1, | |
| 'noticeexception.php' => 1, | |
| 'invalidexception.php' => 1, | |
| 'tombstone.php' => 1, | |
| 'tombstone' => 1, | |
| 'schebstockpanelbundle.php' => 1, | |
| 'copying.phalcon' => 1, | |
| 'scandiotrobabridgebundle.php' => 1, | |
| 'scabbia.bat' => 1, | |
| 'rut-widget.js' => 1, | |
| 'xmlstr_to_array.php' => 1, | |
| 'saymegulprevbundle.php' => 1, | |
| 'saxulum-collection.js' => 1, | |
| 'vsavritskymorpherbundle.php' => 1, | |
| 'saulswidgetbundle.php' => 1, | |
| 'mooflashcardbundle.php' => 1, | |
| 'mooflashcardadminbundle.php' => 1, | |
| 'log4php.xml' => 1, | |
| 'rss_utils.inc' => 1, | |
| 'rss_parse.inc' => 1, | |
| 'rss_fetch.inc' => 1, | |
| 'rss_cache.inc' => 1, | |
| 'troubleshooting' => 1, | |
| 'satelliteudeploybundle.php' => 1, | |
| 'association-for-computational-linguistics.csl' => 1, | |
| 'atencion-primaria.csl' => 1, | |
| 'journal-of-cardiothoracic-and-vascular-anesthesia.csl' => 1, | |
| 'harvard-leeds-metropolitan-university.csl' => 1, | |
| 'harvard-the-university-of-melbourne.csl' => 1, | |
| 'harvard-swinburne-university-of-technology.csl' => 1, | |
| 'harvard-stellenbosch-university.csl' => 1, | |
| 'harvard-staffordshire-university.csl' => 1, | |
| 'harvard-southampton-solent-university.csl' => 1, | |
| 'harvard-pontificia-universidad-catolica-del-ecuador.csl' => 1, | |
| 'harvard-oxford-brookes-university-faculty-of-health-and-life-sciences.csl' => 1, | |
| 'harvard-north-west-university.csl' => 1, | |
| 'harvard-newcastle-university.csl' => 1, | |
| 'harvard-manchester-metropolitan-university.csl' => 1, | |
| 'harvard-manchester-business-school.csl' => 1, | |
| 'harvard-london-south-bank-university.csl' => 1, | |
| 'harvard-limerick.csl' => 1, | |
| 'harvard-leeds-beckett-university.csl' => 1, | |
| 'harvard-the-university-of-sheffield-school-of-east-asian-studies.csl' => 1, | |
| 'harvard-kings-college-london.csl' => 1, | |
| 'harvard-institut-fur-praxisforschung-de.csl' => 1, | |
| 'harvard-imperial-college-london.csl' => 1, | |
| 'harvard-gesellschaft-fur-bildung-und-forschung-in-europa.csl' => 1, | |
| 'harvard-fachhochschule-salzburg.csl' => 1, | |
| 'harvard-european-archaeology.csl' => 1, | |
| 'harvard-edge-hill-university.csl' => 1, | |
| 'harvard-durham-university-business-school.csl' => 1, | |
| 'harvard-dundalk-institute-of-technology.csl' => 1, | |
| 'harvard-cranfield-university.csl' => 1, | |
| 'harvard-coventry-university.csl' => 1, | |
| 'harvard-cite-them-right.csl' => 1, | |
| 'harvard-cardiff-university.csl' => 1, | |
| 'harvard-the-university-of-northampton.csl' => 1, | |
| 'harvard-the-university-of-sheffield-town-and-regional-planning.csl' => 1, | |
| 'harvard-cape-peninsula-university-of-technology.csl' => 1, | |
| 'harvard-university-of-worcester.csl' => 1, | |
| 'hematology-oncology-clinics-of-north-america.csl' => 1, | |
| 'heart-rhythm.csl' => 1, | |
| 'heart-failure-clinics.csl' => 1, | |
| 'health-services-research.csl' => 1, | |
| 'health-reform-observer-observatoire-des-reformes-de-sante.csl' => 1, | |
| 'health-policy-and-planning.csl' => 1, | |
| 'health-economics.csl' => 1, | |
| 'health-economics-policy-and-law.csl' => 1, | |
| 'health-and-social-care-in-the-community.csl' => 1, | |
| 'hawaii-international-conference-on-system-sciences-proceedings.csl' => 1, | |
| 'harvard7de.csl' => 1, | |
| 'harvard1.csl' => 1, | |
| 'harvard-york-st-john-university.csl' => 1, | |
| 'harvard-university-of-wolverhampton.csl' => 1, | |
| 'harvard-universiti-tunku-abdul-rahman.csl' => 1, | |
| 'harvard-university-of-westminster.csl' => 1, | |
| 'harvard-university-of-west-london.csl' => 1, | |
| 'harvard-university-of-the-west-of-scotland.csl' => 1, | |
| 'harvard-university-of-the-west-of-england.csl' => 1, | |
| 'harvard-university-of-sunderland.csl' => 1, | |
| 'harvard-university-of-leeds.csl' => 1, | |
| 'harvard-university-of-kent.csl' => 1, | |
| 'harvard-university-of-greenwich.csl' => 1, | |
| 'harvard-university-of-gloucestershire.csl' => 1, | |
| 'harvard-university-of-cape-town.csl' => 1, | |
| 'harvard-university-of-brighton-school-of-environment-and-technology.csl' => 1, | |
| 'harvard-university-of-birmingham.csl' => 1, | |
| 'harvard-university-of-abertay-dundee.csl' => 1, | |
| 'harvard-university-for-the-creative-arts.csl' => 1, | |
| 'harvard-cardiff-university-biosi.csl' => 1, | |
| 'harvard-bournemouth-university.csl' => 1, | |
| 'heredity.csl' => 1, | |
| 'food-and-agriculture-organization-of-the-united-nations.csl' => 1, | |
| 'frontiers-in-optics.csl' => 1, | |
| 'frontiers-in-ecology-and-the-environment.csl' => 1, | |
| 'freshwater-science.csl' => 1, | |
| 'freshwater-biology.csl' => 1, | |
| 'french4.csl' => 1, | |
| 'french3.csl' => 1, | |
| 'french2.csl' => 1, | |
| 'french1.csl' => 1, | |
| 'french-politics.csl' => 1, | |
| 'freie-universitat-berlin-geographische-wissenschaften.csl' => 1, | |
| 'free-radical-research.csl' => 1, | |
| 'forest-science.csl' => 1, | |
| 'forensic-science-review.csl' => 1, | |
| 'fold-and-r.csl' => 1, | |
| 'frontiers-medical-journals.csl' => 1, | |
| 'foerster-geisteswissenschaft.csl' => 1, | |
| 'florida-entomologist.csl' => 1, | |
| 'flavour-and-fragrance-journal.csl' => 1, | |
| 'fish-and-fisheries.csl' => 1, | |
| 'first-monday.csl' => 1, | |
| 'finanzarchiv.csl' => 1, | |
| 'fertility-and-sterility.csl' => 1, | |
| 'ferdinand-porsche-fern-fachhochschule.csl' => 1, | |
| 'facial-plastic-surgery-clinics-of-north-america.csl' => 1, | |
| 'fachhochschule-vorarlberg.csl' => 1, | |
| 'fachhochschule-kiel-fachbereich-medien.csl' => 1, | |
| 'eye.csl' => 1, | |
| 'experimental-dermatology.csl' => 1, | |
| 'frontiers-in-physics.csl' => 1, | |
| 'frontiers.csl' => 1, | |
| 'harvard-anglia-ruskin-university.csl' => 1, | |
| 'geological-magazine.csl' => 1, | |
| 'hand.csl' => 1, | |
| 'hamburg-school-of-food-science.csl' => 1, | |
| 'grasas-y-aceites.csl' => 1, | |
| 'gost-r-7-0-5-2008.csl' => 1, | |
| 'gost-r-7-0-5-2008-numeric.csl' => 1, | |
| 'gost-r-7-0-5-2008-numeric-alphabetical.csl' => 1, | |
| 'global-ecology-and-biogeography.csl' => 1, | |
| 'global-change-biology.csl' => 1, | |
| 'gewerblicher-rechtsschutz-und-urheberrecht.csl' => 1, | |
| 'gesellschaft-fur-popularmusikforschung.csl' => 1, | |
| 'georg-august-universitat-gottingen-institut-fur-ethnologie-und-ethnologische-sammlung.csl' => 1, | |
| 'geopolitics.csl' => 1, | |
| 'geology.csl' => 1, | |
| 'geografie-sbornik-cgs.csl' => 1, | |
| 'future-science-group.csl' => 1, | |
| 'geochimica-et-cosmochimica-acta.csl' => 1, | |
| 'geobiology.csl' => 1, | |
| 'geoarchaeology.csl' => 1, | |
| 'genome-biology-and-evolution.csl' => 1, | |
| 'genetics.csl' => 1, | |
| 'genetics-and-molecular-biology.csl' => 1, | |
| 'geneses.csl' => 1, | |
| 'genes-to-cells.csl' => 1, | |
| 'geistes-und-kulturwissenschaften-heilmann.csl' => 1, | |
| 'gastrointestinal-intervention.csl' => 1, | |
| 'gastrointestinal-endoscopy-clinics-of-north-america.csl' => 1, | |
| 'gastroenterology.csl' => 1, | |
| 'gallia.csl' => 1, | |
| 'g3.csl' => 1, | |
| 'hepatology.csl' => 1, | |
| 'hiob-ludolf-centre-for-ethiopian-studies-with-url-doi.csl' => 1, | |
| 'evolutionary-ecology-research.csl' => 1, | |
| 'investigative-radiology.csl' => 1, | |
| 'iso690-numeric-cs.csl' => 1, | |
| 'iso690-numeric-brackets-cs.csl' => 1, | |
| 'iso690-note-fr.csl' => 1, | |
| 'iso690-note-cs.csl' => 1, | |
| 'iso690-full-note-sk.csl' => 1, | |
| 'iso690-author-date-sk.csl' => 1, | |
| 'iso690-author-date-fr.csl' => 1, | |
| 'iso690-author-date-fr-no-abstract.csl' => 1, | |
| 'iso690-author-date-es.csl' => 1, | |
| 'iso690-author-date-en.csl' => 1, | |
| 'iso690-author-date-cs.csl' => 1, | |
| 'irish-historical-studies.csl' => 1, | |
| 'invisu.csl' => 1, | |
| 'invertebrate-biology.csl' => 1, | |
| 'iso690-numeric-fr.csl' => 1, | |
| 'international-union-of-crystallography.csl' => 1, | |
| 'international-studies-association.csl' => 1, | |
| 'international-pig-veterinary-society-congress-proceedings.csl' => 1, | |
| 'international-organization.csl' => 1, | |
| 'international-microbiology.csl' => 1, | |
| 'international-labour-organization.csl' => 1, | |
| 'international-journal-of-wildland-fire.csl' => 1, | |
| 'international-journal-of-sports-medicine.csl' => 1, | |
| 'international-journal-of-radiation-oncology-biology-physics.csl' => 1, | |
| 'international-journal-of-quantum-chemistry.csl' => 1, | |
| 'international-journal-of-plant-sciences.csl' => 1, | |
| 'international-journal-of-osteopathic-medicine.csl' => 1, | |
| 'international-journal-of-osteoarchaeology.csl' => 1, | |
| 'iso690-numeric-en.csl' => 1, | |
| 'iso690-numeric-lt.csl' => 1, | |
| 'international-journal-of-occupational-medicine-and-environmental-health.csl' => 1, | |
| 'journal-of-applied-ecology.csl' => 1, | |
| 'journal-of-business-logistics.csl' => 1, | |
| 'journal-of-burn-care-and-research.csl' => 1, | |
| 'journal-of-brachial-plexus-and-peripheral-nerve-injury.csl' => 1, | |
| 'journal-of-bone-and-mineral-research.csl' => 1, | |
| 'journal-of-biomedical-materials-research-part-a.csl' => 1, | |
| 'journal-of-biological-chemistry.csl' => 1, | |
| 'journal-of-biogeography.csl' => 1, | |
| 'journal-of-basic-microbiology.csl' => 1, | |
| 'journal-of-avian-biology.csl' => 1, | |
| 'journal-of-atrial-fibrillation.csl' => 1, | |
| 'journal-of-archaeological-research.csl' => 1, | |
| 'journal-of-applied-philosophy.csl' => 1, | |
| 'journal-of-applied-entomology.csl' => 1, | |
| 'journal-of-applied-animal-science.csl' => 1, | |
| 'iso690-numeric-sk.csl' => 1, | |
| 'journal-of-antimicrobial-chemotherapy.csl' => 1, | |
| 'journal-of-animal-science.csl' => 1, | |
| 'journal-of-animal-physiology-and-animal-nutrition.csl' => 1, | |
| 'journal-of-analytical-toxicology.csl' => 1, | |
| 'journal-of-alzheimers-disease.csl' => 1, | |
| 'journal-of-aerosol-medicine-and-pulmonary-drug-delivery.csl' => 1, | |
| 'journal-of-adolescent-health.csl' => 1, | |
| 'journal-for-the-history-of-astronomy.csl' => 1, | |
| 'javnost-the-public.csl' => 1, | |
| 'jahrbuch-fur-evangelikale-theologie.csl' => 1, | |
| 'jahrbuch-der-osterreichischen-byzantinischen-gesellschaft.csl' => 1, | |
| 'jacc-cardiovascular-imaging.csl' => 1, | |
| 'ithaque.csl' => 1, | |
| 'israel-medical-association-journal.csl' => 1, | |
| 'international-journal-of-oral-and-maxillofacial-surgery.csl' => 1, | |
| 'international-journal-of-obstetric-anesthesia.csl' => 1, | |
| 'hiob-ludolf-centre-for-ethiopian-studies.csl' => 1, | |
| 'hydrobiologia.csl' => 1, | |
| 'indian-journal-of-medical-research.csl' => 1, | |
| 'immunological-reviews.csl' => 1, | |
| 'im-gesprach.csl' => 1, | |
| 'iica-catie.csl' => 1, | |
| 'igaku-toshokan.csl' => 1, | |
| 'ieee.csl' => 1, | |
| 'ieee-with-url.csl' => 1, | |
| 'ie-comunicaciones.csl' => 1, | |
| 'ices-journal-of-marine-science.csl' => 1, | |
| 'hypotheses-in-the-life-sciences.csl' => 1, | |
| 'hypertension-research.csl' => 1, | |
| 'hydrological-sciences-journal.csl' => 1, | |
| 'hydrological-processes.csl' => 1, | |
| 'humboldt-state-university-environmental-resources-engineering.csl' => 1, | |
| 'infectio.csl' => 1, | |
| 'human-wildlife-interactions.csl' => 1, | |
| 'human-resource-management-journal.csl' => 1, | |
| 'human-reproduction.csl' => 1, | |
| 'human-reproduction-update.csl' => 1, | |
| 'human-mutation.csl' => 1, | |
| 'human-brain-mapping.csl' => 1, | |
| 'hong-kong-journal-of-radiology.csl' => 1, | |
| 'hochschule-fur-wirtschaft-und-recht-berlin.csl' => 1, | |
| 'history-of-the-human-sciences.csl' => 1, | |
| 'history-and-theory.csl' => 1, | |
| 'histoire-et-mesure.csl' => 1, | |
| 'histoire-at-politique.csl' => 1, | |
| 'hipertension-y-riesgo-vascular.csl' => 1, | |
| 'indoor-air.csl' => 1, | |
| 'infectious-disease-clinics-of-north-america.csl' => 1, | |
| 'international-journal-of-nuclear-security.csl' => 1, | |
| 'interdisziplinare-zeitschrift-fur-technologie-und-lernen.csl' => 1, | |
| 'international-journal-of-lexicography.csl' => 1, | |
| 'international-journal-of-infectious-diseases.csl' => 1, | |
| 'international-journal-of-humanoid-robotics.csl' => 1, | |
| 'international-journal-of-geriatric-psychiatry.csl' => 1, | |
| 'international-journal-of-food-science-and-technology.csl' => 1, | |
| 'international-journal-of-exercise-science.csl' => 1, | |
| 'international-journal-of-epidemiology.csl' => 1, | |
| 'international-journal-of-electronic-commerce.csl' => 1, | |
| 'international-journal-of-climatology.csl' => 1, | |
| 'international-journal-of-cancer.csl' => 1, | |
| 'international-journal-of-audiology.csl' => 1, | |
| 'international-conference-on-information-systems-development.csl' => 1, | |
| 'international-atomic-energy-agency.csl' => 1, | |
| 'interaction-design-and-architectures.csl' => 1, | |
| 'inflammatory-bowel-diseases.csl' => 1, | |
| 'inter-ro.csl' => 1, | |
| 'inter-research-science-center.csl' => 1, | |
| 'instituto-superior-de-teologia-de-las-islas-canarias.csl' => 1, | |
| 'instituto-de-pesquisas-tecnologicas.csl' => 1, | |
| 'institute-of-physics-numeric.csl' => 1, | |
| 'institute-of-physics-harvard.csl' => 1, | |
| 'institut-national-de-sante-publique-du-quebec-topo.csl' => 1, | |
| 'institut-national-de-sante-publique-du-quebec-napp.csl' => 1, | |
| 'institut-national-de-la-recherche-scientifique-sciences-sociales.csl' => 1, | |
| 'ingenieria-agricola.csl' => 1, | |
| 'information-systems-research.csl' => 1, | |
| 'infoclio-fr-smallcaps.csl' => 1, | |
| 'infoclio-fr-nocaps.csl' => 1, | |
| 'infoclio-de.csl' => 1, | |
| 'exercer.csl' => 1, | |
| 'evolutionary-anthropology.csl' => 1, | |
| 'ausonius-editions.csl' => 1, | |
| 'cellular-reprogramming.csl' => 1, | |
| 'chicago-author-date.csl' => 1, | |
| 'chicago-author-date-fr.csl' => 1, | |
| 'chicago-author-date-de.csl' => 1, | |
| 'chicago-author-date-basque.csl' => 1, | |
| 'chicago-annotated-bibliography.csl' => 1, | |
| 'chest.csl' => 1, | |
| 'chemical-senses.csl' => 1, | |
| 'chemical-and-pharmaceutical-bulletin.csl' => 1, | |
| 'changer-d-epoque.csl' => 1, | |
| 'ceska-zemedelska-univerzita-v-praze-fakulta-agrobiologie-potravinovych-a-prirodnich-zdroju.csl' => 1, | |
| 'cerebral-cortex.csl' => 1, | |
| 'centre-de-recherche-sur-les-civilisations-de-l-asie-orientale.csl' => 1, | |
| 'centaurus.csl' => 1, | |
| 'cellular-and-molecular-bioengineering.csl' => 1, | |
| 'chicago-fullnote-bibliography-fr.csl' => 1, | |
| 'cell.csl' => 1, | |
| 'cell-transplantation.csl' => 1, | |
| 'cell-research.csl' => 1, | |
| 'cell-numeric.csl' => 1, | |
| 'catholic-biblical-association.csl' => 1, | |
| 'cardiocore.csl' => 1, | |
| 'carcinogenesis.csl' => 1, | |
| 'carbohydrate-research.csl' => 1, | |
| 'canadian-public-policy.csl' => 1, | |
| 'canadian-journal-of-fisheries-and-aquatic-sciences.csl' => 1, | |
| 'canadian-journal-of-economics.csl' => 1, | |
| 'canadian-journal-of-dietetic-practice-and-research.csl' => 1, | |
| 'campus-adventiste-du-saleve-faculte-adventiste-de-theologie.csl' => 1, | |
| 'chicago-figures.csl' => 1, | |
| 'chicago-fullnote-bibliography-no-ibid.csl' => 1, | |
| 'byzantina-symmeikta.csl' => 1, | |
| 'clays-and-clay-minerals.csl' => 1, | |
| 'collection-du-centre-jean-berard.csl' => 1, | |
| 'collection-de-l-ecole-francaise-de-rome-note.csl' => 1, | |
| 'collection-de-l-ecole-francaise-de-rome-full-note.csl' => 1, | |
| 'cold-spring-harbor-laboratory-press.csl' => 1, | |
| 'cns-and-neurological-disorders-drug-targets.csl' => 1, | |
| 'clio-medica.csl' => 1, | |
| 'clinical-pharmacology-and-therapeutics.csl' => 1, | |
| 'clinical-otolaryngology.csl' => 1, | |
| 'clinical-orthopaedics-and-related-research.csl' => 1, | |
| 'clinical-nuclear-medicine.csl' => 1, | |
| 'clinical-infectious-diseases.csl' => 1, | |
| 'clinical-gastroenterology-and-hepatology.csl' => 1, | |
| 'clinica-e-investigacion-en-arteriosclerosis.csl' => 1, | |
| 'clay-minerals.csl' => 1, | |
| 'chicago-fullnote-bibliography.csl' => 1, | |
| 'clara-architecture-recherche.csl' => 1, | |
| 'cladistics.csl' => 1, | |
| 'cirugia-espanola.csl' => 1, | |
| 'cirugia-cardiovascular.csl' => 1, | |
| 'circulation.csl' => 1, | |
| 'chroniques-des-activites-archeologiques-de-l-ecole-francaise-de-rome.csl' => 1, | |
| 'chinese-journal-of-aeronautics.csl' => 1, | |
| 'chinese-gb7714-2005-numeric.csl' => 1, | |
| 'chinese-gb7714-2005-author-date.csl' => 1, | |
| 'chinese-gb7714-1987-numeric.csl' => 1, | |
| 'chimia.csl' => 1, | |
| 'chicago-note-bibliography.csl' => 1, | |
| 'chicago-note-biblio-no-ibid.csl' => 1, | |
| 'chicago-library-list.csl' => 1, | |
| 'cahiers-du-centre-gustave-glotz.csl' => 1, | |
| 'bulletin-of-marine-science.csl' => 1, | |
| 'collections-electroniques-de-l-inha-full-note.csl' => 1, | |
| 'beltz-padagogik.csl' => 1, | |
| 'biological-psychiatry.csl' => 1, | |
| 'biological-journal-of-the-linnean-society.csl' => 1, | |
| 'biological-and-pharmaceutical-bulletin.csl' => 1, | |
| 'biologia.csl' => 1, | |
| 'bioinformatics.csl' => 1, | |
| 'bioessays.csl' => 1, | |
| 'bioelectromagnetics.csl' => 1, | |
| 'biochimica-et-biophysica-acta.csl' => 1, | |
| 'biochemistry.csl' => 1, | |
| 'biochemical-society-transactions.csl' => 1, | |
| 'biochemical-journal.csl' => 1, | |
| 'bioarchaeology-of-the-near-east.csl' => 1, | |
| 'bibtex.csl' => 1, | |
| 'babes-bolyai-university-faculty-of-orthodox-theology.csl' => 1, | |
| 'biology-of-reproduction.csl' => 1, | |
| 'aviation-space-and-environmental-medicine.csl' => 1, | |
| 'avian-pathology.csl' => 1, | |
| 'avian-diseases.csl' => 1, | |
| 'avian-conservation-and-ecology.csl' => 1, | |
| 'austrian-legal.csl' => 1, | |
| 'australian-veterinary-journal.csl' => 1, | |
| 'australian-journal-of-grape-and-wine-research.csl' => 1, | |
| 'australian-journal-of-earth-sciences.csl' => 1, | |
| 'australian-historical-studies.csl' => 1, | |
| 'australian-guide-to-legal-citation.csl' => 1, | |
| 'australian-critical-care.csl' => 1, | |
| 'australasian-emergency-nursing-journal.csl' => 1, | |
| 'austral-ecology.csl' => 1, | |
| 'biological-reviews.csl' => 1, | |
| 'biomed-central.csl' => 1, | |
| 'bulletin-of-faculty-of-pharmacy-cairo-university.csl' => 1, | |
| 'brain.csl' => 1, | |
| 'bulletin-de-la-societe-prehistorique-francaise.csl' => 1, | |
| 'building-structure.csl' => 1, | |
| 'british-journal-of-surgery.csl' => 1, | |
| 'british-journal-of-political-science.csl' => 1, | |
| 'british-journal-of-pharmacology.csl' => 1, | |
| 'british-journal-of-industrial-relations.csl' => 1, | |
| 'british-journal-of-haematology.csl' => 1, | |
| 'british-journal-of-dermatology.csl' => 1, | |
| 'british-journal-of-cancer.csl' => 1, | |
| 'british-journal-of-anaesthesia.csl' => 1, | |
| 'british-ecological-society.csl' => 1, | |
| 'briefings-in-bioinformatics.csl' => 1, | |
| 'brazilian-journal-of-infectious-diseases.csl' => 1, | |
| 'boreal-environment-research.csl' => 1, | |
| 'biomed-research-international.csl' => 1, | |
| 'body-and-society.csl' => 1, | |
| 'bmj.csl' => 1, | |
| 'bluebook2.csl' => 1, | |
| 'bluebook-law-review.csl' => 1, | |
| 'bluebook-inline.csl' => 1, | |
| 'blood.csl' => 1, | |
| 'biotropica.csl' => 1, | |
| 'biotechnology-and-bioengineering.csl' => 1, | |
| 'biotechniques.csl' => 1, | |
| 'bioresources.csl' => 1, | |
| 'biopolymers.csl' => 1, | |
| 'biophysical-journal.csl' => 1, | |
| 'bioorganic-and-medicinal-chemistry-letters.csl' => 1, | |
| 'biometrics.csl' => 1, | |
| 'collections-electroniques-de-l-inha-author-date.csl' => 1, | |
| 'colombian-journal-of-anesthesiology.csl' => 1, | |
| 'evolution.csl' => 1, | |
| 'enfermeria-clinica.csl' => 1, | |
| 'environmental-toxicology-and-chemistry.csl' => 1, | |
| 'environmental-microbiology.csl' => 1, | |
| 'environmental-health-perspectives.csl' => 1, | |
| 'environmental-conservation.csl' => 1, | |
| 'environmental-chemistry.csl' => 1, | |
| 'environmental-and-engineering-geoscience.csl' => 1, | |
| 'environment-and-urbanization.csl' => 1, | |
| 'environment-and-planning.csl' => 1, | |
| 'entomological-society-of-america.csl' => 1, | |
| 'entomologia-experimentalis-et-applicata.csl' => 1, | |
| 'ens-de-lyon-centre-d-ingenierie-documentaire.csl' => 1, | |
| 'engineering-in-life-sciences.csl' => 1, | |
| 'enfermeria-intensiva.csl' => 1, | |
| 'endoscopia.csl' => 1, | |
| 'epidemiologie-et-sante-animale.csl' => 1, | |
| 'endocrinologia-y-nutricion.csl' => 1, | |
| 'endocrine-press.csl' => 1, | |
| 'emu-austral-ornithology.csl' => 1, | |
| 'emerald-harvard.csl' => 1, | |
| 'embo-reports.csl' => 1, | |
| 'elsevier-without-titles.csl' => 1, | |
| 'elsevier-with-titles.csl' => 1, | |
| 'elsevier-with-titles-alphabetical.csl' => 1, | |
| 'elsevier-vancouver.csl' => 1, | |
| 'elsevier-harvard2.csl' => 1, | |
| 'elsevier-harvard.csl' => 1, | |
| 'elsevier-harvard-without-titles.csl' => 1, | |
| 'el-profesional-de-la-informacion.csl' => 1, | |
| 'environnement-risques-et-sante.csl' => 1, | |
| 'equine-veterinary-education.csl' => 1, | |
| 'ecosistemas.csl' => 1, | |
| 'european-journal-of-international-law.csl' => 1, | |
| 'evolution-and-development.csl' => 1, | |
| 'european-union-interinstitutional-style-guide.csl' => 1, | |
| 'european-society-of-cardiology.csl' => 1, | |
| 'european-retail-research.csl' => 1, | |
| 'european-respiratory-journal.csl' => 1, | |
| 'european-journal-of-vascular-and-endovascular-surgery.csl' => 1, | |
| 'european-journal-of-surgical-oncology.csl' => 1, | |
| 'european-journal-of-soil-science.csl' => 1, | |
| 'european-journal-of-political-research.csl' => 1, | |
| 'european-journal-of-pain.csl' => 1, | |
| 'european-journal-of-paediatric-neurology.csl' => 1, | |
| 'european-journal-of-ophthalmology.csl' => 1, | |
| 'european-journal-of-neuroscience.csl' => 1, | |
| 'european-journal-of-information-systems.csl' => 1, | |
| 'equine-veterinary-journal.csl' => 1, | |
| 'european-journal-of-immunology.csl' => 1, | |
| 'european-journal-of-human-genetics.csl' => 1, | |
| 'european-journal-of-emergency-medicine.csl' => 1, | |
| 'european-journal-of-clinical-microbiology-and-infectious-diseases.csl' => 1, | |
| 'european-cells-and-materials.csl' => 1, | |
| 'europace.csl' => 1, | |
| 'ets-ecole-de-technologie-superieure.csl' => 1, | |
| 'ethnologie-francaise.csl' => 1, | |
| 'ethnobiology-and-conservation.csl' => 1, | |
| 'ethics-book-reviews.csl' => 1, | |
| 'escuela-nacional-de-antropologia-e-historia-short-note.csl' => 1, | |
| 'escuela-nacional-de-antropologia-e-historia-full-note.csl' => 1, | |
| 'escuela-nacional-de-antropologia-e-historia-author-date.csl' => 1, | |
| 'ergoscience.csl' => 1, | |
| 'ecosystems.csl' => 1, | |
| 'ecoscience.csl' => 1, | |
| 'comision-economica-para-america-latina-y-el-caribe.csl' => 1, | |
| 'cultivos-tropicales.csl' => 1, | |
| 'der-moderne-staat.csl' => 1, | |
| 'demographic-research.csl' => 1, | |
| 'decision-sciences.csl' => 1, | |
| 'de-buck.csl' => 1, | |
| 'database.csl' => 1, | |
| 'cytometry.csl' => 1, | |
| 'currents-in-biblical-research.csl' => 1, | |
| 'current-topics-in-medicinal-chemistry.csl' => 1, | |
| 'current-protocols.csl' => 1, | |
| 'current-proteomics.csl' => 1, | |
| 'current-opinion.csl' => 1, | |
| 'culture-medicine-and-psychiatry.csl' => 1, | |
| 'cultural-studies-of-science-education.csl' => 1, | |
| 'cuadernos-de-filologia-clasica.csl' => 1, | |
| 'deutsche-medizinische-wochenschrift.csl' => 1, | |
| 'critical-care-medicine.csl' => 1, | |
| 'creativity-and-innovation-management.csl' => 1, | |
| 'cranfield-university-numeric.csl' => 1, | |
| 'council-of-science-editors.csl' => 1, | |
| 'council-of-science-editors-author-date.csl' => 1, | |
| 'council-of-science-editors-alphabetical.csl' => 1, | |
| 'corrosion.csl' => 1, | |
| 'coral-reefs.csl' => 1, | |
| 'copernicus-publications.csl' => 1, | |
| 'conservation-physiology.csl' => 1, | |
| 'conservation-letters.csl' => 1, | |
| 'conservation-biology.csl' => 1, | |
| 'computer-und-recht.csl' => 1, | |
| 'communication-et-langages.csl' => 1, | |
| 'deutsche-gesellschaft-fur-psychologie.csl' => 1, | |
| 'deutsche-sprache.csl' => 1, | |
| 'economie-et-statistique.csl' => 1, | |
| 'drug-testing-and-analysis.csl' => 1, | |
| 'economic-commission-for-latin-america-and-the-caribbean.csl' => 1, | |
| 'ecology.csl' => 1, | |
| 'ecology-letters.csl' => 1, | |
| 'ecology-and-society.csl' => 1, | |
| 'ecological-entomology.csl' => 1, | |
| 'ecole-pratique-des-hautes-etudes-sciences-historiques-et-philologiques.csl' => 1, | |
| 'ecclesial-practices.csl' => 1, | |
| 'earthquake-engineering-and-structural-dynamics.csl' => 1, | |
| 'earth-surface-processes-and-landforms.csl' => 1, | |
| 'early-medieval-europe.csl' => 1, | |
| 'early-christianity.csl' => 1, | |
| 'ear-and-hearing.csl' => 1, | |
| 'drugs-of-today.csl' => 1, | |
| 'drug-development-research.csl' => 1, | |
| 'deutsches-archaologisches-institut.csl' => 1, | |
| 'documents-d-archeologie-francaise.csl' => 1, | |
| 'dna-research.csl' => 1, | |
| 'disability-and-rehabilitation.csl' => 1, | |
| 'diplo.csl' => 1, | |
| 'din-1505-2.csl' => 1, | |
| 'din-1505-2-numeric.csl' => 1, | |
| 'din-1505-2-numeric-alphabetical.csl' => 1, | |
| 'din-1505-2-alphanumeric.csl' => 1, | |
| 'die-bachelorarbeit-samac-et-al-note.csl' => 1, | |
| 'die-bachelorarbeit-samac-et-al-in-text.csl' => 1, | |
| 'diatom-research.csl' => 1, | |
| 'dialisis-y-trasplante.csl' => 1, | |
| 'diagnostico-prenatal.csl' => 1, | |
| 'development-policy-review.csl' => 1, | |
| 'baffordweblibbundle.php' => 1, | |
| 'boundinteger.php' => 1, | |
| 'baffordcsscolorvalidatorbundle.php' => 1, | |
| 'smartcorebundle.php' => 1, | |
| 'widgetmodule.php' => 1, | |
| 'webformmodule.php' => 1, | |
| 'unicatmodule.php' => 1, | |
| 'textermodule.php' => 1, | |
| 'simplenewsmodule.php' => 1, | |
| 'gallerymodule.php' => 1, | |
| 'breadcrumbsmodule.php' => 1, | |
| 'smartmediabundleusecases.php' => 1, | |
| 'smartmediabundle.php' => 1, | |
| 'htmlbundle.php' => 1, | |
| 'felibbundle.php' => 1, | |
| 'smartdbdumperbundle.php' => 1, | |
| 'cmsgeneratorbundle.php' => 1, | |
| 'smartseobundle.php' => 1, | |
| 'cmsappkernel.php' => 1, | |
| 'cacheclearerservice.php' => 1, | |
| 'acceleratorcacheclearer.php' => 1, | |
| 'acceleratorcachebundle.php' => 1, | |
| 'uncia.php' => 1, | |
| 'bare.php' => 1, | |
| 'safehtml.php' => 1, | |
| 'slikio.php' => 1, | |
| 'sleepnessubertranslationbundle.php' => 1, | |
| 'sleepnessubertranslationadminbundle.php' => 1, | |
| 'sleepnessuberfrontendvalidationbundle.php' => 1, | |
| 'hoauthadminaction.php' => 1, | |
| 'smartricheditorbundle.php' => 1, | |
| 'smartcoresessionbundle.php' => 1, | |
| 'dummyuseridentity.php' => 1, | |
| 'domainmessage.php' => 1, | |
| 'soclozeventqueuebundle.php' => 1, | |
| 'socloznsqbundle.php' => 1, | |
| 'goutte.phar' => 1, | |
| 'frontend.php' => 1, | |
| 'snceutilitybundle.php' => 1, | |
| 'snceezpublishlegacyutilitybundle.php' => 1, | |
| 'errorcontroller.php' => 1, | |
| 'objectselfserializer.php' => 1, | |
| 'eventsourcedrepository.php' => 1, | |
| 'aggregateroot.php' => 1, | |
| 'projectenableddispatcher.php' => 1, | |
| 'simpleeventbus.php' => 1, | |
| 'domaineventstream.php' => 1, | |
| 'smartsettingsbundle.php' => 1, | |
| 'simplecommandtranslator.php' => 1, | |
| 'simplecommandhandlerresolver.php' => 1, | |
| 'commandhandlermiddleware.php' => 1, | |
| 'basecommand.php' => 1, | |
| 'smilesimplepageviewbundle.php' => 1, | |
| 'testsettings-dist.php' => 1, | |
| 'example-full.php' => 1, | |
| 'smartrockuserbundle.php' => 1, | |
| 'smartgeckothriftbundle.php' => 1, | |
| 'governorframeworkbundle.php' => 1, | |
| 'externalresource.php' => 1, | |
| 'smartsitemapbundle.php' => 1, | |
| 'smartsimpleprofilerbundle.php' => 1, | |
| 'hoauthaction.php' => 1, | |
| 'slaxer' => 1, | |
| 'soclozmonitoringbundle.php' => 1, | |
| 'linkshere_body.php' => 1, | |
| 'alink.i18n.php' => 1, | |
| 'alink.i18n.magic.php' => 1, | |
| 'aform_body.php' => 1, | |
| 'aform.php' => 1, | |
| 'aform.i18n.php' => 1, | |
| 'aform.i18n.magic.php' => 1, | |
| 'userpageinfo_body.php' => 1, | |
| 'userpageinfo.php' => 1, | |
| 'userpageinfo.i18n.php' => 1, | |
| 'userpageinfo.i18n.magic.php' => 1, | |
| 'mailman.php' => 1, | |
| 'mailman.i18n.php' => 1, | |
| 'linkshere.php' => 1, | |
| 'alink_body.php' => 1, | |
| 'gravatar_body.php' => 1, | |
| 'gravatar.i18n.php' => 1, | |
| 'gravatar.i18n.magic.php' => 1, | |
| 'getuserinfo_body.php' => 1, | |
| 'getuserinfo.php' => 1, | |
| 'getuserinfo.i18n.php' => 1, | |
| 'getuserinfo.i18n.magic.php' => 1, | |
| 'getpageinfo.php' => 1, | |
| 'getpageinfo.body.php' => 1, | |
| 'extracttext_body.php' => 1, | |
| 'extracttext.php' => 1, | |
| 'extracttext.i18n.php' => 1, | |
| 'extracttext.i18n.magic.php' => 1, | |
| 'alink.php' => 1, | |
| 'linkrel.i18n.magic.php' => 1, | |
| 'street.php' => 1, | |
| 'sithousnetsuitebundle.php' => 1, | |
| 'building.php' => 1, | |
| 'apartment.php' => 1, | |
| 'sizanniatranslationbundle.php' => 1, | |
| 'sizanniajquerytoolsbundle.php' => 1, | |
| 'sizanniaeditorbundle.php' => 1, | |
| 'sizanniadataanalyticsbundle.php' => 1, | |
| 'imodule.php' => 1, | |
| 'deuton.sample.ini' => 1, | |
| 'param.php' => 1, | |
| 'opt.php' => 1, | |
| 'deuton.php' => 1, | |
| 'abort.php' => 1, | |
| 'sithousantispambundle.php' => 1, | |
| 'linkrel.i18n.php' => 1, | |
| 'exemples.php' => 1, | |
| 'sglim' => 1, | |
| 'config.sh' => 1, | |
| 'flyr.zip' => 1, | |
| 'suffixbehavior.php' => 1, | |
| 'mailqueue.neon.example' => 1, | |
| 'typo3cms' => 1, | |
| 'simonsimcityliipimaginewatermarkfilterbundle.php' => 1, | |
| 'simonsimcitygetid3bundle.php' => 1, | |
| 'simonsimcitycouchbasebundle.php' => 1, | |
| 'ansi.php' => 1, | |
| 'linkrel_body.php' => 1, | |
| 'linkrel.php' => 1, | |
| 'soclozfeatureflagbundle.php' => 1, | |
| 'gh-pages.sh' => 1, | |
| 'docviewer.php' => 1, | |
| 'classinfo_html.php' => 1, | |
| 'commanduserbundle.php' => 1, | |
| 'spomkylabsrolehierarchybundle.php' => 1, | |
| 'spomkylabsoauth2serverbundle.php' => 1, | |
| 'extensionwithplugins.php' => 1, | |
| 'configurationwithplugins.php' => 1, | |
| 'bundlewithplugins.php' => 1, | |
| 'bundleplugininterface.php' => 1, | |
| 'spomkylabsjosebundle.php' => 1, | |
| 'spomkylabsipfilterbundle.php' => 1, | |
| 'spikeointltelbundle.php' => 1, | |
| 'speicher210cloudinarybundle.php' => 1, | |
| 'spfixturedumperbundle.php' => 1, | |
| 'sparkreflection.php' => 1, | |
| 'bprsassetbundle.php' => 1, | |
| 'basics.php' => 1, | |
| 'fixers' => 1, | |
| 'soulboundawscloudsearchbundle.php' => 1, | |
| 'php-export-data.class.php' => 1, | |
| 'dtd-parser.iml' => 1, | |
| 'soothsilverdtdparser.php' => 1, | |
| 'extyii.php' => 1, | |
| 'classdiagram.png' => 1, | |
| 'classdiagram.dia' => 1, | |
| 'yamlstorage.php' => 1, | |
| 'parametersstorage.php' => 1, | |
| 'configstorage.php' => 1, | |
| 'spraedvcardbundle.php' => 1, | |
| 'bprsassetevent.php' => 1, | |
| 'slot.php' => 1, | |
| 'kcfinderinput.php' => 1, | |
| 'openssl.conf' => 1, | |
| 'opensslca.php' => 1, | |
| 'laravel-docker' => 1, | |
| 'overlayasset.php' => 1, | |
| 'debugpanelasset.php' => 1, | |
| 'crontask.php' => 1, | |
| 'cronservice.php' => 1, | |
| 'cronprocess.php' => 1, | |
| 'documents.json' => 1, | |
| 'documents-sample.json' => 1, | |
| 'stephanemanginangularjwtauthenticationbundle.php' => 1, | |
| 'kcfinderselectasset.php' => 1, | |
| 'yii2boletos.php' => 1, | |
| 'bprscommandlinebundle.php' => 1, | |
| 'smalltal.php' => 1, | |
| 'smalltal.tests.php' => 1, | |
| 'smalltal.compiler.php' => 1, | |
| 'neartal.php' => 1, | |
| 'neartal.tests.php' => 1, | |
| 'neartal.compiler.php' => 1, | |
| 'license.agpl-3.0' => 1, | |
| 'testwidget.php' => 1, | |
| 'piha.sh' => 1, | |
| 'staglag13womtestbundle.php' => 1, | |
| 'cli_run.php' => 1, | |
| 'bprsuserbundle.php' => 1, | |
| 'bprsstylebundle.php' => 1, | |
| 'arraystorage.php' => 1, | |
| 'uriservice.php' => 1, | |
| 'webpackpublishplugin.js' => 1, | |
| 'corrector.php' => 1, | |
| 'single-esdeveniment.php' => 1, | |
| 'plantilla-text-menuleft.php' => 1, | |
| 'plantilla-steps.php' => 1, | |
| 'plantilla-distribuidora-02.php' => 1, | |
| 'plantilla-distribuidora-02-auto.php' => 1, | |
| 'plantilla-distribuidora-01.php' => 1, | |
| 'plantilla-distribuidora-01-auto.php' => 1, | |
| 'planeta.php' => 1, | |
| 'home-sc.php' => 1, | |
| 'dist-recursos_traductors.php' => 1, | |
| 'dist-eines_consulta.php' => 1, | |
| 'diccionari-multilingue.php' => 1, | |
| 'contacte.php' => 1, | |
| 'single-projecte.php' => 1, | |
| 'archive-projecte.php' => 1, | |
| 'archive-programa.php' => 1, | |
| 'archive-esdeveniment.php' => 1, | |
| 'aparell.php' => 1, | |
| 'sc-shortcodes.php' => 1, | |
| 'sc-normalize-upload-dir.php' => 1, | |
| 'sc-importer.php' => 1, | |
| 'scfootnotes.php' => 1, | |
| 'scfootnotes.js' => 1, | |
| 'mce-table-buttons-class.php' => 1, | |
| 'logboardbundle.php' => 1, | |
| 'soclemissingtypebundle.php' => 1, | |
| 'socleintldatetimeformatbundle.php' => 1, | |
| 'single-programa.php' => 1, | |
| 'sinonims.php' => 1, | |
| 'solve' => 1, | |
| 'formulaire.php' => 1, | |
| 'httpstatus.php' => 1, | |
| 'headerstorage.php' => 1, | |
| 'fsservice.php' => 1, | |
| 'eventstate.php' => 1, | |
| 'eventpriority.php' => 1, | |
| 'dependencyunit.php' => 1, | |
| 'dependencycontainer.php' => 1, | |
| 'qc.php' => 1, | |
| 'dataprocessortest.php' => 1, | |
| 'dataprocessor.php' => 1, | |
| 'soloistbaseadminbundle.php' => 1, | |
| 'tester.php' => 1, | |
| 'fastconfig.php' => 1, | |
| 'subpagina-programa.php' => 1, | |
| 'exceptioninternal.php' => 1, | |
| 'processtrait.php' => 1, | |
| 'trieur.php' => 1, | |
| 'sourcefilter.php' => 1, | |
| 'abstractformat.php' => 1, | |
| 'mysqldump.class.php' => 1, | |
| 'soipookentouserbundle.php' => 1, | |
| 'soipookentoadminbundle.php' => 1, | |
| 'theme-mover.php' => 1, | |
| 'traductor.php' => 1, | |
| 'taxonomy-esdeveniment_cat.php' => 1, | |
| 'taxonomy-categoria_projecte.php' => 1, | |
| 'subpagina-projecte.php' => 1, | |
| 'docviewer_body.php' => 1, | |
| 'docviewer.i18n.php' => 1, | |
| 'license-numeraljs' => 1, | |
| 'screeperactionbundle.php' => 1, | |
| 'textcutter.php' => 1, | |
| 'swmmailhookevent.php' => 1, | |
| 'swmmailhookbundle.php' => 1, | |
| 'reph.php' => 1, | |
| 'reph.phn' => 1, | |
| 'template_debug.php' => 1, | |
| 'pharen.php' => 1, | |
| 'lexical.php' => 1, | |
| 'lang.phn' => 1, | |
| 'screeperserverbundle.php' => 1, | |
| 'screeperplayerbundle.php' => 1, | |
| 'screeperjsonapibundle.php' => 1, | |
| 'screamzsecuredownloadbundle.php' => 1, | |
| 'php-console.js' => 1, | |
| 'htmlsample.html' => 1, | |
| 'googlechart.php' => 1, | |
| 'export2excelbehavior.php' => 1, | |
| 'downloadaction.php' => 1, | |
| 'shkpagebundle.php' => 1, | |
| 'details' => 1, | |
| 'chart.png' => 1, | |
| 'release.command' => 1, | |
| 'svdschedulerbundle.php' => 1, | |
| 'svdmediabundle.php' => 1, | |
| 'sceniccitylabsoauthbundle.php' => 1, | |
| 'changelog-5.8' => 1, | |
| 'jquery-1.9.1.min.js' => 1, | |
| 'selenesoftwarespressplugindeployaws.php' => 1, | |
| 'user-data.tpl.sh' => 1, | |
| 'semanticwatchlist.hooks.php' => 1, | |
| 'wp-dashboard-log-monitor.php' => 1, | |
| 'wp-custom-bulk-actions.php' => 1, | |
| 'lake' => 1, | |
| 'budgegeriadatetimebundle.php' => 1, | |
| 'datacollectorbundle.php' => 1, | |
| 'sendmachineapiclient.php' => 1, | |
| 'sempredfacebookbundle.php' => 1, | |
| 'whatsnearby.php' => 1, | |
| 'semanticwatchlist.settings.php' => 1, | |
| 'semanticwatchlist.php' => 1, | |
| 'semanticwatchlist.i18n.php' => 1, | |
| 'semanticwatchlist.i18n.alias.php' => 1, | |
| 'semanticsignup.php' => 1, | |
| 'example.phpunit.xml.dist' => 1, | |
| 'semanticmetatags.php' => 1, | |
| 'semanticmediawiki.settings.php' => 1, | |
| 'semanticmediawiki.php' => 1, | |
| 'semanticmediawiki.hooks.php' => 1, | |
| 'semanticmaps.php' => 1, | |
| 'semanticmaps.hooks.php' => 1, | |
| 'sm_settings.php' => 1, | |
| 'semanticinterlanguagelinks.php' => 1, | |
| 'semanticglossary.php' => 1, | |
| 'semanticformsselect.php' => 1, | |
| 'semanticextraspecialproperties.php' => 1, | |
| 'semanticexternalquerylookup.php' => 1, | |
| 'semanticcite.php' => 1, | |
| 'changelog-5.10' => 1, | |
| 'options-icon.png' => 1, | |
| 'wp-frontend-profile.php' => 1, | |
| 'statementiteratorfactory.php' => 1, | |
| 'bspaccountingbundle.php' => 1, | |
| 'breakouthelper.php' => 1, | |
| 'sstwitterbundle.php' => 1, | |
| 'parallaxbundle.php' => 1, | |
| 'url_rewriting' => 1, | |
| 'sparqlutils.php' => 1, | |
| 'saft.wordpress.php' => 1, | |
| 'chainablestore.php' => 1, | |
| 'basictriplepatternstore.php' => 1, | |
| 'abstracttriplepatternstore.php' => 1, | |
| 'abstractsparqlstore.php' => 1, | |
| 'statementiteratorfactoryimpl.php' => 1, | |
| 'statementiterator.php' => 1, | |
| 'activemongocursor.php' => 1, | |
| 'statementimpl.php' => 1, | |
| 'statementfactoryimpl.php' => 1, | |
| 'statementfactory.php' => 1, | |
| 'nodeutils.php' => 1, | |
| 'nodefactoryimpl.php' => 1, | |
| 'nodefactory.php' => 1, | |
| 'namednodeimpl.php' => 1, | |
| 'namednode.php' => 1, | |
| 'literalpatternimpl.php' => 1, | |
| 'literalimpl.php' => 1, | |
| 'literal.php' => 1, | |
| 'blanknodeimpl.php' => 1, | |
| 'blanknode.php' => 1, | |
| 'logroute.php' => 1, | |
| 'indexcontroller.php' => 1, | |
| 'logo-white.png' => 1, | |
| 'samsondatagridbundle.php' => 1, | |
| 'internal' => 1, | |
| 'satoripopimagesbundle.php' => 1, | |
| 'sarsportuserbundle.php' => 1, | |
| 'sarsportapplicationbundle.php' => 1, | |
| 'stnwechatbundle.php' => 1, | |
| 'stnstatemachinebundle.php' => 1, | |
| 'samsonyoutrackbundle.php' => 1, | |
| 'samsonunexpectedresponsebundle.php' => 1, | |
| 'samsonsimplerknppaginatorbundle.php' => 1, | |
| 'samsonreleasebundle.php' => 1, | |
| 'samsonfilterbundle.php' => 1, | |
| 'samsondataviewbundle.php' => 1, | |
| 'samsonautocompletebundle.php' => 1, | |
| 'elephantio.php' => 1, | |
| 'samsonangularroutingbundle.php' => 1, | |
| 'rackspace.php' => 1, | |
| 'jquery.qtip.min.map' => 1, | |
| 'jquery.qtip.min.js' => 1, | |
| 'jquery.qtip.min.css' => 1, | |
| 'jquery.qtip.js' => 1, | |
| 'jquery.qtip.css' => 1, | |
| 'imagesloaded.pkg.min.js' => 1, | |
| 'qtipasset.php' => 1, | |
| 'qtip.php' => 1, | |
| 'outdatedbrowserasset.php' => 1, | |
| 'outdatedbrowser.php' => 1, | |
| 'keycdn.php' => 1, | |
| 'wp-fetch-social-posts.php' => 1, | |
| 'wp-hq-responsive-youtube-embed.php' => 1, | |
| 'docviewer.i18n.magic.php' => 1, | |
| 'basewpapi.php' => 1, | |
| 'arnmmediabundle.php' => 1, | |
| 'arnmcorebundle.php' => 1, | |
| 'arnmcontentbundle.php' => 1, | |
| 'arnmcontactbundle.php' => 1, | |
| 'configbundleinfo.php' => 1, | |
| 'arnmconfigbundle.php' => 1, | |
| 'arnmcatalogbundle.php' => 1, | |
| 'arnmartistbundle.php' => 1, | |
| 'arrayfinder.php' => 1, | |
| 'wpapiexception.php' => 1, | |
| 'orgwpapi.php' => 1, | |
| 'comwpapi.php' => 1, | |
| 'apirequest.php' => 1, | |
| 'arnmmenubundle.php' => 1, | |
| 'ilinkoscope.php' => 1, | |
| 'iapihandler.php' => 1, | |
| 'orglinkoscope.php' => 1, | |
| 'getlinksresult.php' => 1, | |
| 'getlinksrequest.php' => 1, | |
| 'getcommentsresult.php' => 1, | |
| 'getcommentsrequest.php' => 1, | |
| 'comlinkoscope.php' => 1, | |
| 'libs.php' => 1, | |
| 'twisto.php' => 1, | |
| 'shareddbresponse.php' => 1, | |
| 'orderitem.php' => 1, | |
| 'neworder.php' => 1, | |
| 'mediacontentbundle.php' => 1, | |
| 'arnmpagesbundle.php' => 1, | |
| 'checkresponse.php' => 1, | |
| 'silvestramediabundle.php' => 1, | |
| 'silvestratextnodebundle.php' => 1, | |
| 'silvestratextbundle.php' => 1, | |
| 'silvestrasitemapbundle.php' => 1, | |
| 'silvestraseobundle.php' => 1, | |
| 'seopageinterface.php' => 1, | |
| 'seopage.php' => 1, | |
| 'silvestrasandboxbundle.php' => 1, | |
| 'silvestrapaginatorbundle.php' => 1, | |
| 'urlhelper.php' => 1, | |
| 'templatinghelperinterface.php' => 1, | |
| 'silvestranotificationbundle.php' => 1, | |
| 'alertmanager.php' => 1, | |
| 'silvestralocalebundle.php' => 1, | |
| 'arnmwidgetbundle.php' => 1, | |
| 'silvestrafrontendbundle.php' => 1, | |
| 'silvestraformbundle.php' => 1, | |
| 'keyvaluearray.php' => 1, | |
| 'silvestracachebundle.php' => 1, | |
| 'silvestrabannerbundle.php' => 1, | |
| 'bannerzonesynchronizer.php' => 1, | |
| 'silvestraadminuserbundle.php' => 1, | |
| 'silvestraadminbundle.php' => 1, | |
| 'silverkixcmsbundle.php' => 1, | |
| 'simpleorm.php' => 1, | |
| 'containerawarecommand.php' => 1, | |
| 'sibsetaopfeaturebundle.php' => 1, | |
| 'jwthttpbearerauth.php' => 1, | |
| 'customer.php' => 1, | |
| 'bareorder.php' => 1, | |
| 'admin-readme.html' => 1, | |
| 'employee.php' => 1, | |
| 'sflsettingsbundle.php' => 1, | |
| 'sflpagebundle.php' => 1, | |
| 'sflgoogleapibundle.php' => 1, | |
| 'sendpulseinterface.php' => 1, | |
| 'sendpulse.php' => 1, | |
| 'dtobundle.php' => 1, | |
| 'smsaero.php' => 1, | |
| 'econfig.php' => 1, | |
| 'sergsxmuibundle.php' => 1, | |
| 'schedulewidget.php' => 1, | |
| 'rgobjecttrait.php' => 1, | |
| 'employeegroup.php' => 1, | |
| 'pushmenuwidget.php' => 1, | |
| 'hidenamespace.i18n.magic.php' => 1, | |
| 'bootstrowidget.php' => 1, | |
| 'inbapiauthenticationbundle.php' => 1, | |
| 'editlinkasset.php' => 1, | |
| 'editlink.php' => 1, | |
| 'siphash_apache.so' => 1, | |
| 'siphash.so' => 1, | |
| 'serializebehavior.php' => 1, | |
| 'searchlucene.php' => 1, | |
| 'menubuilderassets.php' => 1, | |
| 'simple-header-footer-html.php' => 1, | |
| 'wp-multisite-plugin-statistics.php' => 1, | |
| 'link-relative.js' => 1, | |
| 'https-domain-alias.php' => 1, | |
| 'breadcrumb.css' => 1, | |
| 'hidenamespace.i18n.php' => 1, | |
| 'barecustomer.php' => 1, | |
| 'shaygantelegrambotapibundle.php' => 1, | |
| 'bareaddress.php' => 1, | |
| 'shoplobundle.php' => 1, | |
| '.shootproof-sample' => 1, | |
| 'shonmresquebundle.php' => 1, | |
| 'resqueevents.php' => 1, | |
| 'chesscomhoneybadgerbundle.php' => 1, | |
| 'usoftidealbundle.php' => 1, | |
| 'abstracttranslationbundle.php' => 1, | |
| 'class-jp-tax-query.php' => 1, | |
| 'jp-rest-cache.php' => 1, | |
| 'class-jp-menu-api.php' => 1, | |
| 'telegrambotapi.php' => 1, | |
| 'shayganaffiliateevents.php' => 1, | |
| 'hidenamespace.php' => 1, | |
| 'shayganaffiliatebundle.php' => 1, | |
| 'increment.php' => 1, | |
| 'generalizing' => 1, | |
| 'feature.php' => 1, | |
| 'shakepeers.php' => 1, | |
| 'myscripts.js' => 1, | |
| 'mising-trads' => 1, | |
| 'custom.css' => 1, | |
| 'shakepeers.skin.php' => 1, | |
| 'sitelinkssearchbox.php' => 1, | |
| 'pagecreator.php' => 1, | |
| 'pagecontributors.php' => 1, | |
| 'pagecontributors.i18n.magic.php' => 1, | |
| 'stillat_common.png' => 1, | |
| 'license-numbro' => 1, | |
| 'anypatternimpl.php' => 1, | |
| 'stop.sh' => 1, | |
| 'thibautg16squelettebundle.php' => 1, | |
| 'theratbranchingbundle.php' => 1, | |
| 'appfile' => 1, | |
| 'aws.config.yml' => 1, | |
| 'thephalconsamazonwebservicesbundle.php' => 1, | |
| 'basesocketlistener.php' => 1, | |
| 'settingtrait.php' => 1, | |
| 'mongoclient.php' => 1, | |
| 'utilities.sublime-project' => 1, | |
| 'tumblr-parser.sublime-project' => 1, | |
| 'rating.sublime-project' => 1, | |
| 'phpcsrs.sublime-project' => 1, | |
| 'start-mua.sh' => 1, | |
| 'sitebuild' => 1, | |
| 'start-daemon.sh' => 1, | |
| 'phpchat.sublime-project' => 1, | |
| 'listports.sh' => 1, | |
| 'macho.sublime-project' => 1, | |
| 'dbg.sh' => 1, | |
| 'config.check.sh' => 1, | |
| 'imapd.sublime-project' => 1, | |
| 'html2markdown.sublime-project' => 1, | |
| 'hashcash.sublime-project' => 1, | |
| 'assembly.sublime-project' => 1, | |
| 'masonry' => 1, | |
| 'fscrestbundle.php' => 1, | |
| 'new text document' => 1, | |
| 'dist.configuration.php' => 1, | |
| 'fscp3pbundle.php' => 1, | |
| 'wpsimplemapper.class.php' => 1, | |
| 'kendobuild.php' => 1, | |
| 'tigreboitefunkylabbundle.php' => 1, | |
| '.gitiignore' => 1, | |
| 'ticketparkpingenbundle.php' => 1, | |
| 'ticketparkpdfbundle.php' => 1, | |
| 'ticketparklocalebundle.php' => 1, | |
| 'ticketparkimagebundle.php' => 1, | |
| 'ticketparkfilebundle.php' => 1, | |
| 'ticketparkexpiringurlbundle.php' => 1, | |
| 'ticketparkexcelbundle.php' => 1, | |
| 'ticketparkdynamicrolebundle.php' => 1, | |
| 'ticketparkbarcodebundle.php' => 1, | |
| 'wpsimpledao.class.php' => 1, | |
| 'start_phantomjs.sh' => 1, | |
| 'plib.class.php' => 1, | |
| 'phpgamification.class.php' => 1, | |
| 'dao.class.php' => 1, | |
| 'phalconfilter.php' => 1, | |
| 'ar_migrate' => 1, | |
| 'test_configs.php' => 1, | |
| 'ar_benchmark' => 1, | |
| 'tctwigglobalbundle.php' => 1, | |
| 'tctwigdefaultbundle.php' => 1, | |
| 'tcpjaxbundle.php' => 1, | |
| 'pool.php' => 1, | |
| 'controllable.php' => 1, | |
| 'start_selenium.sh' => 1, | |
| 'responsedecorator.php' => 1, | |
| 'fschateoasbundle.php' => 1, | |
| 'git_env.reg' => 1, | |
| 'teckhousemdetectbundle.php' => 1, | |
| 'tecnocreacionesvzlafixturesbundle.php' => 1, | |
| 'tecnocreacionesvzlaentitybundle.php' => 1, | |
| 'tecnocreacionesvzlaapibundle.php' => 1, | |
| 'toolsevents.php' => 1, | |
| 'tecnocreacionestoolsbundle.php' => 1, | |
| 'tecnocreacionesresourcebundle.php' => 1, | |
| 'tecnocreacionesinstallbundle.php' => 1, | |
| 'tecnocreacionescrmtemplatebundle.php' => 1, | |
| 'btobsocialnetworkentitybundle.php' => 1, | |
| 'btobsocialnetworkcorebundle.php' => 1, | |
| 'tecnocreacionesajaxfosuserbundle.php' => 1, | |
| 'tecnowordbundle.php' => 1, | |
| 'teckhouseanalyticsbundle.php' => 1, | |
| 'tecnocreacionesvzlatoolsbundle.php' => 1, | |
| 'techdatacontextdibundle.php' => 1, | |
| 'techdataas2securebundle.php' => 1, | |
| 'stormdeltalatexencoderannotationbundle.php' => 1, | |
| 'razorgatorfulfillmentapiv1.pdf' => 1, | |
| 'newtype.php' => 1, | |
| 'generate_model.php' => 1, | |
| 'usersbase.php' => 1, | |
| 'taysormbase.php' => 1, | |
| 'easyconnect.php' => 1, | |
| 'sqlbrainstorming.sql' => 1, | |
| 'librarianapinoodling.php' => 1, | |
| 'taoti_bootstrap.libraries.yml' => 1, | |
| 'taoti_bootstrap.info.yml' => 1, | |
| 'tecnocreacionesvzlagovernmentbundle.php' => 1, | |
| 'laravelpayzencontroller.php' => 1, | |
| 'fscemailfilterbundle.php' => 1, | |
| 'th3moukdoctrinetableprefixbundle.php' => 1, | |
| 'dotcommercefastentitybundle.php' => 1, | |
| 'northwind.sql' => 1, | |
| 'architect' => 1, | |
| 'tbbcrestutilbundle.php' => 1, | |
| 'composer-template.json' => 1, | |
| 'tbbcmoneyevents.php' => 1, | |
| 'tbbcmoneybundle.php' => 1, | |
| 'moneyexception.php' => 1, | |
| 'tbbccachebundle.php' => 1, | |
| 'classnotfoundexception.php' => 1, | |
| 'th3moukyahooweatherbundle.php' => 1, | |
| 'th3moukplanningbundle.php' => 1, | |
| 'th3moukcmssiteplanbundle.php' => 1, | |
| 'laravelpayzenserviceprovider.php' => 1, | |
| 'th3moukcmssimplecontentmanagerbundle.php' => 1, | |
| 'th3moukcmspagebundle.php' => 1, | |
| 'th3moukcmscorebundle.php' => 1, | |
| 'textrazor.php' => 1, | |
| 'mhosts.php' => 1, | |
| 'php7exceptions.php' => 1, | |
| 'telerivet.php' => 1, | |
| 'telemessage_web.phar' => 1, | |
| 'sellsy-plugin.php' => 1, | |
| 'asteriskmanager.php' => 1, | |
| 'agi.php' => 1, | |
| 'tehrancodeyahooapibundle.php' => 1, | |
| 'payzenformtoolbox.php' => 1, | |
| 'symfonianindonesiagammubundle.php' => 1, | |
| 'simplethingszetawebmailbundle.php' => 1, | |
| 'testbannerbundle.php' => 1, | |
| 'ucssecuritybobundle.php' => 1, | |
| 'datagridcolumninterface.php' => 1, | |
| 'datagridcolumnconfigurationinterface.php' => 1, | |
| 'datagridcolumnconfiguration.php' => 1, | |
| 'datagridcolumn.php' => 1, | |
| 'abstractdatagridtype.php' => 1, | |
| 'currencycodeguesserinterface.php' => 1, | |
| 'ucsutilsbundle.php' => 1, | |
| 'userprofileevents.php' => 1, | |
| 'userlogevents.php' => 1, | |
| 'ucsusermodelbundle.php' => 1, | |
| 'ucsuserbobundle.php' => 1, | |
| 'ucssecuritymodelbundle.php' => 1, | |
| 'ucssearchbundle.php' => 1, | |
| 'datagridconfigurationinterface.php' => 1, | |
| 'ucsrichuibundle.php' => 1, | |
| 'ucsmailerbundle.php' => 1, | |
| 'ucshtmlgeneratorbundle.php' => 1, | |
| 'markupevents.php' => 1, | |
| 'ucsdatagridbundle.php' => 1, | |
| 'ucsbackofficebundle.php' => 1, | |
| 'ucsadminstrapbundle.php' => 1, | |
| 'efficientpaginator.php' => 1, | |
| 'ucsnewsbundle.php' => 1, | |
| 'newsevents.php' => 1, | |
| 'newsmediamanagerinterface.php' => 1, | |
| 'newsmediamanager.php' => 1, | |
| 'datagridconfiguration.php' => 1, | |
| 'datagridfactory.php' => 1, | |
| 'newsmedia.php' => 1, | |
| '.arrayformtype.php.swp' => 1, | |
| 'autoload_test_function.php' => 1, | |
| 'autoload_test_classmap.php' => 1, | |
| 'ufo_license_ru' => 1, | |
| 'markupmanagerinterface.php' => 1, | |
| 'markupmanager.php' => 1, | |
| 'markupinterface.php' => 1, | |
| 'generatorfactoryinterface.php' => 1, | |
| 'generatorfactory.php' => 1, | |
| 'constraintfactoryinterface.php' => 1, | |
| 'constraintfactory.php' => 1, | |
| 'arrayformtype.php' => 1, | |
| 'arrayformdataparserinterface.php' => 1, | |
| 'datapropertytransformerinterface.php' => 1, | |
| 'datagridfactoryinterface.php' => 1, | |
| 'datapropertyinterface.php' => 1, | |
| 'datapropertyformatterregistryinterface.php' => 1, | |
| 'datapropertyformatterregistry.php' => 1, | |
| 'datapropertyformatterinterface.php' => 1, | |
| 'datapropertyconfigurationinterface.php' => 1, | |
| 'datapropertyconfiguration.php' => 1, | |
| 'dataproperty.php' => 1, | |
| 'datagridtypeinterface.php' => 1, | |
| 'datagridrowtransformerinterface.php' => 1, | |
| 'datagridrowformatterinterface.php' => 1, | |
| 'datagridrowformatter.php' => 1, | |
| 'datagridpreviewerinterface.php' => 1, | |
| 'datagridinterface.php' => 1, | |
| 'newsmediainterface.php' => 1, | |
| 'newsmanagerinterface.php' => 1, | |
| 'tgaaudiencebundle.php' => 1, | |
| 'tom32iuserbundle.php' => 1, | |
| 'translation.sql' => 1, | |
| 'views-info.png' => 1, | |
| 'server-info.png' => 1, | |
| 'request-info.png' => 1, | |
| 'database-info.png' => 1, | |
| 'atlassianstashintegrationplugin.php' => 1, | |
| 'traackr-api.sublime-project' => 1, | |
| 'upload.xml' => 1, | |
| 'etherpad-lite-client.php' => 1, | |
| 'api-spec.json' => 1, | |
| 'example-loader.php' => 1, | |
| 'interop.php' => 1, | |
| 'tom32iurlscannerbundle.php' => 1, | |
| 'phpunit-no-logging.xml' => 1, | |
| 'tom32isimplesecuritybundle.php' => 1, | |
| 'tom32ifilebundle.php' => 1, | |
| 'tom32icsvbundle.php' => 1, | |
| 'max' => 1, | |
| 'dbconnector.php' => 1, | |
| 'math' => 1, | |
| 'tinyview.php' => 1, | |
| 'reasons.php' => 1, | |
| 'tinyvalidator.php' => 1, | |
| 'showloading.php' => 1, | |
| 'panelmenu.php' => 1, | |
| 'advanced-rss-widget.php' => 1, | |
| 'tilowebpaginationbundle.php' => 1, | |
| 'treewebvalidationbundle.php' => 1, | |
| 'test_configuration.example.yml' => 1, | |
| 'newsmanager.php' => 1, | |
| 'guide_utilisation_magento2.docx' => 1, | |
| 'newsinterface.php' => 1, | |
| 'newsawareinterface.php' => 1, | |
| 'tmpvj91xg' => 1, | |
| 'mailercollection.php' => 1, | |
| 'defaultmailer.php' => 1, | |
| 'configurableactioninterface.php' => 1, | |
| 'actionsubjectinterface.php' => 1, | |
| 'actioninterface.php' => 1, | |
| 'actionevents.php' => 1, | |
| 'actionevent.php' => 1, | |
| 'actioncollection.php' => 1, | |
| 'user_guide_magento2.docx' => 1, | |
| 'txtonyarrowdbconnectorevents.php' => 1, | |
| 'mondrian.php' => 1, | |
| 'txtonyarrowdbconnectorbundle.php' => 1, | |
| 'sweet-qa' => 1, | |
| 'session_messages.php' => 1, | |
| 'tuxes3doctrineutilbundle.php' => 1, | |
| 'tohtmlmini.jpg' => 1, | |
| 'uglifycss-lib.js' => 1, | |
| 'uglifycss' => 1, | |
| 'serpri.php' => 1, | |
| 'serpri' => 1, | |
| 'tdsinflectorbundle.php' => 1, | |
| 'troissixmysqlpostfixadminbundle.php' => 1, | |
| 'trismegistewambundle.php' => 1, | |
| 'howtouse' => 1, | |
| 'taoti_bootstrap.breakpoints.yml' => 1, | |
| 'planned' => 1, | |
| 'stingerbootstrapmaxlengthjsbundle.php' => 1, | |
| 'precisions.php' => 1, | |
| 'catalog-1.0.mwb' => 1, | |
| 'walvasimplecmsbundle.php' => 1, | |
| 'ste.php' => 1, | |
| 'pathcompiler.php' => 1, | |
| 'hostcompiler.php' => 1, | |
| 'compilerinterface.php' => 1, | |
| 'resourceserver.php' => 1, | |
| 'refreshtokeninterface.php' => 1, | |
| 'mac.php' => 1, | |
| 'implicitgrantinterface.php' => 1, | |
| 'dynamicuriinterface.php' => 1, | |
| 'authcodeinterface.php' => 1, | |
| 'exchangerateexception.php' => 1, | |
| 'swpmultitenancybundle.php' => 1, | |
| 'nativedriver.php' => 1, | |
| 'modriver.php' => 1, | |
| 'directories.php' => 1, | |
| 'sqlitedriver.php' => 1, | |
| 'pgsqltableschema.php' => 1, | |
| 'pgsqldriver.php' => 1, | |
| 'mysqldriver.php' => 1, | |
| 'pdostatementinterface.php' => 1, | |
| 'pdointerface.php' => 1, | |
| 'yamlloader.php' => 1, | |
| 'xmlloader.php' => 1, | |
| 'nativeloader.php' => 1, | |
| 'swpbridgebundle.php' => 1, | |
| 'swpupdaterbundle.php' => 1, | |
| 'iniloader.php' => 1, | |
| 'ordershippingtransitions.php' => 1, | |
| 'resourceactions.php' => 1, | |
| 'serviceregistryinterface.php' => 1, | |
| 'prioritizedserviceregistryinterface.php' => 1, | |
| 'prioritizedserviceregistry.php' => 1, | |
| 'nonexistingserviceexception.php' => 1, | |
| 'existingserviceexception.php' => 1, | |
| 'paymenttransitions.php' => 1, | |
| 'ordertransitions.php' => 1, | |
| 'syliusmailerevents.php' => 1, | |
| 'syliusstockableevents.php' => 1, | |
| 'inventoryunittransitions.php' => 1, | |
| 'syliuscheckoutevents.php' => 1, | |
| 'orderpaymenttransitions.php' => 1, | |
| 'html2pdf.js' => 1, | |
| 'ordercheckouttransitions.php' => 1, | |
| 'ordercheckoutstates.php' => 1, | |
| 'syliuscartevents.php' => 1, | |
| 'sylakesylakimbundle.php' => 1, | |
| 'licence.sample' => 1, | |
| 'coffee.php' => 1, | |
| 'swith' => 1, | |
| 'errorlayout.php' => 1, | |
| 'switherror.php' => 1, | |
| 'modulebootstrapper.php' => 1, | |
| 'scales.tsv' => 1, | |
| 'chords' => 1, | |
| 'survosmogreetbundle.php' => 1, | |
| 'jsonloader.php' => 1, | |
| 'captcha.ttf' => 1, | |
| 'shipmenttransitions.php' => 1, | |
| 'stingerckeditortableresizebundle.php' => 1, | |
| 'stingervisjsbundle.php' => 1, | |
| 'readme-orig' => 1, | |
| 'license-apache-2.0' => 1, | |
| 'stingerstrophejsbundle.php' => 1, | |
| 'stingersoftplatformbundle.php' => 1, | |
| 'stingermomentjsbundle.php' => 1, | |
| 'stingersoftmediaparsingbundle.php' => 1, | |
| 'stingerjquerybackstretchbundle.php' => 1, | |
| 'stingerckeditorwidgetbundle.php' => 1, | |
| 'stingerckeditoruploadwidgetbundle.php' => 1, | |
| 'stingerckeditoruploadimagebundle.php' => 1, | |
| 'stingerckeditortabletoolsbundle.php' => 1, | |
| 'stingerckeditorsavebundle.php' => 1, | |
| 'load-mu-plugins.php' => 1, | |
| 'stingerckeditorquicktablebundle.php' => 1, | |
| 'stingerckeditorpreviewbundle.php' => 1, | |
| 'stingerckeditorpanelbuttonbundle.php' => 1, | |
| 'stingerckeditorpanelbundle.php' => 1, | |
| 'stingerckeditoroffice2013skinbundle.php' => 1, | |
| 'stingerckeditornotificationbundle.php' => 1, | |
| 'stingerckeditornotificationaggregatorbundle.php' => 1, | |
| 'stingerckeditorlineutilsbundle.php' => 1, | |
| 'stingerckeditorimage2bundle.php' => 1, | |
| 'stingerckeditorfontbundle.php' => 1, | |
| 'stingerckeditorfloatingpanelbundle.php' => 1, | |
| 'stingerckeditorfiletoolsbundle.php' => 1, | |
| 'stingerckeditorcolorbuttonbundle.php' => 1, | |
| 'zohosubscriptionbundle.php' => 1, | |
| 'understory.php' => 1, | |
| 'memcachestore.php' => 1, | |
| 'phpunit-full.xml.dist' => 1, | |
| 'incrementorinterface.php' => 1, | |
| 'remembermeinterface.php' => 1, | |
| 'limitinterface.php' => 1, | |
| 'internalexception.php' => 1, | |
| 'hotpsecret.php' => 1, | |
| 'hotp.php' => 1, | |
| 'jspacker.php' => 1, | |
| 'jshrinkfilter.php' => 1, | |
| 'dummypacker.php' => 1, | |
| 'csspacker.php' => 1, | |
| 'abstractpacker.php' => 1, | |
| 'modell.php' => 1, | |
| 'attachment.class.php' => 1, | |
| 'epayapicontroller.php' => 1, | |
| 'mimemailparser.class.php' => 1, | |
| 'htaccess.redirect' => 1, | |
| 'strontiumpjaxbundle.php' => 1, | |
| 'specificationfactory.php' => 1, | |
| 'specificationbundle.php' => 1, | |
| 'woocommerce-first-atlantic-commerce.php' => 1, | |
| 'woocommerce-affiliate-tracking.php' => 1, | |
| 'trackerfactory.php' => 1, | |
| 'stregogooglebundle.php' => 1, | |
| 'events-manager-osm.php' => 1, | |
| 'events-manager-osm.js' => 1, | |
| 'iepay.php' => 1, | |
| 'epayapiserviceprovider.php' => 1, | |
| 'syliussequenceevents.php' => 1, | |
| 'shipmentunittransitions.php' => 1, | |
| 'treeexception.php' => 1, | |
| 'syndmultitenantbundle.php' => 1, | |
| 'pointers.js' => 1, | |
| 'pointers-tour.php' => 1, | |
| 'pointersmanagerinterface.php' => 1, | |
| 'pointersmanager.php' => 1, | |
| 'class-tgm-plugin-activation.php' => 1, | |
| 'tdmschedulerbundle.php' => 1, | |
| 'tdmswiftmailereventbundle.php' => 1, | |
| 'tdmdoctrineeventprioritybundle.php' => 1, | |
| 'tdmdoctrineencryptbundle.php' => 1, | |
| 'wp-mainwp-child-hidemenu.php' => 1, | |
| 'syren7owncloudapibundle.php' => 1, | |
| 'tenantevents.php' => 1, | |
| 'syndfreshbooksbundle.php' => 1, | |
| 'httpcapture.php' => 1, | |
| 'uasparser_example.phps' => 1, | |
| 'parameters.json-dist' => 1, | |
| 'db-config-sample.php' => 1, | |
| 'symfonianindonesiarestcrudevents.php' => 1, | |
| 'symfonianindonesiarestcrudbundle.php' => 1, | |
| 'symfonianindonesiarehatconstants.php' => 1, | |
| 'symfonianindonesiarehatbundle.php' => 1, | |
| 'symfonianindonesiaadminconstants.php' => 1, | |
| 'symfonianindonesiaadminbundle.php' => 1, | |
| 'adminbundle.png' => 1, | |
| 'votingbundle.php' => 1, | |
| 'taxonomybundle.php' => 1, | |
| 'sessionbundle.php' => 1, | |
| 'pointers.php' => 1, | |
| 'httpcapturebundle.php' => 1, | |
| 'linkbuttonbundle.php' => 1, | |
| 'surf' => 1, | |
| 'factoryexception.php' => 1, | |
| 'dom.php' => 1, | |
| 'diexception.php' => 1, | |
| 'configurabletrait.php' => 1, | |
| 'talandynamicformbundle.php' => 1, | |
| 'talakadoctrineversioningbundle.php' => 1, | |
| 'talakadoctrinetranslatablebundle.php' => 1, | |
| 'talakaapiplatformmongodbbundle.php' => 1, | |
| 'talakaannotationskitbundle.php' => 1, | |
| 'webpack.js' => 1, | |
| 'tacticscommandbusbundle.php' => 1, | |
| '_.htaccess' => 1, | |
| 'raw' => 1, | |
| 'coreasteriskbundle.php' => 1, | |
| 'browse' => 1, | |
| 'n2r' => 1, | |
| 'tmsolutionextjsbundle.php' => 1, | |
| 'tmsolutionsmsbundle.php' => 1, | |
| 'coresecuritybundle.php' => 1, | |
| 'coremenubundle.php' => 1, | |
| 'tmsolutionloggingbundle.php' => 1, | |
| 'logmanager.php' => 1, | |
| 'tmsolutiongeneratorbundle.php' => 1, | |
| 'phpanalyzer.php' => 1, | |
| 'tmsolutiongamificationbundle.php' => 1, | |
| 'tmsolutionformtypebundle.php' => 1, | |
| 'tmsolutioncronbundle.php' => 1, | |
| 'machinenamefieldbundle.php' => 1, | |
| 'imagefieldbundle.php' => 1, | |
| 'cookiestorage.php' => 1, | |
| 'syliuscurrencybundle.php' => 1, | |
| 'syliuspayumbundle.php' => 1, | |
| 'syliuspaymentbundle.php' => 1, | |
| 'syliusorderbundle.php' => 1, | |
| 'syliusomnipaybundle.php' => 1, | |
| 'syliusmoneybundle.php' => 1, | |
| 'syliusmetadatabundle.php' => 1, | |
| 'syliusmailerbundle.php' => 1, | |
| 'syliuslocalebundle.php' => 1, | |
| 'syliusinstallerbundle.php' => 1, | |
| 'syliusgridbundle.php' => 1, | |
| 'syliusflowbundle.php' => 1, | |
| 'syliusfixturesbundle.php' => 1, | |
| 'syliuscorebundle.php' => 1, | |
| 'syliuspricingbundle.php' => 1, | |
| 'syliuscontactbundle.php' => 1, | |
| 'syliuschannelbundle.php' => 1, | |
| 'syliuscategorizerbundle.php' => 1, | |
| 'syliuscartbundle.php' => 1, | |
| 'syliusbloggerbundle.php' => 1, | |
| 'syliusattributebundle.php' => 1, | |
| 'syliusassortmentbundle.php' => 1, | |
| 'syliusassociationbundle.php' => 1, | |
| 'syliusarchetypebundle.php' => 1, | |
| 'syliusapibundle.php' => 1, | |
| 'syliusadminbundle.php' => 1, | |
| 'syliusaddressingbundle.php' => 1, | |
| 'doctrinecachestorage.php' => 1, | |
| 'syliuspluginsbundle.php' => 1, | |
| 'syliuspromotionbundle.php' => 1, | |
| 'filefieldbundle.php' => 1, | |
| 'syliuswebbundle.php' => 1, | |
| 'filedatabundle.php' => 1, | |
| 'dynamicmenubundle.php' => 1, | |
| 'cronexecuter.php' => 1, | |
| 'contentschedulerbundle.php' => 1, | |
| 'confirmbundle.php' => 1, | |
| 'alertermanager.php' => 1, | |
| 'alerterbundle.php' => 1, | |
| 'imagemagick_dependency.sh' => 1, | |
| 'symfonycommonsimagebundle.php' => 1, | |
| 'symbbextensionbundle.php' => 1, | |
| 'kernelplugin.php' => 1, | |
| 'composerplugin.php' => 1, | |
| 'syliusvariationbundle.php' => 1, | |
| 'syliusrbacbundle.php' => 1, | |
| 'syliusvariableproductbundle.php' => 1, | |
| 'syliususerbundle.php' => 1, | |
| 'syliusuibundle.php' => 1, | |
| 'syliusthemingbundle.php' => 1, | |
| 'syliustaxonomybundle.php' => 1, | |
| 'syliustaxationbundle.php' => 1, | |
| 'syliusshippingbundle.php' => 1, | |
| 'syliussettingsbundle.php' => 1, | |
| 'syliussequencebundle.php' => 1, | |
| 'syliussearchbundle.php' => 1, | |
| 'syliussalesbundle.php' => 1, | |
| 'syliusreviewbundle.php' => 1, | |
| 'syliusreportbundle.php' => 1, | |
| 'arraystatementiteratorimpl.php' => 1, | |
| 'abstractstatement.php' => 1, | |
| 'ujmexobundle.php' => 1, | |
| 'blockcurrencies.tpl' => 1, | |
| 'blocklayered-attribute-indexer.php' => 1, | |
| 'blocklayered-ajax.php' => 1, | |
| 'blocklayered-15.css' => 1, | |
| 'blocklanguages.tpl' => 1, | |
| 'blocklanguages.php' => 1, | |
| 'blocklanguages.css' => 1, | |
| 'blockfacebook.tpl' => 1, | |
| 'blockfacebook.php' => 1, | |
| 'blockfacebook.js' => 1, | |
| 'blockcustomerprivacy.tpl' => 1, | |
| 'blockcustomerprivacy.php' => 1, | |
| 'blockcustomerprivacy-simple.tpl' => 1, | |
| 'blockcurrencies.php' => 1, | |
| 'blocklayered-no-products.tpl' => 1, | |
| 'blockcurrencies.css' => 1, | |
| 'blockcontactinfos.tpl' => 1, | |
| 'blockcontactinfos.php' => 1, | |
| 'blockcontact.tpl' => 1, | |
| 'blockcontact.php' => 1, | |
| 'blockcontact.css' => 1, | |
| 'blockcmsinfo.tpl' => 1, | |
| 'blockcmsinfo.php' => 1, | |
| 'blockcms.tpl' => 1, | |
| 'blockcms.php' => 1, | |
| 'blockcmsmodel.php' => 1, | |
| 'blockcategories_footer.tpl' => 1, | |
| 'blocklayered-footer.js' => 1, | |
| 'blocklayered-price-indexer.php' => 1, | |
| 'blockcategories.php' => 1, | |
| 'blocknewproducts.php' => 1, | |
| 'reassuranceclass.php' => 1, | |
| 'blockreassurance.php' => 1, | |
| 'blockpermanentlinks.tpl' => 1, | |
| 'blockpermanentlinks.php' => 1, | |
| 'blockpermanentlinks.css' => 1, | |
| 'blockpermanentlinks-header.tpl' => 1, | |
| 'blockpermanentlinks-footer.tpl' => 1, | |
| 'blockpaymentlogo.tpl' => 1, | |
| 'blockpaymentlogo.php' => 1, | |
| 'blocknewsletter.php' => 1, | |
| 'blocknewsletter.js' => 1, | |
| 'blocknewsletter.css' => 1, | |
| 'blockmyaccountfooter.tpl' => 1, | |
| 'blocklayered-url-indexer.php' => 1, | |
| 'blockmyaccountfooter.php' => 1, | |
| 'blockmyaccount.css' => 1, | |
| 'blockmyaccount.tpl' => 1, | |
| 'blockmyaccount.php' => 1, | |
| 'blockmanufacturer.tpl' => 1, | |
| 'blockmanufacturer.php' => 1, | |
| 'prefs.gif' => 1, | |
| 'blocklink.tpl' => 1, | |
| 'blocklink.php' => 1, | |
| 'blocklayered.tpl' => 1, | |
| 'blocklayered.php' => 1, | |
| 'blocklayered.js' => 1, | |
| 'blocklayered.css' => 1, | |
| 'blockcategories.tpl' => 1, | |
| 'crossselling.tpl' => 1, | |
| 'blockreinsurance.tpl' => 1, | |
| 'poolport-sample.php' => 1, | |
| 'positibeuniqueviewsbundle.php' => 1, | |
| 'positibeseobundle.php' => 1, | |
| 'portalflareuserbundle.php' => 1, | |
| 'pfpdf.php' => 1, | |
| 'portalflarereportbundle.php' => 1, | |
| 'propertymetadata.php' => 1, | |
| 'portalflaremetadatabundle.php' => 1, | |
| 'metadataprocessor.php' => 1, | |
| 'metadataannotation.php' => 1, | |
| 'annotationdriver.php' => 1, | |
| 'portalflarefilterbundle.php' => 1, | |
| 'magicgettersetter.php' => 1, | |
| '.simplecov' => 1, | |
| 'destroy.png' => 1, | |
| 'ruleset.phpcs.xml' => 1, | |
| 'sslcreator' => 1, | |
| 'polyauth' => 1, | |
| 'pssmockerybundle.php' => 1, | |
| 'pssdoctrineextensionsbundle.php' => 1, | |
| 'pssblogbundle.php' => 1, | |
| 'pfftagitbundle.php' => 1, | |
| 'urlmatcher.php' => 1, | |
| 'kernellistener.php' => 1, | |
| 'acceptheaderserviceprovider.php' => 1, | |
| 'class-pwp-system-status.php' => 1, | |
| 'plemipayboxbundle.php' => 1, | |
| 'plemiboomgobundle.php' => 1, | |
| '.scrutinizer.yml ' => 1, | |
| 'index (copy 1).html' => 1, | |
| 'blockcart.tpl' => 1, | |
| 'bankwire.php' => 1, | |
| 'blockcart.php' => 1, | |
| 'blockcart.css' => 1, | |
| 'blockcart-set-collapse.php' => 1, | |
| 'blockcart-json.tpl' => 1, | |
| 'blockcart-ajax.php' => 1, | |
| 'ajax-cart.js' => 1, | |
| 'blockbestsellers.php' => 1, | |
| 'blockbanner.tpl' => 1, | |
| 'blockbanner.php' => 1, | |
| 'blockbanner.css' => 1, | |
| 'blockadvertising.tpl' => 1, | |
| 'blockadvertising.php' => 1, | |
| 'bankwire.jpg' => 1, | |
| 'index (copy 2).html' => 1, | |
| 'backwardcompatibility.php' => 1, | |
| 'backward_compatibility' => 1, | |
| 'ru.php' => 1, | |
| 'it.php' => 1, | |
| 'autoupgrade.php' => 1, | |
| 'ajax-upgradetab.php' => 1, | |
| 'adminselfupgrade.php' => 1, | |
| 'adminselfupgrade.gif' => 1, | |
| 'adminselftab.php' => 1, | |
| 'adminpreferences.php' => 1, | |
| 'advancedeucompliance.php' => 1, | |
| 'pswebservicelibrary.php' => 1, | |
| 'index (copy 3).html' => 1, | |
| 'blockreinsurance.php' => 1, | |
| 'reinsuranceclass.php' => 1, | |
| 'setup.yml.sample' => 1, | |
| 'homefeatured.php' => 1, | |
| 'productcomments.css' => 1, | |
| 'productcomments-extra.tpl' => 1, | |
| 'productcomments-ajax.php' => 1, | |
| 'productcriterion.php' => 1, | |
| 'productcommentcriterion.php' => 1, | |
| 'productcomment.php' => 1, | |
| 'paymentexample.php' => 1, | |
| 'payment.jpg' => 1, | |
| 'pagesnotfound.php' => 1, | |
| 'comment.gif' => 1, | |
| 'newsletter.php' => 1, | |
| 'homeslider.php' => 1, | |
| 'gsitemap.php' => 1, | |
| 'productcomments.tpl' => 1, | |
| 'gsitemap-cron.php' => 1, | |
| 'gridhtml.php' => 1, | |
| 'graphnvd3.php' => 1, | |
| 'oauth2callback.php' => 1, | |
| 'gapi.php' => 1, | |
| 'sql_install.php' => 1, | |
| 'prestashop.pub' => 1, | |
| 'gamification.php' => 1, | |
| 'followup.php' => 1, | |
| 'favoriteproducts.php' => 1, | |
| 'favoriteproducts.js' => 1, | |
| 'favoriteproducts.css' => 1, | |
| 'productcomments.php' => 1, | |
| 'productcomments_reviews.tpl' => 1, | |
| 'favoriteproducts-account.php' => 1, | |
| 'ps_customtext.tpl' => 1, | |
| 'referralprogrammodule.php' => 1, | |
| 'pscleaner.php' => 1, | |
| 'ps_socialfollow.tpl' => 1, | |
| 'ps_socialfollow.php' => 1, | |
| 'ps_sharebuttons.php' => 1, | |
| 'ps_mainmenu.tpl' => 1, | |
| 'ps_mainmenu.php' => 1, | |
| 'ps_linklist.php' => 1, | |
| 'ps_imageslider.php' => 1, | |
| 'homeslider.gif' => 1, | |
| 'ps_featuredproducts.php' => 1, | |
| 'ps_emailsubscription.php' => 1, | |
| 'ps_customtext.php' => 1, | |
| 'productcommentscriterion.php' => 1, | |
| 'ps_customersignin.tpl' => 1, | |
| 'ps_customersignin.php' => 1, | |
| 'ps_contactinfo.tpl' => 1, | |
| 'ps_contactinfo.php' => 1, | |
| 'ps_contactinfo-rich.tpl' => 1, | |
| 'ps_categorytree.php' => 1, | |
| 'ps_banner.tpl' => 1, | |
| 'ps_banner.php' => 1, | |
| 'producttooltip.php' => 1, | |
| 'productscategory.php' => 1, | |
| 'productpaymentlogos.php' => 1, | |
| 'tab.tpl' => 1, | |
| 'products-comparison.tpl' => 1, | |
| 'favoriteproducts-ajax.php' => 1, | |
| 'favoriteproduct.php' => 1, | |
| 'blockrss.php' => 1, | |
| 'blockstore.tpl' => 1, | |
| 'blockviewed.css' => 1, | |
| 'blockuserinfo.tpl' => 1, | |
| 'blockuserinfo.php' => 1, | |
| 'blockuserinfo.css' => 1, | |
| 'blocktopmenu.tpl' => 1, | |
| 'blocktopmenu.php' => 1, | |
| 'blocktags.tpl' => 1, | |
| 'blocktags.php' => 1, | |
| 'blocktags.css' => 1, | |
| 'blocksupplier.tpl' => 1, | |
| 'blocksupplier.php' => 1, | |
| 'store.jpg' => 1, | |
| 'blockstore.php' => 1, | |
| 'blockviewed.tpl' => 1, | |
| 'blockspecials.php' => 1, | |
| 'blocksocial.tpl' => 1, | |
| 'blocksocial.php' => 1, | |
| 'blocksocial.jpg' => 1, | |
| 'blocksharefb.tpl' => 1, | |
| 'blocksharefb.php' => 1, | |
| 'blocksearch.tpl' => 1, | |
| 'blocksearch.php' => 1, | |
| 'blocksearch.js' => 1, | |
| 'blocksearch.css' => 1, | |
| 'blocksearch-top.tpl' => 1, | |
| 'blocksearch-instantsearch.tpl' => 1, | |
| 'blockrss.tpl' => 1, | |
| 'blockviewed.php' => 1, | |
| 'blockwishlist-ajax.tpl' => 1, | |
| 'editorial.tpl' => 1, | |
| 'cheque.jpg' => 1, | |
| 'editorial.php' => 1, | |
| 'editorialclass.php' => 1, | |
| 'orderdetail.tpl' => 1, | |
| 'dateofdelivery.php' => 1, | |
| 'beforecarrier.tpl' => 1, | |
| 'dashtrends.php' => 1, | |
| 'dashproducts.php' => 1, | |
| 'dashgoals.php' => 1, | |
| 'gapi-logo.gif' => 1, | |
| 'dashactivity.php' => 1, | |
| 'crossselling.php' => 1, | |
| 'contactform.php' => 1, | |
| 'cashondelivery.php' => 1, | |
| 'blockwishlist-extra.tpl' => 1, | |
| 'cashondelivery.jpg' => 1, | |
| 'cashondelivery.gif' => 1, | |
| 'carriercompare.php' => 1, | |
| 'carriercompare.js' => 1, | |
| 'sendwishlist.php' => 1, | |
| 'my-account.tpl' => 1, | |
| 'managewishlist.php' => 1, | |
| 'buywishlistproduct.php' => 1, | |
| 'blockwishlist_top.tpl' => 1, | |
| 'blockwishlist_button.tpl' => 1, | |
| 'blockwishlist.tpl' => 1, | |
| 'blockwishlist.php' => 1, | |
| 'blockwishlist.css' => 1, | |
| 'swagger.json' => 1, | |
| 'playadzquicksetupbundle.php' => 1, | |
| 'referralprogram.php' => 1, | |
| 'padam87knockoutjsbundle.php' => 1, | |
| 'crypter.php' => 1, | |
| 'pandafirecorebundle.php' => 1, | |
| 'clonerinterface.php' => 1, | |
| 'pagomio.php' => 1, | |
| 'pageonaccountingbundle.php' => 1, | |
| 'paellatwitterbootstrapbundle.php' => 1, | |
| 'padam87searchbundle.php' => 1, | |
| 'rasterizer.php' => 1, | |
| 'padam87rasterizebundle.php' => 1, | |
| 'tempdir.php' => 1, | |
| 'configurationawaretrait.php' => 1, | |
| 'padam87modulebundle.php' => 1, | |
| 'padam87doctrinecacheinvalidatorbundle.php' => 1, | |
| 'encryptableiteminterface.php' => 1, | |
| 'padam87cronbundle.php' => 1, | |
| 'padam87billingobundle.php' => 1, | |
| 'padam87addressbundle.php' => 1, | |
| 'lightncandy' => 1, | |
| 'pugxshortiddoctrinebundle.php' => 1, | |
| 'bigquery' => 1, | |
| 'pugxi18nbundle.php' => 1, | |
| 'pugxgeoformbundle.php' => 1, | |
| 'pugxgeneratorbundle.php' => 1, | |
| 'pugxextravalidatorbundle.php' => 1, | |
| 'pugxautocompleterbundle.php' => 1, | |
| 'cascade.sublime-project' => 1, | |
| 'crypterinterface.php' => 1, | |
| 'nullcrypter.php' => 1, | |
| 'logincidadaotosbundle.php' => 1, | |
| 'slacklogger.php' => 1, | |
| 'banwiregatewaymethod.php' => 1, | |
| 'banwiregatewaybundle.php' => 1, | |
| 'banwiremethod.php' => 1, | |
| 'banwirebundle.php' => 1, | |
| 'bankwiremethod.php' => 1, | |
| 'bankwirebundle.php' => 1, | |
| 'authorizenetmethod.php' => 1, | |
| 'authorizenetbundle.php' => 1, | |
| 'openpayu_domain.php' => 1, | |
| 'html_helper.php' => 1, | |
| 'urlparserasset.php' => 1, | |
| 'bladebehavior.php' => 1, | |
| 'slackclient.php' => 1, | |
| 'timegenerator.php' => 1, | |
| 'xcopy.php' => 1, | |
| 'img_resize.php' => 1, | |
| 'priceformatter.php' => 1, | |
| 'clib.php' => 1, | |
| 'uploadercontroller.php' => 1, | |
| 'imguploader.php' => 1, | |
| 'parizzcacheextrabundle.php' => 1, | |
| 'parizzcachebundle.php' => 1, | |
| 'lsvpddkapibundle.php' => 1, | |
| 'lsvglsdkapibundle.php' => 1, | |
| 'paytrailgatewayfactory.php' => 1, | |
| 'pandawantechnologyrolevizbundle.php' => 1, | |
| 'timegeneratorinterface.php' => 1, | |
| 'praynocasauthbundle.php' => 1, | |
| 'procergslogincidadaomonitorbundle.php' => 1, | |
| 'dineromailapimethod.php' => 1, | |
| 'o2userbundle.php' => 1, | |
| 'plugin.js' => 1, | |
| 'persist.js' => 1, | |
| 'node.js' => 1, | |
| 'i18n.js' => 1, | |
| 'format.js' => 1, | |
| 'debug.js' => 1, | |
| 'arsenic.php' => 1, | |
| 'ppm.php' => 1, | |
| 'epitwitter.php' => 1, | |
| 'episequence.php' => 1, | |
| 'epioauth.php' => 1, | |
| 'epicurl.php' => 1, | |
| 'o2uibundle.php' => 1, | |
| 'string.js' => 1, | |
| 'o2modelbundle.php' => 1, | |
| 'thematicspeech.php' => 1, | |
| 'enseparhtml2pdfbundle.php' => 1, | |
| 'withingsbundle.php' => 1, | |
| 'oryzoneoauthbundle.php' => 1, | |
| 'oryzonemediastoragebundle.php' => 1, | |
| 'oryzoneimagevalidatorbundle.php' => 1, | |
| 'oryzoneimageresizerbundle.php' => 1, | |
| 'oryzoneboilerplatebundle.php' => 1, | |
| 'orkestrowebbundle.php' => 1, | |
| 'orkestrocountrybundle.php' => 1, | |
| 'orkestrocorebundle.php' => 1, | |
| 'orimgoogleapibundle.php' => 1, | |
| 'state.js' => 1, | |
| 'toolbar.js' => 1, | |
| 'procergslogincidadaoigpbundle.php' => 1, | |
| 'datetimerangesplitter.php' => 1, | |
| 'acmebadgesbundle.php' => 1, | |
| 'logincidadaobadgesbundle.php' => 1, | |
| 'pqstudiorestutilitybundle.php' => 1, | |
| 'pqstudioratelimitbundle.php' => 1, | |
| 'vk_exception.php' => 1, | |
| 'firstfriday.php' => 1, | |
| 'database.sqlite' => 1, | |
| 'addadmin.php' => 1, | |
| 'phppdo.php' => 1, | |
| 'pdostatementabstract.php' => 1, | |
| 'pdoexception.php' => 1, | |
| 'pdoabstract.php' => 1, | |
| 'datetimerange.php' => 1, | |
| 'types.js' => 1, | |
| 'cachebundle.php' => 1, | |
| 'phpfastcgispeedfonybundle.php' => 1, | |
| 'runfromweb.php' => 1, | |
| 'phpcheckstyle.sh' => 1, | |
| 'phpcheckstyle.cmd' => 1, | |
| '.anorak.yml' => 1, | |
| 'database_pgsql.sql' => 1, | |
| 'wasp' => 1, | |
| 'profiles.php' => 1, | |
| 'stash.png' => 1, | |
| 'perbilitybcryptbundle.php' => 1, | |
| 'pbxg33kvocadbbundle.php' => 1, | |
| 'treetable.jquery.json' => 1, | |
| 'dineromailapibundle.php' => 1, | |
| 'dineromailbundle.php' => 1, | |
| 'platzengysasseticremoveloggingbundle.php' => 1, | |
| 'asesfeedbackcommand.php' => 1, | |
| 'form-protector.js' => 1, | |
| 'slyurlshortenerbundle.php' => 1, | |
| 'slypushoverbundle.php' => 1, | |
| 'slyfrancoisbundle.php' => 1, | |
| 'tinymce_toolbar.png' => 1, | |
| 'pco-kint.php' => 1, | |
| 'pco-image-widget-field.php' => 1, | |
| 'codesniffer.xml' => 1, | |
| 'wreaths' => 1, | |
| 'hawkstyles.css' => 1, | |
| '.env_example' => 1, | |
| 'asesfeedbackhandler.php' => 1, | |
| 'asesfeedback.php' => 1, | |
| 'phing' => 1, | |
| 'imageresizer.php' => 1, | |
| 'visitorinfo.php' => 1, | |
| 'visitorfilter.php' => 1, | |
| 'updatecommand.php' => 1, | |
| 'peerjmpdfbundle.php' => 1, | |
| 'peerjusersecuritybundle.php' => 1, | |
| 'run-tests-with-coverage.sh' => 1, | |
| 'init.environment.php' => 1, | |
| 'public-routes.php' => 1, | |
| 'init.example.php' => 1, | |
| 'markdowntest.php' => 1, | |
| 'checker_bootstrap.php' => 1, | |
| 'phpaint.php' => 1, | |
| 'default_config.php' => 1, | |
| 'index.textile' => 1, | |
| 'currencytest.php' => 1, | |
| 'testguy.php' => 1, | |
| 'multidatespickerasset.php' => 1, | |
| 'multidatespicker.php' => 1, | |
| 'datespickerasset.php' => 1, | |
| 'datespicker.php' => 1, | |
| 'datesasset.php' => 1, | |
| 'collapsemenu.php' => 1, | |
| 'adminmenu.php' => 1, | |
| 'activeviewbutton.php' => 1, | |
| 'activetoolbarbutton.php' => 1, | |
| 'activeformbutton.php' => 1, | |
| 'composer.l' => 1, | |
| 'pipin' => 1, | |
| 'scenario.php' => 1, | |
| 'index.lex' => 1, | |
| 'codeguy.php' => 1, | |
| 'phpantom.php' => 1, | |
| 'phpantom' => 1, | |
| 'composer-extension.phar' => 1, | |
| 'htmlrenderer.php' => 1, | |
| 'test.file' => 1, | |
| 'phosprdoubleentrybundle.php' => 1, | |
| 'phosprcorebundle.php' => 1, | |
| 'workflow.png' => 1, | |
| 'rabbitmqsupervisorbundle.php' => 1, | |
| 'phobetorbillomatbundle.php' => 1, | |
| 'yml-example.php' => 1, | |
| 'i18n.class.php' => 1, | |
| 'circle-tests.yml' => 1, | |
| 'stripejsgatewayfactory.php' => 1, | |
| 'dineromailmethod.php' => 1, | |
| 'visanetmethod.php' => 1, | |
| 'redsysmethod.php' => 1, | |
| 'redsysbundle.php' => 1, | |
| 'paypalwebcheckoutmethod.php' => 1, | |
| 'paypalwebcheckoutemptymethod.php' => 1, | |
| 'paypalwebcheckoutbundle.php' => 1, | |
| 'paypalexpresscheckoutmethod.php' => 1, | |
| 'paypalexpresscheckoutbundle.php' => 1, | |
| 'paymillmethod.php' => 1, | |
| 'paymillbundle.php' => 1, | |
| 'paymentmethodinterface.php' => 1, | |
| 'paymentcoreevents.php' => 1, | |
| 'paymentcorebundle.php' => 1, | |
| 'payutransactiontypes.php' => 1, | |
| 'safetypaymethod.php' => 1, | |
| 'payurequesttypes.php' => 1, | |
| 'payumethod.php' => 1, | |
| 'payudetailstypes.php' => 1, | |
| 'payuadditionalvaluetypes.php' => 1, | |
| 'pagosonlinegatewaymethod.php' => 1, | |
| 'pagosonlinegatewaybundle.php' => 1, | |
| 'pagosonlinecommbundle.php' => 1, | |
| 'pagosonlinemethod.php' => 1, | |
| 'pagosonlinebundle.php' => 1, | |
| 'googlewalletmethod.php' => 1, | |
| 'googlewalletbundle.php' => 1, | |
| 'freepaymentmethod.php' => 1, | |
| 'freepaymentbundle.php' => 1, | |
| 'safetypaybundle.php' => 1, | |
| 'stripebundle.php' => 1, | |
| 'stripedirectgatewayfactory.php' => 1, | |
| 'payumbuilder.php' => 1, | |
| 'stripecheckoutgatewayfactory.php' => 1, | |
| 'sofortgatewayfactory.php' => 1, | |
| 'skeletongatewayfactory.php' => 1, | |
| 'payumbundle.php' => 1, | |
| 'paypalrestgatewayfactory.php' => 1, | |
| 'paypalprocheckoutgatewayfactory.php' => 1, | |
| 'paypalmasspaygatewayfactory.php' => 1, | |
| 'paypalexpresscheckoutgatewayfactory.php' => 1, | |
| 'payexgatewayfactory.php' => 1, | |
| 'offlinegatewayfactory.php' => 1, | |
| 'klarnainvoicegatewayfactory.php' => 1, | |
| 'klarnacheckoutgatewayfactory.php' => 1, | |
| 'payum.php' => 1, | |
| 'stripemethod.php' => 1, | |
| 'gatewayfactoryinterface.php' => 1, | |
| 'gatewayawaretrait.php' => 1, | |
| 'gatewayawareinterface.php' => 1, | |
| 'coregatewayfactory.php' => 1, | |
| 'apiawaretrait.php' => 1, | |
| 'apiawareinterface.php' => 1, | |
| 'be2billoffsitegatewayfactory.php' => 1, | |
| 'be2billdirectgatewayfactory.php' => 1, | |
| 'authorizenetaimgatewayfactory.php' => 1, | |
| 'undefinedkeyinstrictarrayexception.php' => 1, | |
| 'strictarray.php' => 1, | |
| 'webpaymethod.php' => 1, | |
| 'webpaybundle.php' => 1, | |
| 'referralprogram.gif' => 1, | |
| 'securitypatch.php' => 1, | |
| 'abstractnamednode.php' => 1, | |
| 'cookie-banner.php' => 1, | |
| 'rauwekostreleasebundle.php' => 1, | |
| 'rauwekostmonologawsbundle.php' => 1, | |
| 'rattlerhoneypotbundle.php' => 1, | |
| 'update-blocker.php' => 1, | |
| 'toolbar-theme-switcher.php' => 1, | |
| 'class-locate-vendor.php' => 1, | |
| 'holder.php' => 1, | |
| 'fragment-cache.php' => 1, | |
| 'error-log-dashboard-widget.php' => 1, | |
| 'class-r-hook-handler.php' => 1, | |
| 'advanced-hooks-api.php' => 1, | |
| 'rare-font-fout.php' => 1, | |
| 'generate_metrics.sh' => 1, | |
| 'release.yml.dist' => 1, | |
| 'raptekregonbundle.php' => 1, | |
| 'sf2genconsolelistener.php' => 1, | |
| 'sf2genconsolebundle.php' => 1, | |
| 'raphymarkdownbundle.php' => 1, | |
| 'raphyepitechuserbundle.php' => 1, | |
| 'samurai' => 1, | |
| '.samurai.json' => 1, | |
| 'puppy' => 1, | |
| 'thrift.php' => 1, | |
| 'tania_serrano.sql' => 1, | |
| 'application.raid' => 1, | |
| 'autoload.gradle' => 1, | |
| 'deploy.yml.dist' => 1, | |
| 'version.yml.dist' => 1, | |
| 'apiserver-test.php' => 1, | |
| 'azubuapi.php' => 1, | |
| 'example.phtml' => 1, | |
| 'renton56paginatorbundle.php' => 1, | |
| 'rjemailbundle.php' => 1, | |
| 'google-translate.gemspec' => 1, | |
| '.rvmrc' => 1, | |
| 'remguserbundle.php' => 1, | |
| 'remgpagebundle.php' => 1, | |
| 'remgmessagebundle.php' => 1, | |
| 'remggeneratorbundle.php' => 1, | |
| 'remgfrontendbundle.php' => 1, | |
| 'remgbackendbundle.php' => 1, | |
| 'ogravatar.php' => 1, | |
| 'sharescounter.php' => 1, | |
| 'rauwekostschedulebundle.php' => 1, | |
| 'scrypt130302pitcairnglg2tc8192w256l8.bin' => 1, | |
| 'regelwerkignorebotswiftmailerhandlerbundle.php' => 1, | |
| 'pscss' => 1, | |
| 'rdirsimplearraybundle.php' => 1, | |
| 'redexpertserrbitbundle.php' => 1, | |
| 'platesslimextension.php' => 1, | |
| 'platesmailtoextension.php' => 1, | |
| 'rravenmenuannotationsbundle.php' => 1, | |
| 'igbinary.php' => 1, | |
| 'eassetmanager.php' => 1, | |
| 'yiimailer.php' => 1, | |
| 'style_guide' => 1, | |
| 'liw.php' => 1, | |
| 'pdfcrowd.php' => 1, | |
| 'ec2ssh-worker' => 1, | |
| 'travis-coverage.php' => 1, | |
| 'context.go' => 1, | |
| 'staticroute.go' => 1, | |
| 'router_test.go' => 1, | |
| 'router.go' => 1, | |
| 'route_test.go' => 1, | |
| 'route.go' => 1, | |
| 'response_test.go' => 1, | |
| 'response.go' => 1, | |
| 'request_test.go' => 1, | |
| 'request.go' => 1, | |
| 'regexroute.go' => 1, | |
| 'middleware.go' => 1, | |
| 'context_test.go' => 1, | |
| 'comptage' => 1, | |
| 'defaultrequest_test.go' => 1, | |
| 'cadastre_type' => 1, | |
| 'bano-974.csv' => 1, | |
| 'bano-973.csv' => 1, | |
| 'bano-972.csv' => 1, | |
| 'bano-971.csv' => 1, | |
| 'bano-95.csv' => 1, | |
| 'bano-94.csv' => 1, | |
| 'bano-93.csv' => 1, | |
| 'bano-92.csv' => 1, | |
| 'bano-91.csv' => 1, | |
| 'bano-90.csv' => 1, | |
| 'bano-89.csv' => 1, | |
| 'bano-88.csv' => 1, | |
| 'defaultrequest.go' => 1, | |
| 'defaultresponse.go' => 1, | |
| 'ec2ssh' => 1, | |
| 'rncryptor-spec-v2' => 1, | |
| 'radiocerosbitidbundle.php' => 1, | |
| 'rwsoftexcelbundle.php' => 1, | |
| 'excelresponse.php' => 1, | |
| 'helper.css' => 1, | |
| 'yamlconfigbundle.php' => 1, | |
| 'vichimaginebundle.php' => 1, | |
| 'uploadbundle.php' => 1, | |
| 'ipinfobundle.php' => 1, | |
| 'itfadminbundle.php' => 1, | |
| 'homestead.yaml' => 1, | |
| 'draft-rncryptor-spec-v4.0' => 1, | |
| 'rncryptor-spec-v3' => 1, | |
| 'torrentapi.php' => 1, | |
| 'defaultresponse_test.go' => 1, | |
| 'api_documentation.pdf' => 1, | |
| 'googleapilibrary.php' => 1, | |
| 'slitslidermodule.php' => 1, | |
| 'manualwidget.php' => 1, | |
| 'manualimageaction.php' => 1, | |
| 'googlecalendarwidget.php' => 1, | |
| 'googlemapapi.php' => 1, | |
| 'propeltranslationbundle.php' => 1, | |
| 'pelau_suite_test.go' => 1, | |
| 'pelau.go' => 1, | |
| 'mime.go' => 1, | |
| 'defaultrouter_test.go' => 1, | |
| 'defaultrouter.go' => 1, | |
| 'quickpay.php' => 1, | |
| 'requestlabestatbundle.php' => 1, | |
| 'bano-86.csv' => 1, | |
| 'redactor.php' => 1, | |
| 'filearray.php' => 1, | |
| 'symfonybundleinstallerplugin.php' => 1, | |
| 'symfonybundleinstaller.php' => 1, | |
| 'servicesloader.php' => 1, | |
| 'scannerfactory.php' => 1, | |
| 'projectscanner.php' => 1, | |
| 'magicinjectionbundle.php' => 1, | |
| 'yamldeserializationvisitor.php' => 1, | |
| 'datetimehandler.php' => 1, | |
| 'abstractyamldeserializationhandler.php' => 1, | |
| 'jmsdeyamlbundle.php' => 1, | |
| 'elasticaentitymappingbundle.php' => 1, | |
| 'config.global.php' => 1, | |
| 'sipmultipleuploadbundle.php' => 1, | |
| 'priv.key' => 1, | |
| 'roles' => 1, | |
| 'syntaxhighlighter mit license' => 1, | |
| 'diem permissions' => 1, | |
| 'prove' => 1, | |
| 'ruhrtalnetmenubundle.php' => 1, | |
| 'gravatar-proxy.php' => 1, | |
| 'modifier.noscheme.php' => 1, | |
| 'rtmpdump' => 1, | |
| 'rtxlabsliquibasebundle.php' => 1, | |
| 'phppoker' => 1, | |
| 'gestion_framework.sql' => 1, | |
| 'rootaccezbasicbundle.php' => 1, | |
| 'siplocationpickerbundle.php' => 1, | |
| 'sipadmintreebundle.php' => 1, | |
| '.ac-php-conf.json' => 1, | |
| 'symbioorangegatetimelinebundle.php' => 1, | |
| 'abstractliteral.php' => 1, | |
| 'abstractblanknode.php' => 1, | |
| 'querycache.php' => 1, | |
| 'serializerfactoryimpl.php' => 1, | |
| 'serializerfactory.php' => 1, | |
| 'serializationutils.php' => 1, | |
| 'parserfactory.php' => 1, | |
| 'nquadsserializerimpl.php' => 1, | |
| 'pxcorepaylinebundle.php' => 1, | |
| 'pxcorelibreofficeconverterbundle.php' => 1, | |
| 'symbioorangegateuserbundle.php' => 1, | |
| 'symbioorangegatetranslationbundle.php' => 1, | |
| 'symbioorangegatesearchbundle.php' => 1, | |
| 'sipdynamicconnectionbundle.php' => 1, | |
| 'symbioorangegatepagebundle.php' => 1, | |
| 'symbioorangegatenewsbundle.php' => 1, | |
| 'symbioorangegatemediabundle.php' => 1, | |
| 'symbioorangegatedoctrineormadminbundle.php' => 1, | |
| 'symbioorangegateclassificationbundle.php' => 1, | |
| 'symbioorangegateanalyticsbundle.php' => 1, | |
| 'symbioorangegateadminbundle.php' => 1, | |
| 'symbiofulltextsearchbundle.php' => 1, | |
| 'stiwlpagebundle.php' => 1, | |
| 'siptagbundle.php' => 1, | |
| 'siptranslationbundle.php' => 1, | |
| 'siptextbundle.php' => 1, | |
| 'sipnewsbundle.php' => 1, | |
| 'rootaccezodeskapibundle.php' => 1, | |
| 'watch.list' => 1, | |
| 'requestlabvimeobundle.php' => 1, | |
| 'cacheablebehaviorbundle.php' => 1, | |
| 'bamboo-example.png' => 1, | |
| 'fix-cs.sh' => 1, | |
| 'demo-config.yml' => 1, | |
| 'example-manual.php' => 1, | |
| 'configure.sample.json' => 1, | |
| 'tagcachetime.php' => 1, | |
| 'tagcacheobj.php' => 1, | |
| 'img-nocache.jpg' => 1, | |
| 'img-cached.jpg' => 1, | |
| 'tagcachecacheclearer.php' => 1, | |
| 'tagcachebundle.php' => 1, | |
| 'cacheablebehaviorfactory.php' => 1, | |
| 'itemfactory.php' => 1, | |
| 'phantomserver.js' => 1, | |
| 'itemcollectionfactory.php' => 1, | |
| 'itemcollection.php' => 1, | |
| 'itemallower.php' => 1, | |
| 'criteriabuilder.php' => 1, | |
| 'monexy.php' => 1, | |
| 'alphasms.php' => 1, | |
| 'exchanger.php' => 1, | |
| 'saasapiresourcemap' => 1, | |
| 'buttondropdownsorter.php' => 1, | |
| 'restapigeneratorbundle.php' => 1, | |
| 'respectvalidationbundle.php' => 1, | |
| 'rnkelfinderbundle.php' => 1, | |
| 'requestlabxitianalyticsbundle.php' => 1, | |
| 'filler.yml.dist' => 1, | |
| 'rjmcommentbundle.php' => 1, | |
| 'chosenbootstrapasset.php' => 1, | |
| 'ss3.jpg' => 1, | |
| 'roheaopenxintegrationbundle.php' => 1, | |
| 's2protocol' => 1, | |
| 'corezerobundle.php' => 1, | |
| 'settings.example.yml' => 1, | |
| 'parentchildtree.php' => 1, | |
| 'i18ntoolbar.php' => 1, | |
| 'treetable.php' => 1, | |
| 'term.php' => 1, | |
| 'taxonomytrait.php' => 1, | |
| 'rbrssbundle.php' => 1, | |
| 'rvdvdisqusbundle.php' => 1, | |
| 'example-output' => 1, | |
| 'ss2.jpg' => 1, | |
| 'rjmgenemusandboxbundle.php' => 1, | |
| 'ss1.jpg' => 1, | |
| 'docgen.json' => 1, | |
| 'reflectionmethod.php' => 1, | |
| 'reflectioninterface.php' => 1, | |
| 'docblock.php' => 1, | |
| 'use_native_gettext_function.php' => 1, | |
| 'use_class_gettext_function.php' => 1, | |
| 'gettextvars.php' => 1, | |
| 'gettextreader.php' => 1, | |
| 'multifactorauthforeveryone.png' => 1, | |
| 'twofactorauth.sln' => 1, | |
| 'twofactorauth.phpproj' => 1, | |
| 'rjmmaxmindbundle.php' => 1, | |
| 'bano-87.csv' => 1, | |
| 'bano-85.csv' => 1, | |
| 'sekeywords.php' => 1, | |
| 'smwfileprotect.php' => 1, | |
| 'smwuserprotect.classes.php' => 1, | |
| 'smwparent.php' => 1, | |
| 'smwparent.iterate.php' => 1, | |
| 'smwparent.i18n.php' => 1, | |
| 'smwparent.i18n.magic.php' => 1, | |
| 'smwparent.classes.php' => 1, | |
| 'smwlistprops.php' => 1, | |
| 'smwlistprops.i18n.php' => 1, | |
| 'smwlistprops.i18n.magic.php' => 1, | |
| 'smwlistprops.classes.php' => 1, | |
| 'smwnsprotect_body.php' => 1, | |
| 'smwfileprotect_body.php' => 1, | |
| 'formlink.php' => 1, | |
| 'smwuserprotect.php' => 1, | |
| 'emailobfuscator.js' => 1, | |
| 'laravel4.phpunit.xml' => 1, | |
| 'cmsadminbundle.php' => 1, | |
| 'entitystore' => 1, | |
| 'default-config.json' => 1, | |
| 'liscence' => 1, | |
| 'pkroundcolor.php' => 1, | |
| 'pkcolor.php' => 1, | |
| 'ps-forms.php' => 1, | |
| 'class-ps-forms.php' => 1, | |
| 'class-ps-forms-table.php' => 1, | |
| 'class-ps-forms-admin.php' => 1, | |
| 'smwuserprotect.i18n.php' => 1, | |
| 'semanticformsmultiedit.php' => 1, | |
| 'padoctrineenumbundle.php' => 1, | |
| 'sha1hashgenerator.php' => 1, | |
| '.coverals.yml' => 1, | |
| 'pulpcache.php' => 1, | |
| 'pulpmediaserializedresponsebundle.php' => 1, | |
| 'pulpmedianghttpbundle.php' => 1, | |
| 'pulpmediap3pcookiebundle.php' => 1, | |
| 'radiobuttonmatrix.php' => 1, | |
| 'webtestcaseinterface.php' => 1, | |
| 'extensiontestcase.php' => 1, | |
| 'databasewebtestcase.php' => 1, | |
| 'databasetestcase.php' => 1, | |
| 'containerawaretestcase.php' => 1, | |
| 'consolecommandtestcase.php' => 1, | |
| 'md5hashgenerator.php' => 1, | |
| 'test.tpl' => 1, | |
| 'customalphabetcodegenerator.php' => 1, | |
| 'codegeneratorinterface.php' => 1, | |
| 'publeroapinotificationbundle.php' => 1, | |
| 'publerotokenauthenticationevents.php' => 1, | |
| 'publerotokenauthenticationbundle.php' => 1, | |
| 'publerotemplatemailerbundle.php' => 1, | |
| 'publeroapplemobilebundle.php' => 1, | |
| 'publerofilebundle.php' => 1, | |
| 'psycle-mail.php' => 1, | |
| 'psycle-mail.class.php' => 1, | |
| 'psycle-pii-scrub.php' => 1, | |
| 'class-pii-scrub.php' => 1, | |
| 'proxiwebpersonabundle.php' => 1, | |
| 'uri.lib.php' => 1, | |
| 'programmingarehardresourcebundle.php' => 1, | |
| 'loggly.php' => 1, | |
| 'statsbestvouchers.php' => 1, | |
| 'statspersonalinfos.php' => 1, | |
| 'statsorigin.php' => 1, | |
| 'statsnewsletter.php' => 1, | |
| 'statslive.php' => 1, | |
| 'statsforecast.php' => 1, | |
| 'next.png' => 1, | |
| 'funnel.png' => 1, | |
| 'statsequipment.php' => 1, | |
| 'statsdata.php' => 1, | |
| 'statscheckup.php' => 1, | |
| 'statscatalog.php' => 1, | |
| 'statscarrier.php' => 1, | |
| 'statsbestsuppliers.php' => 1, | |
| 'statsregistrations.php' => 1, | |
| 'statsbestproducts.php' => 1, | |
| 'statsbestmanufacturers.php' => 1, | |
| 'statsbestcustomers.php' => 1, | |
| 'statsbestcategories.php' => 1, | |
| 'socialsharing.php' => 1, | |
| 'sendtoafriend_ajax.php' => 1, | |
| 'sendtoafriend.tpl' => 1, | |
| 'sendtoafriend.png' => 1, | |
| 'sendtoafriend.php' => 1, | |
| 'sendtoafriend.js' => 1, | |
| 'sendtoafriend.css' => 1, | |
| 'sendtoafriend-extra.tpl' => 1, | |
| 'product_page.tpl' => 1, | |
| 'statsproduct.php' => 1, | |
| 'statssales.php' => 1, | |
| 'phar_stub.php' => 1, | |
| 'prims47translatebundle.php' => 1, | |
| 'tested.html' => 1, | |
| 'hypersafe.php' => 1, | |
| 'laravel.php' => 1, | |
| 'htmlki.php' => 1, | |
| 'smile.png' => 1, | |
| 'feeder.php' => 1, | |
| 'example-object.php' => 1, | |
| 'example-chain.php' => 1, | |
| 'example-array.php' => 1, | |
| 'chained.php' => 1, | |
| 'datefmt.php' => 1, | |
| 'certificationycertybundle.php' => 1, | |
| 'prims47paypalexpresscheckoutnvpbundle.php' => 1, | |
| 'statssearch.php' => 1, | |
| 'primenavigationbundle.php' => 1, | |
| 'prezenttranslationbundle.php' => 1, | |
| 'prezentgridbundle.php' => 1, | |
| 'prezentdompdfbundle.php' => 1, | |
| 'prezentdoctrinetranslatablebundle.php' => 1, | |
| 'watermark.php' => 1, | |
| 'watermark.gif' => 1, | |
| 'vatnumber.php' => 1, | |
| 'vatnumbertaxmanager.php' => 1, | |
| 'trackingfront.php' => 1, | |
| 'themeconfigurator.php' => 1, | |
| 'statsvisits.php' => 1, | |
| 'statsstock.php' => 1, | |
| 'boot_laravel.php' => 1, | |
| 'herokugeneratorcontroller.php' => 1, | |
| 'bano-84.csv' => 1, | |
| 'bano-40.csv' => 1, | |
| 'bano-52.csv' => 1, | |
| 'bano-51.csv' => 1, | |
| 'bano-50.csv' => 1, | |
| 'bano-49.csv' => 1, | |
| 'bano-48.csv' => 1, | |
| 'bano-47.csv' => 1, | |
| 'bano-46.csv' => 1, | |
| 'bano-45.csv' => 1, | |
| 'bano-44.csv' => 1, | |
| 'bano-43.csv' => 1, | |
| 'bano-42.csv' => 1, | |
| 'bano-41.csv' => 1, | |
| 'bano-39.csv' => 1, | |
| 'bano-54.csv' => 1, | |
| 'bano-38.csv' => 1, | |
| 'bano-37.csv' => 1, | |
| 'bano-36.csv' => 1, | |
| 'bano-35.csv' => 1, | |
| 'bano-34.csv' => 1, | |
| 'bano-33.csv' => 1, | |
| 'bano-32.csv' => 1, | |
| 'bano-31.csv' => 1, | |
| 'bano-30.csv' => 1, | |
| 'bano-2b.csv' => 1, | |
| 'bano-2a.csv' => 1, | |
| 'bano-29.csv' => 1, | |
| 'bano-28.csv' => 1, | |
| 'bano-53.csv' => 1, | |
| 'bano-55.csv' => 1, | |
| 'bano-26.csv' => 1, | |
| 'bano-71.csv' => 1, | |
| 'bano-83.csv' => 1, | |
| 'bano-82.csv' => 1, | |
| 'bano-81.csv' => 1, | |
| 'bano-80.csv' => 1, | |
| 'bano-79.csv' => 1, | |
| 'bano-78.csv' => 1, | |
| 'bano-77.csv' => 1, | |
| 'bano-76.csv' => 1, | |
| 'bano-75.csv' => 1, | |
| 'bano-74.csv' => 1, | |
| 'bano-73.csv' => 1, | |
| 'bano-72.csv' => 1, | |
| 'bano-70.csv' => 1, | |
| 'bano-56.csv' => 1, | |
| 'bano-69.csv' => 1, | |
| 'bano-68.csv' => 1, | |
| 'bano-67.csv' => 1, | |
| 'bano-66.csv' => 1, | |
| 'bano-65.csv' => 1, | |
| 'bano-64.csv' => 1, | |
| 'bano-63.csv' => 1, | |
| 'bano-62.csv' => 1, | |
| 'bano-61.csv' => 1, | |
| 'bano-60.csv' => 1, | |
| 'bano-59.csv' => 1, | |
| 'bano-58.csv' => 1, | |
| 'bano-57.csv' => 1, | |
| 'bano-27.csv' => 1, | |
| 'bano-25.csv' => 1, | |
| 'check_psr.sh' => 1, | |
| 'dataservice.php' => 1, | |
| 'sourcertrait.php' => 1, | |
| 'sourcerinterface.php' => 1, | |
| 'sourceabletrait.php' => 1, | |
| 'sourceableinterface.php' => 1, | |
| 'qualitypressstaticcontentbundle.php' => 1, | |
| 'qualitypresssocialmediabundle.php' => 1, | |
| 'qualitycurrencyconverterbundle.php' => 1, | |
| 'qualitypressbreadcrumbsbundle.php' => 1, | |
| 'requestadapter.php' => 1, | |
| 'operationcontextadapter.php' => 1, | |
| 'odataurlrule.php' => 1, | |
| 'queryprovider.php' => 1, | |
| 'basequeryprovider.php' => 1, | |
| 'listingfilter.php' => 1, | |
| 'baseentity.php' => 1, | |
| 'basedataservice.php' => 1, | |
| 'qcumbeerbreadcrumbsbundle.php' => 1, | |
| 'shops.dist.json' => 1, | |
| 'ee7.php' => 1, | |
| 'ee.php' => 1, | |
| 'qbttranslationbundle.php' => 1, | |
| 'qbankapi.php' => 1, | |
| 'credentials.php' => 1, | |
| 'cachepolicy.php' => 1, | |
| 'radiohitsbundle.php' => 1, | |
| 'deejaypoolbundle.php' => 1, | |
| 'deejayfilesorganizerbundle.php' => 1, | |
| 'websitebundle.php' => 1, | |
| 'uploadmodel.php' => 1, | |
| 'bano-24.csv' => 1, | |
| 'bano-10.csv' => 1, | |
| 'bano-23.csv' => 1, | |
| 'bano-22.csv' => 1, | |
| 'bano-21.csv' => 1, | |
| 'bano-19.csv' => 1, | |
| 'bano-18.csv' => 1, | |
| 'bano-17.csv' => 1, | |
| 'bano-16.csv' => 1, | |
| 'bano-15.csv' => 1, | |
| 'bano-14.csv' => 1, | |
| 'bano-13.csv' => 1, | |
| 'bano-12.csv' => 1, | |
| 'bano-11.csv' => 1, | |
| 'bano-09.csv' => 1, | |
| 'qbrepobundle.php' => 1, | |
| 'bano-08.csv' => 1, | |
| 'bano-07.csv' => 1, | |
| 'bano-06.csv' => 1, | |
| 'bano-05.csv' => 1, | |
| 'bano-04.csv' => 1, | |
| 'bano-03.csv' => 1, | |
| 'bano-02.csv' => 1, | |
| 'bano-01.csv' => 1, | |
| '1_statistiques_rapprochement_voirie' => 1, | |
| 'searchresultproviderfactory.php' => 1, | |
| 'searchresultprovider.php' => 1, | |
| 'searchresultfilter.php' => 1, | |
| 'searchprovider.php' => 1, | |
| 'autoload_test_register.php' => 1, | |
| 'csconfig.php_cs' => 1, | |
| 'oreadespaymentpayplugbundle.php' => 1, | |
| 'analystsconfigurator.example.php' => 1, | |
| 'docomo.php' => 1, | |
| 'deployer.yml' => 1, | |
| 'couchreplicator.php' => 1, | |
| 'couchdocument.php' => 1, | |
| 'couchclient.php' => 1, | |
| 'couchadmin.php' => 1, | |
| 'couch.php' => 1, | |
| 'classmap-generator.sh' => 1, | |
| 'ioccontainer.php' => 1, | |
| 'anna.php' => 1, | |
| 'anna.bat' => 1, | |
| 'anna' => 1, | |
| 'payu.php' => 1, | |
| 'loggly-new-input.png' => 1, | |
| 'mysql-connector-license' => 1, | |
| 'mysql-connector-java-5.1.18-bin.jar' => 1, | |
| 'aniscommercebundle.php' => 1, | |
| 'uploadcropimagebundle.php' => 1, | |
| 'animedb' => 1, | |
| 'pandoradoctrinegeneratorbundle.php' => 1, | |
| 'include_file_template.php' => 1, | |
| 'cake.php' => 1, | |
| 'envswitcher.php' => 1, | |
| 'model' => 1, | |
| 'standards.xml' => 1, | |
| 'easygit.php' => 1, | |
| 'create-tables.sql' => 1, | |
| 'loggly-shell.png' => 1, | |
| 'create-language-detector' => 1, | |
| 'upgrade-2.0.2' => 1, | |
| 'wp-libre-form.php' => 1, | |
| 'woocommerce-clean-orphaned-variations.php' => 1, | |
| 'pusher.sublime-project' => 1, | |
| 'antqaajaxautocompletebundle.php' => 1, | |
| 'gate.php' => 1, | |
| 'amocrm.php' => 1, | |
| 'vkapi.php' => 1, | |
| 'antkowiakvalidationbundle.php' => 1, | |
| 'readme_pl' => 1, | |
| 'mongodbmigrationsbundle.php' => 1, | |
| 'upgrade-2.0.4' => 1, | |
| 'upgrade-2.0.3' => 1, | |
| 'upgrade-2.0.1' => 1, | |
| 'ansuserbundle.php' => 1, | |
| 'rules.mk' => 1, | |
| 'afs_version.php' => 1, | |
| 'afs_lib.php' => 1, | |
| 'afs_lib.doxygen' => 1, | |
| 'dlr' => 1, | |
| 'arvblogservices.php' => 1, | |
| 'arvblogroles.php' => 1, | |
| 'arvblogparameters.php' => 1, | |
| 'arvblogbundle.php' => 1, | |
| 'afdonttranslatebundle.php' => 1, | |
| 'patchwork.php' => 1, | |
| 'generate-phar.php' => 1, | |
| 'antaresaccessiblebundle.php' => 1, | |
| 'detect-language' => 1, | |
| 'extension-install.sh' => 1, | |
| 'wp-pdf-templates.php' => 1, | |
| 'bubblesoap.class.php' => 1, | |
| 'andresmontanezfragmentcachebundle.php' => 1, | |
| 'wysihtml5.php' => 1, | |
| 'coreimage.php' => 1, | |
| 'yammerstrategy.php' => 1, | |
| 'schematic.phar' => 1, | |
| '.schematic.yaml' => 1, | |
| 'wp-represent-map.php' => 1, | |
| 'cover.jpeg' => 1, | |
| 'bootstrap-phpunit.php' => 1, | |
| 'utilizando_o_composer_no_windows' => 1, | |
| 'exemplo-estados' => 1, | |
| 'exemplo-datas' => 1, | |
| 'ususcryptpasswordencoderbundle.php' => 1, | |
| 'andresmontanezuseragentstringbundle.php' => 1, | |
| 'billabletrait.php' => 1, | |
| 'gravatarpresentertrait.php' => 1, | |
| 'abkquerybundle.php' => 1, | |
| 'phpjunitmerge' => 1, | |
| 'andreasglasernotifybundle.php' => 1, | |
| 'andreasglaserdceventbundle.php' => 1, | |
| 'andreasglaserdoctrinefilebundle.php' => 1, | |
| 'commit-msg' => 1, | |
| 'try_schema_tool.php' => 1, | |
| 'migration-to-2.1' => 1, | |
| 'migration-to-2.0' => 1, | |
| 'htaccess-example' => 1, | |
| 'potatodb.sq3' => 1, | |
| 'andresmontanezrecommendationsbundle.php' => 1, | |
| 'googleurlshortener.php' => 1, | |
| 'acknowledgement' => 1, | |
| 'nooppagerbundle.php' => 1, | |
| 'mhttohtml.php' => 1, | |
| 'gerrie' => 1, | |
| 'license 2' => 1, | |
| '.env.production.php' => 1, | |
| 'simplify.php' => 1, | |
| 'run_webpage.php' => 1, | |
| 'run_servicepage.php' => 1, | |
| 'run_script.php' => 1, | |
| 'run_init.php' => 1, | |
| 'nooptwitterbootstrapbundle.php' => 1, | |
| 'noopstopforumspambundle.php' => 1, | |
| 'noopparserbundle.php' => 1, | |
| 'noopformfieldsbundle.php' => 1, | |
| 'datatrait.php' => 1, | |
| 'attached-post-field-cmb2.php' => 1, | |
| 'contactformwidget.php' => 1, | |
| 'provisioner' => 1, | |
| 'financial' => 1, | |
| 'security_ruleset.xml' => 1, | |
| 'creditcardnumber.php' => 1, | |
| 'creditcardexpiry.php' => 1, | |
| 'creditcardcvcode.php' => 1, | |
| 'creditcardasset.php' => 1, | |
| 'featherlightgalleryasset.php' => 1, | |
| 'featherlightgallery.php' => 1, | |
| 'featherlightasset.php' => 1, | |
| 'featherlight.php' => 1, | |
| 'index-pdf.php' => 1, | |
| 'wp-post-acl.php' => 1, | |
| 'host=localhost:33060;dbname=potato' => 1, | |
| 'aqarmaputilitybundle.php' => 1, | |
| 'arcanacontentbundle.php' => 1, | |
| 'optionelement.php' => 1, | |
| 'errorview.php' => 1, | |
| 'jada' => 1, | |
| 'unittests' => 1, | |
| 'fromgit.php' => 1, | |
| 'ipreserver.php' => 1, | |
| 'cmsdiff.php' => 1, | |
| 'lightframework.sql' => 1, | |
| 'ahomestead' => 1, | |
| 'composer-nette_2.2.json' => 1, | |
| 'thumbnailconfig.php' => 1, | |
| 'multiregionbundle.php' => 1, | |
| 'slotmachineslotbundle.php' => 1, | |
| 'apruve.php' => 1, | |
| 'culabsjquerybundle.php' => 1, | |
| 'culabstestingbundle.php' => 1, | |
| 'culabsilluminatebundle.php' => 1, | |
| 'culabscontactbundle.php' => 1, | |
| 'bugcatch.services.yml' => 1, | |
| 'bugcatch.info.yml' => 1, | |
| 'culabsbugcatchbundle.php' => 1, | |
| 'culabsadminbundle.php' => 1, | |
| 'apresellerclubbundle.php' => 1, | |
| 'testupload.png' => 1, | |
| 'test_add_data.zip' => 1, | |
| 'archerclickatellbundle.php' => 1, | |
| 'schema.solr5.xml' => 1, | |
| 'virtual-host.xml' => 1, | |
| 'armetizfacebookbundle.php' => 1, | |
| 'aygondoctrinemigrationsbundle.php' => 1, | |
| 'aygondatabaseconfigbundle.php' => 1, | |
| 'aygondatalistbundle.php' => 1, | |
| 'albtwigshellbundle.php' => 1, | |
| 'albtwigreflectionbundle.php' => 1, | |
| 'mthamlengine.php' => 1, | |
| 'mthamlbundle.php' => 1, | |
| 'alboauth2serverbundle.php' => 1, | |
| 'repo-stats' => 1, | |
| 'armetizmediabundle.php' => 1, | |
| 'armetizformextensionbundle.php' => 1, | |
| 'facebooksessionpersistence.php' => 1, | |
| 'armazon' => 1, | |
| 'atadminbundle.php' => 1, | |
| 'simple_acf_options.php' => 1, | |
| 'j3telquerybundle.php' => 1, | |
| 'j3telpagerbundle.php' => 1, | |
| 'argentumtranslationbundle.php' => 1, | |
| 'readme.md.example' => 1, | |
| 'yaf.php' => 1, | |
| 'generate_namespaces.php' => 1, | |
| 'v8js.php' => 1, | |
| 'simplecws.php' => 1, | |
| 'oauthparams-dist.php' => 1, | |
| 'morana.sublime-workspace' => 1, | |
| 'atuserbundle.php' => 1, | |
| 'atcmsbundle.php' => 1, | |
| 'sdsidebar.php' => 1, | |
| 'common.win.properties' => 1, | |
| 'apisocialbundle.php' => 1, | |
| 'dryrun.php' => 1, | |
| 'aws-eb-newrelic-deploynotify.sh' => 1, | |
| 'xmllint.sh' => 1, | |
| 'systemstorage_import.sh' => 1, | |
| 'phplint.sh' => 1, | |
| 'opsworks_updateapp.sh' => 1, | |
| 'opsworks_deployment.sh' => 1, | |
| 'apply_patches.sh' => 1, | |
| 'blueprints.example.yml' => 1, | |
| 'locallang_db.php' => 1, | |
| 'class.tx_staticpub_fe.php' => 1, | |
| 'class.tx_staticpub_export.php' => 1, | |
| 'class.tx_staticpub.php' => 1, | |
| 'apply.php' => 1, | |
| 'oraclelogin.php' => 1, | |
| 'scheduler_cron.sh' => 1, | |
| 'lci.php' => 1, | |
| 'api2.php' => 1, | |
| 'logingatebundle.php' => 1, | |
| 'antsocialrestbundle.php' => 1, | |
| 'antphotorestbundle.php' => 1, | |
| 'metadatabundle.php' => 1, | |
| 'helpbundle.php' => 1, | |
| 'antfotobundle.php' => 1, | |
| '.project~' => 1, | |
| 'chateasecurebundle.php' => 1, | |
| 'chateaclientbundle.php' => 1, | |
| 'antbadgebundle.php' => 1, | |
| 'oci8dbconnection.php' => 1, | |
| 'generate-doc.bat' => 1, | |
| 'common.mac.properties' => 1, | |
| 'apoutchikamediabundle.php' => 1, | |
| 'common.linux.properties' => 1, | |
| 'upgrade-1.1.1' => 1, | |
| 'upgrade-1.1.0' => 1, | |
| 'upgrade-1.0.6' => 1, | |
| 'upgrade-1.0.5' => 1, | |
| 'upgrade-1.0.4' => 1, | |
| 'upgrade-1.0.3' => 1, | |
| 'upgrade-1.0.2' => 1, | |
| 'dateintlfacade.php' => 1, | |
| 'dateintlbuilder.php' => 1, | |
| 'readme-pl' => 1, | |
| 'traceviewbundle.php' => 1, | |
| 'apoutchikaloremipsumbundle.php' => 1, | |
| 'expiringhash.php' => 1, | |
| 'pull-hub-updates.bat' => 1, | |
| 'aplazame.php' => 1, | |
| 'watchngo.config' => 1, | |
| 'watchngo' => 1, | |
| 'mp' => 1, | |
| 'migrator.php' => 1, | |
| 'fixturenator.php' => 1, | |
| 'cfg' => 1, | |
| 'configmagic.php' => 1, | |
| 'climax' => 1, | |
| 'testclasses.php' => 1, | |
| 'climaxcontrollertest.php' => 1, | |
| 'climax.php' => 1, | |
| 'potato.db' => 1, | |
| 'view-application-form.php' => 1, | |
| 'aygonformhandlerbundle.php' => 1, | |
| 'debrilrssatombundle.php' => 1, | |
| 'simplistic-nav-menus.php' => 1, | |
| 'alexkomaralexfilesearchbundle.php' => 1, | |
| 'asynctweetsbundle.php' => 1, | |
| 'script.sql' => 1, | |
| 'shell.sh' => 1, | |
| 'readmerussian' => 1, | |
| 'gittest2.core' => 1, | |
| 'gittest' => 1, | |
| 'aldoapibundle.php' => 1, | |
| 'example.dcr.yml' => 1, | |
| 'dcr' => 1, | |
| '.jscsrc.drupal' => 1, | |
| 'phpunit-feeds.xml' => 1, | |
| 'polyutil.php' => 1, | |
| 'debrilfeediobundle.php' => 1, | |
| 'persons.png' => 1, | |
| 'curriculum.png' => 1, | |
| 'alexwebbundle.php' => 1, | |
| 'phped' => 1, | |
| 'grammar' => 1, | |
| 'alexpaginationbundle.php' => 1, | |
| 'alexmultisitebundle.php' => 1, | |
| 'alexdoctrineextrabundle.php' => 1, | |
| 'alexasseticextrabundle.php' => 1, | |
| 'twofactor_gauthenticator_form.js' => 1, | |
| 'twofactor_gauthenticator.php' => 1, | |
| 'mathutil.php' => 1, | |
| 'sphericalutil.php' => 1, | |
| 'qrcode.min.js' => 1, | |
| 'settingsasset.php' => 1, | |
| 'erro.html' => 1, | |
| 'reflectsandcleanspropertiesaftertesttrait.php' => 1, | |
| 'iscontrollertesttrait.php' => 1, | |
| 'closesconnectionsaftertesttrait.php' => 1, | |
| 'apihelperstrait.php' => 1, | |
| 'newsstickerasset.php' => 1, | |
| 'newssticker.php' => 1, | |
| 'phunction.php' => 1, | |
| 'testdummy' => 1, | |
| 'align-lib-doc.pdf' => 1, | |
| 'filternet' => 1, | |
| 'uploadfilesbehavior.php' => 1, | |
| 'algolia_algoliasearch.xml' => 1, | |
| 'isup' => 1, | |
| 'contacts.json' => 1, | |
| 'algoliasearch.php' => 1, | |
| 'skeletonclass.php' => 1, | |
| 'mypackageserviceprovider.php' => 1, | |
| 'ab_useparentmediafiles.sublime-project' => 1, | |
| 'cougar.php' => 1, | |
| 'microremoteservicebundle.php' => 1, | |
| 'microclientbundle.php' => 1, | |
| 'microbaseservicebundle.php' => 1, | |
| 'ratyasset.php' => 1, | |
| 'raty.php' => 1, | |
| 'nf_pp.php' => 1, | |
| 'tiny_ssi.php' => 1, | |
| 'twofactor_gauthenticator.js' => 1, | |
| '2fa_qr_code.js' => 1, | |
| 'phpunit-auth-example.json' => 1, | |
| 'localization.html.php' => 1, | |
| 'templateenginecache.php' => 1, | |
| 'templates.ru.json' => 1, | |
| 'templates.json' => 1, | |
| 'templates.html.php' => 1, | |
| 'simple.ru.json' => 1, | |
| 'simple.json' => 1, | |
| 'pages.ru.json' => 1, | |
| 'pages.php' => 1, | |
| 'pages.html.php' => 1, | |
| 'localization.ru.json' => 1, | |
| 'localization.php' => 1, | |
| 'localization.json' => 1, | |
| 'index.ru.json' => 1, | |
| 'templateenginenull.php' => 1, | |
| 'index.json' => 1, | |
| 'global.ru.json' => 1, | |
| 'global.json' => 1, | |
| 'elements.ru.json' => 1, | |
| 'elements.json' => 1, | |
| 'elements.html.php' => 1, | |
| 'debug.ru.json' => 1, | |
| 'debug.json' => 1, | |
| 'debug.html.php' => 1, | |
| 'controls.ru.json' => 1, | |
| 'controls.php' => 1, | |
| 'controls.json' => 1, | |
| 'controls.html.php' => 1, | |
| 'templateenginefactory.module' => 1, | |
| 'templateengineprocesswire.module' => 1, | |
| 'scrypt.php' => 1, | |
| 'adminltecrudgenerator.sublime-project' => 1, | |
| 'devicedetect.php' => 1, | |
| 'vcdeploy' => 1, | |
| 'config.inc.php.dist2' => 1, | |
| 'l91suluwebsiteuserbundle.php' => 1, | |
| 'l91suluformbundle.php' => 1, | |
| 'l91sulubackendbundle.php' => 1, | |
| 'techfinancialsclient.php' => 1, | |
| 'commoner.xml' => 1, | |
| 'alestecrudgeneratorbundle.php' => 1, | |
| 'alestegeneratorbundle.php' => 1, | |
| 'adminltegeneratorbundle.php' => 1, | |
| 'adminltecrudgenerator.sublime-workspace' => 1, | |
| 'dependentdropdown.php' => 1, | |
| 'license.twig' => 1, | |
| 'modalloaderasset.php' => 1, | |
| 'modalloader.php' => 1, | |
| 'languageboxasset.php' => 1, | |
| 'languagebox.php' => 1, | |
| 'famfamfamflagsasset.php' => 1, | |
| 'cookiesasset.php' => 1, | |
| '.flooignore' => 1, | |
| 'jquerytranslatorasset.php' => 1, | |
| 'circulartabsasset.php' => 1, | |
| 'circulartabs.php' => 1, | |
| 'titlebehavior.php' => 1, | |
| 'i18ntrait.php' => 1, | |
| 'controllerhelper.php' => 1, | |
| 'mg' => 1, | |
| 'timeslot.php' => 1, | |
| 'view-application-data.php' => 1, | |
| 'amiairbrakebundle.php' => 1, | |
| 'reverseproxy.php' => 1, | |
| 'phperror-gui.php' => 1, | |
| 'thumbnails.php' => 1, | |
| 'entropy' => 1, | |
| 'twitterfeed.php' => 1, | |
| 'detailview4col.php' => 1, | |
| 'aerospikesessionhandler.php' => 1, | |
| 'tempmail_example.php' => 1, | |
| 'tempmail.class.php' => 1, | |
| 'zarinpal.php' => 1, | |
| 'awzetacachebundle.php' => 1, | |
| 'awezpfetchbundle.php' => 1, | |
| 'sequencejsasset.php' => 1, | |
| 'pingerbundle.php' => 1, | |
| 'nivosliderasset.php' => 1, | |
| 'elevatezoomasset.php' => 1, | |
| 'elevatezoom.php' => 1, | |
| 'moneyasset.php' => 1, | |
| 'adrcassandrabundle.php' => 1, | |
| 'jpgraph_logo.jpg' => 1, | |
| 'amysql.php' => 1, | |
| 'ambtadoctrineencryptbundle.php' => 1, | |
| 'uploadsaktiwidgetasset.php' => 1, | |
| 'uploadsaktitrait.php' => 1, | |
| 'uploadsaktiasset.php' => 1, | |
| 'uploadsakti.php' => 1, | |
| 'amaxlabformbundle.php' => 1, | |
| 'messentebundle.php' => 1, | |
| 'checkvendors.sh' => 1, | |
| 'timezones' => 1, | |
| 'edit-application-form.php' => 1, | |
| 'view-all-applications.php' => 1, | |
| 'terms_condition.php' => 1, | |
| 'switchery.min.js' => 1, | |
| 'switchery.min.css' => 1, | |
| 'renewal_notification.php' => 1, | |
| 'register-application-form.php' => 1, | |
| 'new-application-list.php' => 1, | |
| 'my_companies.php' => 1, | |
| 'my-invoices-list.php' => 1, | |
| 'manage_templates_role.php' => 1, | |
| 'ias-documents.php' => 1, | |
| 'edited-application-list.php' => 1, | |
| 'company_users.php' => 1, | |
| 'jqueuebundle.php' => 1, | |
| 'change-password.php' => 1, | |
| 'certificate_listing.php' => 1, | |
| 'approved-application-list.php' => 1, | |
| 'application_form.php' => 1, | |
| 'application-form.css' => 1, | |
| 'app-diff.php' => 1, | |
| 'all_companies.php' => 1, | |
| 'add_users.php' => 1, | |
| 'jqueryajaxenxbundle.php' => 1, | |
| '_example.php' => 1, | |
| '_auto_example.php' => 1, | |
| 'lescript.php' => 1, | |
| 'sonatamediawebcamproviderbundle.php' => 1, | |
| 'backenddesignbundle.php' => 1, | |
| 'amsearchplugin.php' => 1, | |
| 'assetmon' => 1, | |
| 'data_manager.php' => 1, | |
| 'businessdropcapbundle.php' => 1, | |
| 'businesscarouselbundle.php' => 1, | |
| 'alphalemonbootstrapbundle.php' => 1, | |
| 'love alphalemoncms (powered by link)' => 1, | |
| 'gpl2' => 1, | |
| 'alphalemoncmsbundle.php' => 1, | |
| 'alvalumuploaderbundle.php' => 1, | |
| 'uinames.class.php' => 1, | |
| 'instagram-helper.php' => 1, | |
| 'posts_store.php' => 1, | |
| 'notice_manager.php' => 1, | |
| 'instagram_factory.php' => 1, | |
| 'carbon_helper.php' => 1, | |
| 'businesssliderbundle.php' => 1, | |
| 'env_example' => 1, | |
| 'entity_decorator_finder.class.inc' => 1, | |
| 'entity_decorator.module' => 1, | |
| 'entity_decorator.info' => 1, | |
| 'measure.php' => 1, | |
| 'weirdbundle.php' => 1, | |
| 'lexrants.libraries.yml' => 1, | |
| 'lexrants.info.yml' => 1, | |
| 'lexrants.breakpoints.yml' => 1, | |
| 'registry.functions.php' => 1, | |
| 'empir' => 1, | |
| 'assetmon.php' => 1, | |
| 'assetmon.json' => 1, | |
| 'businessmenubundle.php' => 1, | |
| 'businesswebsitethemebundle.php' => 1, | |
| 'amnavplugin.php' => 1, | |
| 'symfony.php' => 1, | |
| 'amformsplugin.php' => 1, | |
| 'oathtoken.php' => 1, | |
| 'alyxgrayoathtokenbundle.php' => 1, | |
| 'logviewbundle.php' => 1, | |
| '.twgit_features_subject' => 1, | |
| 'readme.mdwn' => 1, | |
| 'alterphpdeveloperbundle.php' => 1, | |
| 'alterphpbitformbundle.php' => 1, | |
| 'alter' => 1, | |
| 'alsarmonologextensionsbundle.php' => 1, | |
| 'convertibleinterface.php' => 1, | |
| 'autoboxtype.php' => 1, | |
| 'alpixeluserbundle.php' => 1, | |
| 'alphalemonelfinderbundle.php' => 1, | |
| 'seobundle.php' => 1, | |
| 'alpixelmenubundle.php' => 1, | |
| 'alpixelmediabundle.php' => 1, | |
| 'alpixelelasticaquerysorterbundle.php' => 1, | |
| 'alpixelcustomerbridgebundle.php' => 1, | |
| 'alpixelcmsbundle.php' => 1, | |
| 'alpixelassetversionbundle.php' => 1, | |
| 'fix-generated-themes' => 1, | |
| 'alphalemonthemeenginebundle.php' => 1, | |
| 'socialsdkbundle.php' => 1, | |
| 'alphalemonpagetreebundle.php' => 1, | |
| 'markdowngeshibundle.php' => 1, | |
| 'alphalemonfrontendbundle.php' => 1, | |
| 'aygonfilterbundle.php' => 1, | |
| 'config_readme' => 1, | |
| 'nemiro.webforms.php.phpproj.user' => 1, | |
| 'htpasswd.php' => 1, | |
| 'docmethod.php' => 1, | |
| 'docclass.php' => 1, | |
| 'lambda.php' => 1, | |
| 'numerics.php' => 1, | |
| 'tagslist.php' => 1, | |
| 'htmlminifier.php' => 1, | |
| 'named.php' => 1, | |
| 'lazyfield.php' => 1, | |
| 'lazycontainer.php' => 1, | |
| 'arraywrapper.php' => 1, | |
| 'arraymagic.php' => 1, | |
| 'passwordfile.php' => 1, | |
| 'realfile.php' => 1, | |
| 'posgenerated.php' => 1, | |
| 'fs.php' => 1, | |
| 'windows.php' => 1, | |
| 'posix.php' => 1, | |
| 'ifile.php' => 1, | |
| 'ifs.php' => 1, | |
| 'superglobals.php' => 1, | |
| 'evil.php' => 1, | |
| 'typingerror.php' => 1, | |
| 'requiresoverride.php' => 1, | |
| 'propertyreadonly.php' => 1, | |
| 'pointless.php' => 1, | |
| 'opts.php' => 1, | |
| 'docvar.php' => 1, | |
| 'posmap.php' => 1, | |
| 'notinstalled.php' => 1, | |
| 'quick_start' => 1, | |
| 'minify.module' => 1, | |
| 'minify.install' => 1, | |
| 'minify.info' => 1, | |
| 'minify.admin.inc' => 1, | |
| 'azure_blob.streamwrappers.inc' => 1, | |
| 'azure_blob.module' => 1, | |
| 'azure_blob.install' => 1, | |
| 'azure_blob.info' => 1, | |
| 'azure_blob.drush.inc' => 1, | |
| 'simpleapp.php' => 1, | |
| 'azinegeoblockingbundle.php' => 1, | |
| 'usage_examples' => 1, | |
| 'azineemailbundle.php' => 1, | |
| 'possource.php' => 1, | |
| 'azinesocialbarbundle.php' => 1, | |
| 'azinemailgunwebhooksbundle.php' => 1, | |
| 'azinehybridauthbundle.php' => 1, | |
| 'raskoh.php' => 1, | |
| 'code-capture.png' => 1, | |
| 'loop-tests' => 1, | |
| 'azatyanarmenianlocalebundle.php' => 1, | |
| 'sv.po' => 1, | |
| 'php-xgettext' => 1, | |
| 'pgettext.php' => 1, | |
| 'recentplaces.lnk' => 1, | |
| 'ifactory.php' => 1, | |
| 'sourcemap.php' => 1, | |
| 'notvalid.php' => 1, | |
| 'notinited.php' => 1, | |
| 'bmltwigswiftmailerbundle.php' => 1, | |
| 'issuu.php' => 1, | |
| 'calendaruplifts.php' => 1, | |
| 'suppliers.php' => 1, | |
| 'roomservice.php' => 1, | |
| 'products.php' => 1, | |
| 'orders.php' => 1, | |
| 'customers.php' => 1, | |
| 'drinkmenu.php' => 1, | |
| 'modules' => 1, | |
| 'extend' => 1, | |
| 'beverage' => 1, | |
| 'logrest' => 1, | |
| 'shutterfly.php' => 1, | |
| 'curlclass.php' => 1, | |
| 'omnipay.php' => 1, | |
| 'mysql2sqlite.sh' => 1, | |
| 'mysql2sqlite.php' => 1, | |
| 'database-str-replace.php' => 1, | |
| 'database-prefix.php' => 1, | |
| 'database-browser.php' => 1, | |
| 'cities_states.php' => 1, | |
| 'index.sample.php' => 1, | |
| 'avooserializertranslationbundle.php' => 1, | |
| 'avooinstallerbundle.php' => 1, | |
| 'avoogeneratorbundle.php' => 1, | |
| 'avooelobundle.php' => 1, | |
| 'elopoint.php' => 1, | |
| 'avooachievementbundle.php' => 1, | |
| 'custompayment.php' => 1, | |
| 'moventprofilerbundle.php' => 1, | |
| 'notfound.php' => 1, | |
| 'actionnotallowed.php' => 1, | |
| 'logic.php' => 1, | |
| 'itemnotfound.php' => 1, | |
| 'invalidvalue.php' => 1, | |
| 'invalidformat.php' => 1, | |
| 'invalidconfig.php' => 1, | |
| 'forbidden.php' => 1, | |
| 'fieldnotexist.php' => 1, | |
| 'disabled.php' => 1, | |
| 'dependencyerror.php' => 1, | |
| 'containerreadonly.php' => 1, | |
| 'alreadyinited.php' => 1, | |
| 'adapternotdefined.php' => 1, | |
| 'setter.php' => 1, | |
| 'awildeepdisquebundle.php' => 1, | |
| 'joblist.php' => 1, | |
| 'exp.php' => 1, | |
| 'subs.php' => 1, | |
| 'lazy.php' => 1, | |
| 'irootnode.php' => 1, | |
| 'inode.php' => 1, | |
| 'exceptiontrace.php' => 1, | |
| 'phpunit.xml.desc' => 1, | |
| 'axsytransactionalbundle.php' => 1, | |
| 'axsydoctrineshardingbundle.php' => 1, | |
| 'herbertextrabootstrap.php' => 1, | |
| '.codeception.yml' => 1, | |
| '.codeception.coverage.yml' => 1, | |
| 'build-example.xml' => 1, | |
| 'scaffold' => 1, | |
| 'payload.json' => 1, | |
| 'dotenvplugin.php' => 1, | |
| 'classbasednametrait.php' => 1, | |
| 'bangpoundinvokerbundle.php' => 1, | |
| 'bangpoundguzzleproxybundle.php' => 1, | |
| 'commonsgenderbundle.php' => 1, | |
| 'bangpoundfinitebundle.php' => 1, | |
| 'druplex.php' => 1, | |
| 'drupalserviceprovider.php' => 1, | |
| 'pseudokernel.php' => 1, | |
| 'drupalsessionhandler.php' => 1, | |
| 'bangpounddrupalbundle.php' => 1, | |
| 'bangpounddocumentcloudbundle.php' => 1, | |
| 'debugbarserviceprovider.php' => 1, | |
| 'constantsplugin.php' => 1, | |
| 'standardconfigtrait.php' => 1, | |
| 'bangpoundcastlebundle.php' => 1, | |
| 'callablecompilerpass.php' => 1, | |
| 'bangpoundatomdatabundle.php' => 1, | |
| 'asseticserviceprovider.php' => 1, | |
| 'codekitcoffeescriptfilter.php' => 1, | |
| 'sculpinoembedbundle.php' => 1, | |
| 'legacyphphttpkernelprovider.php' => 1, | |
| 'ezid.php' => 1, | |
| 'php-bandwidth' => 1, | |
| 'rm-subs' => 1, | |
| 'catapultdb.sql' => 1, | |
| 'exec.php' => 1, | |
| 'minimalconfigtrait.php' => 1, | |
| 'variablefilesystemtrait.php' => 1, | |
| 'rkpostformat.php' => 1, | |
| 'dynamodb_local_schema.js' => 1, | |
| 'githubmodel.php' => 1, | |
| 'eventbootstrap.php' => 1, | |
| 'urltest.php' => 1, | |
| 'unittest.php' => 1, | |
| 'methodparser.php' => 1, | |
| 'codeceptionaction.php' => 1, | |
| 'clicktest.php' => 1, | |
| 'configbootstrap.php' => 1, | |
| 'html2csv.php' => 1, | |
| 'cgkintbundle.php' => 1, | |
| 'barbondevpaymentpaypointhostedbundle.php' => 1, | |
| 'fast' => 1, | |
| 'dynamodb_local_init.db' => 1, | |
| 'yamlenvironmenttrait.php' => 1, | |
| 'bangpoundtwitterstreamingbundle.php' => 1, | |
| 'symfony_test.module' => 1, | |
| 'symfony_test.info' => 1, | |
| 'symfony.module' => 1, | |
| 'symfony.info' => 1, | |
| 'session.inc' => 1, | |
| 'jsonxmlelement.php' => 1, | |
| 'bangpoundpubsubbundle.php' => 1, | |
| 'phirehoseevents.php' => 1, | |
| 'bangpoundphirehosebundle.php' => 1, | |
| 'mediawiki-parser.php' => 1, | |
| 'ladybugserviceprovider.php' => 1, | |
| 'ladybugextension.php' => 1, | |
| 'phploy.ini' => 1, | |
| 'symfony-autocomplete' => 1, | |
| 'bb-twitterfeed.php' => 1, | |
| 'layoutbuilder.php' => 1, | |
| 'twigrender.php' => 1, | |
| 'urlgeneratorinterface.php' => 1, | |
| 'requestcontextinterface.php' => 1, | |
| 'flashinterface.php' => 1, | |
| 'dependencyinjectioncontainerinterface.php' => 1, | |
| 'callbackinterface.php' => 1, | |
| 'callbackfactoryinterface.php' => 1, | |
| 'bindingfactoryinterface.php' => 1, | |
| 'authenticatorinterface.php' => 1, | |
| 'numeric.php' => 1, | |
| 'backbee.bat' => 1, | |
| 'toolbar.php' => 1, | |
| 'crop.php' => 1, | |
| 'backendwebgeneratorbundle.php' => 1, | |
| 'bbapplication.php' => 1, | |
| 'bacbox_license' => 1, | |
| 'bacbox_author' => 1, | |
| 'taglistextension.php' => 1, | |
| 'taglisteventsubscriber.php' => 1, | |
| 'fastnavextension.php' => 1, | |
| 'fastnaveventsubscriber.php' => 1, | |
| 'blogrollextension.php' => 1, | |
| 'blogrolleventsubscriber.php' => 1, | |
| 'bablogentriesbundle.php' => 1, | |
| 'babaganoushgridsterbundle.php' => 1, | |
| 'babaganoushfoundationbundle.php' => 1, | |
| 'babaganoushdatatablesbundle.php' => 1, | |
| 'backenderepiceditorbundle.php' => 1, | |
| 'errorfinder.php' => 1, | |
| 'brsignedrequestbundle.php' => 1, | |
| 'rollbarerrorhandler.php' => 1, | |
| 'notostest' => 1, | |
| 'uapiasset.php' => 1, | |
| 'baiy.php' => 1, | |
| 'baitpollbundle.php' => 1, | |
| 'sqlite_simple_store.php' => 1, | |
| 'php-hooks.php' => 1, | |
| 'sign_sample.php' => 1, | |
| 'sampleconf.php' => 1, | |
| 'bosclientsample.php' => 1, | |
| 'withpayload.php' => 1, | |
| 'measurementprotocol.php' => 1, | |
| 'rollbarlogroute.php' => 1, | |
| 'rollbarcomponent.php' => 1, | |
| 'badge-poser.svg' => 1, | |
| 'mailgunyii2.php' => 1, | |
| 'mailgunyii.php' => 1, | |
| 'mailgununsubscribe.php' => 1, | |
| 'mailgunroute.php' => 1, | |
| 'mailgunmessage.php' => 1, | |
| 'mailgunlistmember.php' => 1, | |
| 'mailgunlist.php' => 1, | |
| 'mailguncomplaint.php' => 1, | |
| 'mailgunbounce.php' => 1, | |
| 'mailgunapi.php' => 1, | |
| 'baetmaendqlbundle.php' => 1, | |
| 'today-dark.svg' => 1, | |
| 'i_m-badge.svg' => 1, | |
| 'achievement.php' => 1, | |
| 'hookdeploy.php' => 1, | |
| 'arodissxlsbundle.php' => 1, | |
| 'multipleimagesfield.php' => 1, | |
| 'lambdacontroller.php' => 1, | |
| 'httpfile.php' => 1, | |
| 'cookiemanager.php' => 1, | |
| 'hookabletrait.php' => 1, | |
| 'hookmanagerinterface.php' => 1, | |
| 'hookmanager.php' => 1, | |
| 'hookcontainer.php' => 1, | |
| 'chain.php' => 1, | |
| 'widgetmanagerinterface.php' => 1, | |
| 'widgetfactoryinterface.php' => 1, | |
| 'groupinterface.php' => 1, | |
| 'dynamicgroup.php' => 1, | |
| 'imageswidget.php' => 1, | |
| 'migrationmanagerinterface.php' => 1, | |
| 'imagewidget.php' => 1, | |
| 'imageproperty.php' => 1, | |
| 'entityforminterface.php' => 1, | |
| 'entityform.php' => 1, | |
| 'entityfieldsolverinterface.php' => 1, | |
| 'entityfieldsolver.php' => 1, | |
| 'relationsbehavior.php' => 1, | |
| 'persistencebehavior.php' => 1, | |
| 'manycollection.php' => 1, | |
| 'entityexceptioninterface.php' => 1, | |
| 'swiftmessage.php' => 1, | |
| 'swiftemail.php' => 1, | |
| 'dbmigration.php' => 1, | |
| 'collectionorm.php' => 1, | |
| 'psrexception.php' => 1, | |
| 'testbuilder.php' => 1, | |
| 'wkebayapi.php' => 1, | |
| 'wkdhlapibundle.php' => 1, | |
| 'wkbasebundle.php' => 1, | |
| 'wkamazonmwsapi.php' => 1, | |
| 'wkafterbuyapibundle.php' => 1, | |
| 'validatorfactoryinterface.php' => 1, | |
| 'validatorfactory.php' => 1, | |
| 'rulesregistryinterface.php' => 1, | |
| 'rulesregistry.php' => 1, | |
| 'inputbag.php' => 1, | |
| 'testsgenerator.php' => 1, | |
| 'testbuilderinterface.php' => 1, | |
| 'results.php' => 1, | |
| 'collectionormfactory.php' => 1, | |
| 'curlconverter.php' => 1, | |
| 'viewabletrait.php' => 1, | |
| 'templateenginefactoryinterface.php' => 1, | |
| 'sqlpropertytransformerinterface.php' => 1, | |
| 'polymorphiccollectionorm.php' => 1, | |
| 'ormmigrations.php' => 1, | |
| 'orminterface.php' => 1, | |
| 'ormfactoryinterface.php' => 1, | |
| 'ormfactory.php' => 1, | |
| 'ormbehavior.php' => 1, | |
| 'entityrelation.php' => 1, | |
| 'collectionorminterface.php' => 1, | |
| 'collectionormfactoryinterface.php' => 1, | |
| 'fakeemail.php' => 1, | |
| 'sqlite_functions.php' => 1, | |
| 'wkgooglespreadsheetbundle.php' => 1, | |
| 'phpunit.example.xml' => 1, | |
| 'paramscodecbundle.php' => 1, | |
| 'artseldopeninviterbundle.php' => 1, | |
| 'asfwebsitebundle.php' => 1, | |
| 'asfuserbundle.php' => 1, | |
| 'asfschedulerbundle.php' => 1, | |
| 'asfproductbundle.php' => 1, | |
| 'asfdocumentbundle.php' => 1, | |
| 'asfcontactbundle.php' => 1, | |
| 'asfblogbundle.php' => 1, | |
| 'asfbackendbundle.php' => 1, | |
| 'artprimajsendbundle.php' => 1, | |
| 'artprimaformsextrabundle.php' => 1, | |
| 'konektsyliussyncbundle.php' => 1, | |
| 'dateconverterbundle.php' => 1, | |
| 'studio' => 1, | |
| 'moocsybundle.php' => 1, | |
| 'flashersbundle.php' => 1, | |
| 'artesanusevents.php' => 1, | |
| 'artesanusbundle.php' => 1, | |
| 'aclbundle.php' => 1, | |
| 'states.php' => 1, | |
| 'sasshandler.php' => 1, | |
| 'extendedscssc.php' => 1, | |
| 'elivejournal.php' => 1, | |
| 'badsignatureexception.php' => 1, | |
| 'php-ext-checker' => 1, | |
| 'linode.png' => 1, | |
| 'documentorbundle.php' => 1, | |
| 'eassy.php' => 1, | |
| 'schematable.php' => 1, | |
| 'publishbehavior.php' => 1, | |
| 'schemainterface.php' => 1, | |
| 'dbinterface.php' => 1, | |
| 'bundleloader.php' => 1, | |
| 'bundleinstallerplugin.php' => 1, | |
| 'bundleinstaller.php' => 1, | |
| 'paginatorfactoryinterface.php' => 1, | |
| 'paginatorfactory.php' => 1, | |
| 'datetimeinterface.php' => 1, | |
| 'baginterface.php' => 1, | |
| 'nullcache.php' => 1, | |
| 'timestampsbehavior.php' => 1, | |
| 'slugifybehavior.php' => 1, | |
| 'metasbehavior.php' => 1, | |
| 'settings.json-dist' => 1, | |
| 'notauthenticatedexception.php' => 1, | |
| 'monofont.ttf' => 1, | |
| 'bitpaypayments.php' => 1, | |
| 'modelcsv' => 1, | |
| 'as3modlrbundle.php' => 1, | |
| 'arzzzencmsbundle.php' => 1, | |
| 'cana' => 1, | |
| 'macaddrvalidator.php' => 1, | |
| 'htmlutils.php' => 1, | |
| 'dateutils.php' => 1, | |
| 'arturdoruchpaginatorbundle.php' => 1, | |
| 'requesthandler.php' => 1, | |
| 'arturdoruchflashmessagebundle.php' => 1, | |
| 'wkemarsysapi.php' => 1, | |
| 'wkguzzlecommandclient.php' => 1, | |
| 'test-phantom.sh' => 1, | |
| 'wordpress-custom-fields-permalink-plugin.php' => 1, | |
| 'devicedetectorbundle.php' => 1, | |
| 'wrapperimperaviredactorpluginasset.php' => 1, | |
| 'referenceimperaviredactorpluginasset.php' => 1, | |
| 'pdfimperaviredactorpluginasset.php' => 1, | |
| 'blueimperaviredactorpluginasset.php' => 1, | |
| 'psqgridview.php' => 1, | |
| 'testbench' => 1, | |
| 'make.utilities.inc' => 1, | |
| 'about' => 1, | |
| 'atoumatoumbundle.php' => 1, | |
| 'atl15googleanalyticsbundle.php' => 1, | |
| 'atolye15slackexceptionbundle.php' => 1, | |
| 'twigextension' => 1, | |
| 'siteplatformbundle.php' => 1, | |
| '.devtools' => 1, | |
| 'demo-builder.php' => 1, | |
| 'demo-builder-lib.php' => 1, | |
| 'config.markdown.php' => 1, | |
| 'localize.class.php' => 1, | |
| 'entityhintefqexception.php' => 1, | |
| 'entityhintefq.php' => 1, | |
| 'at_base.module' => 1, | |
| 'at_base.missing.inc' => 1, | |
| 'at_base.make' => 1, | |
| 'at_base.install' => 1, | |
| 'at_base.info' => 1, | |
| 'at_base.hooks.inc' => 1, | |
| 'semaphoresmsbundle.php' => 1, | |
| 'siteutilitybundle.php' => 1, | |
| 'at_base.drush.inc' => 1, | |
| 'example_ccform.php' => 1, | |
| 'activefield - copy.php' => 1, | |
| 'rangecomparevalidatorasset.php' => 1, | |
| 'rangecomparevalidator.php' => 1, | |
| 'intltelinputvalidator.php' => 1, | |
| 'intltelinput.php' => 1, | |
| 'datetimerangecomparevalidatorasset.php' => 1, | |
| 'datetimerangecomparevalidator.php' => 1, | |
| 'runtest' => 1, | |
| 'receiver.php' => 1, | |
| 'codes.php' => 1, | |
| 'xinjiaspainvalidatorbundle.php' => 1, | |
| 'avegaochartjsbundle.php' => 1, | |
| 'avanzutransformerbundle.php' => 1, | |
| 'readme-forms' => 1, | |
| 'avanzudoctrineprefixbundle.php' => 1, | |
| 'avanzuprofilebundle.php' => 1, | |
| 'avanzujsonrequestbundle.php' => 1, | |
| 'avanzuadminthemebundle.php' => 1, | |
| 'endpoints.json.default' => 1, | |
| 'avangatejsonrpcclient.php' => 1, | |
| 'sapphp.xml' => 1, | |
| 'ddl-postgresql.sql' => 1, | |
| 'dist.sql' => 1, | |
| 'authy.php' => 1, | |
| 'readme-response' => 1, | |
| 'readme-request' => 1, | |
| 'readme-helpers' => 1, | |
| 'at_base.hack.inc' => 1, | |
| 'test_active_record_class.sql' => 1, | |
| 'wkicecatapi.php' => 1, | |
| 'natika' => 1, | |
| 'selectortest.php' => 1, | |
| 'optionstest.php' => 1, | |
| 'license - copy' => 1, | |
| 'domtest.php' => 1, | |
| 'contenttest.php' => 1, | |
| 'collectiontest.php' => 1, | |
| 'andreaspregabreadcrumbbundle.php' => 1, | |
| 'asposecloudbundle.php' => 1, | |
| 'wp-deblogify.php' => 1, | |
| 'wp-ip.php' => 1, | |
| 'style.phtml' => 1, | |
| 'assymfonydiextends.php' => 1, | |
| 'angularjqasset.php' => 1, | |
| 'index-01.php' => 1, | |
| 'sideuser.php' => 1, | |
| 'ioniconasset.php' => 1, | |
| 'icheckasset.php' => 1, | |
| 'adminlteskinasset.php' => 1, | |
| 'translituk.php' => 1, | |
| 'translitka.php' => 1, | |
| 'translitbe.php' => 1, | |
| 'translitascii.php' => 1, | |
| 'wkversionbundle.php' => 1, | |
| 'wkshopifyapi.php' => 1, | |
| 'wkschutzklickapi.php' => 1, | |
| 'wkklarnaapibundle.php' => 1, | |
| 'wkimageserviceclient.php' => 1, | |
| 'staticdomtest.php' => 1, | |
| 'assetcontroller.php' => 1, | |
| 'example-set.php' => 1, | |
| 'astinamoneybundle.php' => 1, | |
| 'example-hook.php' => 1, | |
| 'example-getupdatescli.php' => 1, | |
| 'doctrineloggerbundle.php' => 1, | |
| 'config.inc.sample.php' => 1, | |
| 'astinatranslationbundle.php' => 1, | |
| 'astinatradedoublerbundle.php' => 1, | |
| 'astinasolvencybundle.php' => 1, | |
| 'astinasociallinksbundle.php' => 1, | |
| 'astinaseobundle.php' => 1, | |
| 'astinaredirectmanagerbundle.php' => 1, | |
| 'astinaquillbundle.php' => 1, | |
| 'astinapaymentbundle.php' => 1, | |
| 'astinalabelsbundle.php' => 1, | |
| 'robotstxt.php' => 1, | |
| 'astinainjectionbundle.php' => 1, | |
| 'astinafotoliabundle.php' => 1, | |
| 'astinadomaineventsbundle.php' => 1, | |
| 'astinadeadlinkbundle.php' => 1, | |
| 'migratelibchart.php' => 1, | |
| 'phpunit_loader.php' => 1, | |
| 'laraeval-travis-build.sh' => 1, | |
| 'sysexits.php' => 1, | |
| 'sociallikes.php' => 1, | |
| 'socialassetjs.php' => 1, | |
| 'socialassetflat.php' => 1, | |
| 'socialassetclassic.php' => 1, | |
| 'socialassetbirman.php' => 1, | |
| 'nemiro.webforms.php.sln' => 1, | |
| 'nemiro.webforms.php.phpproj' => 1, | |
| 'usf-ca-chain.pem' => 1, | |
| 'wiakoweformbundle.php' => 1, | |
| 'woopra_tracker.php' => 1, | |
| 'wp-local-config-sample.php' => 1, | |
| 'wguniversaldatatablebundle.php' => 1, | |
| 'argumentscheck.php' => 1, | |
| 'cli_daemon' => 1, | |
| 'wildphp.php' => 1, | |
| 'main.modules' => 1, | |
| 'config.example.neon' => 1, | |
| 'easyrdf.php' => 1, | |
| 'pubsubhubbubsubscriber.php' => 1, | |
| 'pubsubhubbubsubscriber.i18n.php' => 1, | |
| 'wiakowemandrillbundle.php' => 1, | |
| 'wiakowebreadcrumbbundle.php' => 1, | |
| 'project.ruleset.xml.example' => 1, | |
| 'wiakowedoctrinetableprefixbundle.php' => 1, | |
| 'wihocaptchabundle.php' => 1, | |
| 'rafie.php' => 1, | |
| 'configuration.ini-dist' => 1, | |
| 'white.php' => 1, | |
| 'backpack' => 1, | |
| 'weysandoctrineimgbundle.php' => 1, | |
| 'werkspotstatsdbundle.php' => 1, | |
| 'werkspotsitemapbundle.php' => 1, | |
| 'werkintmemcachedbundle.php' => 1, | |
| 'wellcommercewishlistbundle.php' => 1, | |
| 'wellcommerceunitbundle.php' => 1, | |
| 'wordpoints.php' => 1, | |
| 'getclientip.php' => 1, | |
| 'wellcommercetaxbundle.php' => 1, | |
| 'asynccurler.php' => 1, | |
| 'composerrunner.php' => 1, | |
| 'xtainunitconverterbundle.php' => 1, | |
| 'readme_google' => 1, | |
| 'googledriveexample.php' => 1, | |
| 'x4dsbadmin2bundle.php' => 1, | |
| 'travis-event-loops.sh' => 1, | |
| 'repository-template-compare.yml' => 1, | |
| 'phunin-node.yml' => 1, | |
| 'phunin-node' => 1, | |
| 'htmlscraper.php' => 1, | |
| 'consumessitemap.php' => 1, | |
| 'curler_license' => 1, | |
| 'jquerypostcodeswidget.php' => 1, | |
| 'unescapeplugin.php' => 1, | |
| 'jquerypostcodesasset.php' => 1, | |
| 'ordermodelcolumn.php' => 1, | |
| 'ordermodelaction.php' => 1, | |
| 'orderbehavior.php' => 1, | |
| 'wsdltophp.yml.dist' => 1, | |
| 'cases' => 1, | |
| 'wgopeniduserbundle.php' => 1, | |
| 'ciscosystemsauditbundle.php' => 1, | |
| 'fred.php' => 1, | |
| 'decres.php' => 1, | |
| 'decres.bat' => 1, | |
| 'virtualbundle.php' => 1, | |
| 'appfocusedkernel.php' => 1, | |
| 'wellcommercethemebundle.php' => 1, | |
| 'wellcommerceshopbundle.php' => 1, | |
| 'kinit.php' => 1, | |
| 'wsgeneratorbundle.php' => 1, | |
| 'breadcrumbitemcollection.php' => 1, | |
| 'breadcrumbitem.php' => 1, | |
| 'wellcommerceavailabilitybundle.php' => 1, | |
| 'wellcommerceattributebundle.php' => 1, | |
| 'wellcommerceappbundle.php' => 1, | |
| 'wellcommerceapibundle.php' => 1, | |
| 'wellcommerceadminbundle.php' => 1, | |
| 'commonmodel.php' => 1, | |
| 'weidealdocbundle.php' => 1, | |
| 'aldocexception.php' => 1, | |
| 'aldoc.php' => 1, | |
| 'wsjsformvalidatorbundle.php' => 1, | |
| 'wsformbundle.php' => 1, | |
| 'breadcrumbiteminterface.php' => 1, | |
| 'wsexceptionsbundle.php' => 1, | |
| 'nonsensebundle.php' => 1, | |
| 'doctrinefixturesgeneratorbundle.php' => 1, | |
| 'font.html' => 1, | |
| 'webmakerssettingbundle.php' => 1, | |
| 'shoppingcartcomponent.php' => 1, | |
| 'cartvoucherinterface.php' => 1, | |
| 'cartofferinterface.php' => 1, | |
| 'rightsmodule.php' => 1, | |
| '.hg_archival' => 1, | |
| 'twitteroauthuser.php' => 1, | |
| 'twitteroauthloader.php' => 1, | |
| 'templateenginetrait.php' => 1, | |
| 'breadcrumbitemcollectioninterface.php' => 1, | |
| 'wellcommercecartbundle.php' => 1, | |
| 'wellcommerceshippingbundle.php' => 1, | |
| 'wellcommercemediabundle.php' => 1, | |
| 'wellcommercesearchbundle.php' => 1, | |
| 'wellcommerceroutingbundle.php' => 1, | |
| 'wellcommercereviewbundle.php' => 1, | |
| 'wellcommercereportbundle.php' => 1, | |
| 'wellcommerceproductstatusbundle.php' => 1, | |
| 'wellcommerceproductbundle.php' => 1, | |
| 'wellcommerceproducerbundle.php' => 1, | |
| 'wellcommercepaymentbundle.php' => 1, | |
| 'wellcommercepagebundle.php' => 1, | |
| 'wellcommerceorderbundle.php' => 1, | |
| 'wellcommerceoauthbundle.php' => 1, | |
| 'wellcommercenewsbundle.php' => 1, | |
| 'wellcommercelocalebundle.php' => 1, | |
| 'wellcommercecategorybundle.php' => 1, | |
| 'wellcommercelayoutbundle.php' => 1, | |
| 'wellcommercelayerednavigationbundle.php' => 1, | |
| 'wellcommercedoctrinebundle.php' => 1, | |
| 'wellcommercedistributionbundle.php' => 1, | |
| 'wellcommercedictionarybundle.php' => 1, | |
| 'wellcommercedelivererbundle.php' => 1, | |
| 'wellcommercecurrencybundle.php' => 1, | |
| 'wellcommercecouponbundle.php' => 1, | |
| 'wellcommercecountrybundle.php' => 1, | |
| 'wellcommercecorebundle.php' => 1, | |
| 'wellcommercecontactbundle.php' => 1, | |
| 'wellcommercecompanybundle.php' => 1, | |
| 'wellcommerceclientbundle.php' => 1, | |
| 'xvenginesymfonybridgebundle.php' => 1, | |
| 'testauth.php' => 1, | |
| 'templateengineexception.php' => 1, | |
| 'yadminbundle.php' => 1, | |
| 'youwefilemanagerbundle.php' => 1, | |
| 'ysapiparameters.ini.dist' => 1, | |
| 'uploadablebundle.php' => 1, | |
| 'tokenauthenticationbundle.php' => 1, | |
| 'ysettingsbundle.php' => 1, | |
| 'youshidosecurityuserbundle.php' => 1, | |
| 'ymessagesbundle.php' => 1, | |
| 'youshidoencryptionbundle.php' => 1, | |
| 'youshidodoctrineextensionbundle.php' => 1, | |
| 'ycmsbundle.php' => 1, | |
| 'youshidoblogbundle.php' => 1, | |
| 'apiimagesbundle.php' => 1, | |
| 'yotpo.phar' => 1, | |
| 'wannaspeakbundle.php' => 1, | |
| 'yosimitsoworkingforumbundle.php' => 1, | |
| 'test-sniff-doc.sh' => 1, | |
| 'nexmoverify.php' => 1, | |
| 'i18n-module.php' => 1, | |
| 'class-api-libs.php' => 1, | |
| 'class-api-google.php' => 1, | |
| 'class-api-google-client.php' => 1, | |
| 'class-update-manager.php' => 1, | |
| 'class-theme-update-manager.php' => 1, | |
| 'class-theme-license-manager.php' => 1, | |
| 'class-product.php' => 1, | |
| 'class-plugin-update-manager.php' => 1, | |
| 'youwefilemanagerevents.php' => 1, | |
| 'responsefilter.php' => 1, | |
| 'class-license-manager.php' => 1, | |
| 'images.php' => 1, | |
| 'zensideckeditorbundle.php' => 1, | |
| 'plugin.yaml' => 1, | |
| 'pusherplugin.php' => 1, | |
| 'pushereventpusher.php' => 1, | |
| 'notormtracypanel.php' => 1, | |
| 'srusearch.php' => 1, | |
| 'zeichen32gitlabapibundle.php' => 1, | |
| 'zeeroutelistbundle.php' => 1, | |
| 'zeemobiledetectservicebundle.php' => 1, | |
| 'zeecapifonydeployinfobundle.php' => 1, | |
| 'punit_bootstrap.php.dist.php' => 1, | |
| 'woocommerce.php' => 1, | |
| 'header-searchform.php' => 1, | |
| 'yllyassetdependencybundle.php' => 1, | |
| 'readme-pt_pt' => 1, | |
| 'simple-phpexcel-reader.iml' => 1, | |
| 'composer-setup.php' => 1, | |
| 'wp_scan.yml.dist' => 1, | |
| 'travis.config.sh' => 1, | |
| 'yammerbundle.php' => 1, | |
| 'targetprocessbundle.php' => 1, | |
| 'vdm.raml' => 1, | |
| 'diagram_school_persons_simple.png' => 1, | |
| 'diagram_school_persons.png' => 1, | |
| 'diagram_school_curriculum_simple.png' => 1, | |
| 'diagram_school_curriculum.png' => 1, | |
| 'blurb' => 1, | |
| 'class-plugin-license-manager.php' => 1, | |
| 'class-api-request.php' => 1, | |
| 'cakephp3features' => 1, | |
| 'xidearestbundle.php' => 1, | |
| 'abimusfetchbundle.php' => 1, | |
| 'globaldebug.php' => 1, | |
| 'phpxiphehtml.sublime-snippet' => 1, | |
| '_html.php' => 1, | |
| 'marker_shadow.png' => 1, | |
| 'gmapsmarker.php' => 1, | |
| 'xideauserbundle.php' => 1, | |
| 'xideaurlbundle.php' => 1, | |
| 'xideatwitterbootstrapbundle.php' => 1, | |
| 'xideatemplatebundle.php' => 1, | |
| 'xideastuffbundle.php' => 1, | |
| 'xideastatusbundle.php' => 1, | |
| 'xideaproductbundle.php' => 1, | |
| 'controllerrouter.php' => 1, | |
| 'productevents.php' => 1, | |
| 'xideaprioritybundle.php' => 1, | |
| 'xideanotificationbundle.php' => 1, | |
| 'xideajquerybundle.php' => 1, | |
| 'xideadataflowbundle.php' => 1, | |
| 'xideacommentbundle.php' => 1, | |
| 'commentevents.php' => 1, | |
| 'xideacategorybundle.php' => 1, | |
| 'xideabookbundle.php' => 1, | |
| 'bookevents.php' => 1, | |
| 'xideabasebundle.php' => 1, | |
| 'dataflowinterface.php' => 1, | |
| 'abstractdataflow.php' => 1, | |
| 'dps-pxpay.php' => 1, | |
| 'interfacerouter.php' => 1, | |
| '.gitigore' => 1, | |
| 'importfilewidget.php' => 1, | |
| 'phpdoccrontab.php' => 1, | |
| 'leftright.php' => 1, | |
| 'ydleuserbundle.php' => 1, | |
| 'ydlesettingsbundle.php' => 1, | |
| 'ydleroombundle.php' => 1, | |
| 'ydlenodesbundle.php' => 1, | |
| 'ydlelogsbundle.php' => 1, | |
| 'ydlehubbundle.php' => 1, | |
| 'ydlecorebundle.php' => 1, | |
| 'ydleapibundle.php' => 1, | |
| 'fablabmanagerbundle.php' => 1, | |
| 'importlogwidget.php' => 1, | |
| 'importbehavior.php' => 1, | |
| 'interfaceviewloader.php' => 1, | |
| 'github-checker.php' => 1, | |
| 'tablerow.php' => 1, | |
| 'yourls-loader.php' => 1, | |
| 'yourls-infos.php' => 1, | |
| 'yourls-go.php' => 1, | |
| 'yourls-api.php' => 1, | |
| 'sample-robots' => 1, | |
| 'sample-remote-api-call' => 1, | |
| 'sample-public-front-page' => 1, | |
| 'sample-public-api' => 1, | |
| 'gom.php' => 1, | |
| 'viewloader.php' => 1, | |
| 'onesapp.php' => 1, | |
| 'templateengineloader.php' => 1, | |
| 'storagetrait.php' => 1, | |
| 'zensidesonataimagebundle.php' => 1, | |
| 'vesaxrestclientbundle.php' => 1, | |
| 'siduseavbootstrapbundle.php' => 1, | |
| 'sidusdatagridbundle.php' => 1, | |
| 'sidusadminbundle.php' => 1, | |
| 'vbeesettingbundle.php' => 1, | |
| 'realwork' => 1, | |
| 'barcodegeneratorassets.php' => 1, | |
| 'barcodegenerator.php' => 1, | |
| 'alkwebbundle.php' => 1, | |
| 'organizer.js' => 1, | |
| 'bisect' => 1, | |
| 'plugins.sql' => 1, | |
| 'vesaxseobundle.php' => 1, | |
| 'vesaxrelationbundle.php' => 1, | |
| 'siduseavfilterbundle.php' => 1, | |
| 'maintenance_handler.php' => 1, | |
| 'vesaxmaintenancebundle.php' => 1, | |
| 'vesaxhttpkernelloggerbundle.php' => 1, | |
| 'vesaxguzzlebundle.php' => 1, | |
| 'vesaxfavoritebundle.php' => 1, | |
| 'favoritemanager.php' => 1, | |
| 'vesaxajaxcrossdomainsessionbundle.php' => 1, | |
| 'vesaxadminextrabundle.php' => 1, | |
| 'prepare' => 1, | |
| 'static.json' => 1, | |
| 'velvelreportbundle.php' => 1, | |
| 'search_api_elasticsearch.views.inc' => 1, | |
| 'siduseavdatagridbundle.php' => 1, | |
| 'siduseavmodelbundle.php' => 1, | |
| 'search_api_elasticsearch.install' => 1, | |
| 'ebootstrapalert.php' => 1, | |
| 'ebootstraplistview.php' => 1, | |
| 'ebootstraplinkpager.php' => 1, | |
| 'ebootstraphero.php' => 1, | |
| 'ebootstrapgridview.php' => 1, | |
| 'ebootstrapflashmessages.php' => 1, | |
| 'ebootstrapdetailview.php' => 1, | |
| 'ebootstrapcollapse.php' => 1, | |
| 'ebootstrapcode.php' => 1, | |
| 'ebootstrapcarousel.php' => 1, | |
| 'ebootstrapbuttoncolumn.php' => 1, | |
| 'ebootstrapbutton.php' => 1, | |
| 'ebootstrapbreadcrumbs.php' => 1, | |
| 'ebootstrapactiveform.php' => 1, | |
| 'siduseavvariantbundle.php' => 1, | |
| 'ebootstrap.php' => 1, | |
| 'visithor.yml.dist' => 1, | |
| 'visithorbundle.php' => 1, | |
| 'vlibtemplate.php' => 1, | |
| 'vlibini.php' => 1, | |
| 'vlibdate.php' => 1, | |
| 'virmytuserrefererbundle.php' => 1, | |
| 'auth.todo' => 1, | |
| 'oauth' => 1, | |
| 'siduspublishingbundle.php' => 1, | |
| 'sidusfilterbundle.php' => 1, | |
| 'sidusfileuploadbundle.php' => 1, | |
| 'sidusencryptionbundle.php' => 1, | |
| 'search_api_elasticsearch.module' => 1, | |
| 'search_api_elasticsearch.info' => 1, | |
| 'ebootstrapmodal.php' => 1, | |
| 'unialteritagbundle.php' => 1, | |
| 'useradapted.js' => 1, | |
| 'ads.js' => 1, | |
| 'leafletsearchasset.php' => 1, | |
| 'leafletsearch.php' => 1, | |
| 'sk_lib_i.php' => 1, | |
| 'phphypher.php' => 1, | |
| 'wp-php-console.php' => 1, | |
| 'moneytest.php' => 1, | |
| 'sample-data.json' => 1, | |
| 'mesh.php' => 1, | |
| 'databasetable.php' => 1, | |
| 'uniquelibsemberdataserializerbundle.php' => 1, | |
| 'cmediatagbundle.php' => 1, | |
| 'lib-doc.html' => 1, | |
| 'fixturegenerator.php' => 1, | |
| 'undeletelikesbundle.php' => 1, | |
| 'undeletebtceapibundle.php' => 1, | |
| 'patches.png' => 1, | |
| 'viewtwigextension.php' => 1, | |
| 'twigtemplateengine.php' => 1, | |
| 'templatingtwigextension.php' => 1, | |
| 'tmonologaware.php' => 1, | |
| 'dendecommonbundle.php' => 1, | |
| 'release-clone.php' => 1, | |
| 'get-phing.sh' => 1, | |
| 'classgenerator.php' => 1, | |
| 'readme-release' => 1, | |
| 'example_builder.php' => 1, | |
| 'objrefexamplebundle.php' => 1, | |
| 'opcache.module' => 1, | |
| 'symfonycommand.php' => 1, | |
| 'opcache.install' => 1, | |
| 'opcache.info' => 1, | |
| 'opcache.drush.inc' => 1, | |
| 'opcache.admin.inc' => 1, | |
| 'commerce_taxcloud.rules.inc' => 1, | |
| 'commerce_taxcloud.module' => 1, | |
| 'commerce_taxcloud.install' => 1, | |
| 'commerce_taxcloud.info' => 1, | |
| 'commerce_taxcloud.api.php' => 1, | |
| 'commerce_taxcloud.admin.inc' => 1, | |
| 'veganmenubundle.php' => 1, | |
| 'dunitconfig.example' => 1, | |
| 'vardiususerbundle.php' => 1, | |
| 'objrefremotebundle.php' => 1, | |
| 'vardiussecuritybundle.php' => 1, | |
| 'vardiusmenubundle.php' => 1, | |
| 'vardiusinvoicebundle.php' => 1, | |
| 'vardiusadminbundle.php' => 1, | |
| 'valondeeglebundle.php' => 1, | |
| 'valantirforumbundle.php' => 1, | |
| 'ajaxenginebundle.php' => 1, | |
| 'vvssecuritybundle.php' => 1, | |
| 'exttest.php' => 1, | |
| 'taxcloud.wsdl' => 1, | |
| 'project-readme' => 1, | |
| 'vlabsamazonmwsbundle.php' => 1, | |
| 'mwsclient.php' => 1, | |
| 'ebootstraplistviewitem.php' => 1, | |
| 'ebootstrapmodaltrigger.php' => 1, | |
| 'storageexception.php' => 1, | |
| 'cachestorage.php' => 1, | |
| 'httptrait.php' => 1, | |
| 'eventprocessor.php' => 1, | |
| 'eventmanagerexception.php' => 1, | |
| 'entitypool.php' => 1, | |
| 'entitydataextractor.php' => 1, | |
| 'entitycollection.php' => 1, | |
| 'entityattributebuilder.php' => 1, | |
| 'entityabstract.php' => 1, | |
| 'crypttrait.php' => 1, | |
| 'cryptexception.php' => 1, | |
| 'configtrait.php' => 1, | |
| 'configobject.php' => 1, | |
| 'bootstrapexception.php' => 1, | |
| 'imagetrait.php' => 1, | |
| 'sampleconfig.yaml' => 1, | |
| 'annotationstrait.php' => 1, | |
| 'webilityentityresourcebundle.php' => 1, | |
| 'resourcebundletrait.php' => 1, | |
| 'invite.php' => 1, | |
| 'webultdpayupaymentbundle.php' => 1, | |
| 'rubedo.sh' => 1, | |
| 'rubedo.bat' => 1, | |
| 'mongo.ini' => 1, | |
| 'composer.front.json' => 1, | |
| 'composer.extensions.json.dist' => 1, | |
| 'example-field-setup.php' => 1, | |
| 'cmb2-attached-posts-field.php' => 1, | |
| 'imageloader.php' => 1, | |
| 'loggertrait.php' => 1, | |
| 'wds-wp-rest-api-connect.php' => 1, | |
| 'securitytrait.php' => 1, | |
| 'storageevent.php' => 1, | |
| 'validatortrait.php' => 1, | |
| 'stdobjecttrait.php' => 1, | |
| 'stdlibtrait.php' => 1, | |
| 'factoryloadertrait.php' => 1, | |
| 'servicescope.php' => 1, | |
| 'servicemanagertrait.php' => 1, | |
| 'servicemanagerexception.php' => 1, | |
| 'servicecreator.php' => 1, | |
| 'serviceconfig.php' => 1, | |
| 'factoryargument.php' => 1, | |
| 'configcompiler.php' => 1, | |
| 'routertrait.php' => 1, | |
| 'mailerexception.php' => 1, | |
| 'resttrait.php' => 1, | |
| 'resterrorexception.php' => 1, | |
| 'serverabstract.php' => 1, | |
| 'oauth2user.php' => 1, | |
| 'oauth2request.php' => 1, | |
| 'oauth2loader.php' => 1, | |
| 'oauth2exception.php' => 1, | |
| 'mongotrait.php' => 1, | |
| 'mongoresult.php' => 1, | |
| 'mongointerface.php' => 1, | |
| 'mongoexception.php' => 1, | |
| 'mongocollection.php' => 1, | |
| 'mailertrait.php' => 1, | |
| 'attached-posts-field.png' => 1, | |
| 'wds-customizer-css.php' => 1, | |
| 'ebootstrapnavigation.php' => 1, | |
| 'scu_sort_available.php' => 1, | |
| 'volleyballfixturesbundle.php' => 1, | |
| 'volleyballfacilitybundle.php' => 1, | |
| 'volleyballenrollmentbundle.php' => 1, | |
| 'volleyballcoursebundle.php' => 1, | |
| 'vxipfieldtypebundle.php' => 1, | |
| 'vitrephpconsolebundle.php' => 1, | |
| 'limitrule.php' => 1, | |
| 'xml_parse.php' => 1, | |
| 'viewed_product.php' => 1, | |
| 'sort_scu.php' => 1, | |
| 'sestrenskyihlclass.php' => 1, | |
| 'sestrenskyiclass.php' => 1, | |
| 'script_check_comment.js' => 1, | |
| 'volleyballpasselbundle.php' => 1, | |
| 'js_examples.js' => 1, | |
| 'git_commands' => 1, | |
| 'createsmartfilterseoxml.php' => 1, | |
| 'bitrix_server_test.php' => 1, | |
| 'hl.php' => 1, | |
| 'angulartimeagoasset.php' => 1, | |
| 'ebootstrapwidget.php' => 1, | |
| 'ebootstraptabwrapper.php' => 1, | |
| 'ebootstraptabnavigation.php' => 1, | |
| 'ebootstraptabcontentwrapper.php' => 1, | |
| 'ebootstraptabcontent.php' => 1, | |
| 'ebootstrapsidebar.php' => 1, | |
| 'ebootstrapprogressbar.php' => 1, | |
| 'volleyballorganizationbundle.php' => 1, | |
| 'volleyballreportbundle.php' => 1, | |
| 'cmb2-user-select.php' => 1, | |
| 'wecodepixelspremailerbundle.php' => 1, | |
| 'post-search-field.png' => 1, | |
| 'post-search-dialog.png' => 1, | |
| 'cmb2_post_search_field.php' => 1, | |
| 'to_php_54.php' => 1, | |
| 'webconsulebayapibundle.php' => 1, | |
| 'createdoc.sh' => 1, | |
| 'console.neon' => 1, | |
| 'parameter.sql' => 1, | |
| 'create.jar' => 1, | |
| 'downloadandcompilelua.sh' => 1, | |
| 'testpush.php' => 1, | |
| 'weavingthewebframeworkextrabundle.php' => 1, | |
| 'premailer.php' => 1, | |
| 'volleyballuserbundle.php' => 1, | |
| 'silla' => 1, | |
| 'warrantylifeapiexamplebundle.php' => 1, | |
| 'sample-sender.php' => 1, | |
| 'sample-receiver.php' => 1, | |
| 'wuild.php' => 1, | |
| 'stubs.sqlite' => 1, | |
| 'stubs-generator.php' => 1, | |
| 'sliderrevolution.php' => 1, | |
| 'magnify-core.php' => 1, | |
| 'basic-auth.php' => 1, | |
| 'wdueditor.php' => 1, | |
| 'tweetarticlesbundle.php' => 1, | |
| 'projectpunchclockcorebundle.php' => 1, | |
| 'zensidecorebundle.php' => 1, | |
| 'cli-commands.png' => 1, | |
| 'directivetype.php' => 1, | |
| 'jobs.php' => 1, | |
| 'httpmessagesnewrelicmiddlewareplugin.php' => 1, | |
| 'httpmessagesfractalmiddlewareplugin.php' => 1, | |
| 'httpmessagescommercemiddlewareplugin.php' => 1, | |
| 'httpmessagescachemiddlewareplugin.php' => 1, | |
| 'httpmessagesplugin.php' => 1, | |
| 'helloworld.php~' => 1, | |
| 'related3.png' => 1, | |
| 'related2.png' => 1, | |
| 'related1.png' => 1, | |
| 'iveecoreinit.php' => 1, | |
| 'view.html' => 1, | |
| 'aimeosshopbundle.php' => 1, | |
| 'vkbundle.php' => 1, | |
| 'httpmessagesvalidationmiddlewareplugin.php' => 1, | |
| 'vkapihelperbundle.php' => 1, | |
| 'okbundle.php' => 1, | |
| 'ailovefacebookbundle.php' => 1, | |
| 'ailoveckeditorbundle.php' => 1, | |
| 'abstractsocialbundle.php' => 1, | |
| 'phpcs-validate.sh' => 1, | |
| 'tinymcepluginasset.php' => 1, | |
| 'pianosoloweatherbundle.php' => 1, | |
| 'fontawesome-markers.min.js' => 1, | |
| 'fontawesome-markers.json' => 1, | |
| 'helloworldwidget.php' => 1, | |
| 'slideshowpluginbundle.php' => 1, | |
| 'httpmessagesrestmiddlewareplugin.php' => 1, | |
| 'aivusresizerbundle.php' => 1, | |
| 'ahspushnotificationspluginbundle.php' => 1, | |
| 'asana-oauth.php' => 1, | |
| 'pimenterpriseclassificationrulebundle.php' => 1, | |
| 'tests.cmd' => 1, | |
| '.cocomoignore' => 1, | |
| 'zehir.php' => 1, | |
| 'tokenfieldasset.php' => 1, | |
| 'tokenfield.php' => 1, | |
| 'jqueryuiasset.php' => 1, | |
| 'ajstudionestedsetbundle.php' => 1, | |
| 'ajstudioinflectbundle.php' => 1, | |
| 'ajstudiocentralbankbundle.php' => 1, | |
| 'mongosearchbundle.php' => 1, | |
| 'datafaker.sql' => 1, | |
| 'ajglvalidatoresbundle.php' => 1, | |
| 'gulpbusterbundle.php' => 1, | |
| 'nievalidator.php' => 1, | |
| 'dnivalidator.php' => 1, | |
| 'cifvalidator.php' => 1, | |
| 'checksumvalidator.php' => 1, | |
| 'cccvalidator.php' => 1, | |
| 'ajgltwigextensionsbundle.php' => 1, | |
| 'ajgljqgridbundle.php' => 1, | |
| 'ajgljqueryuibundle.php' => 1, | |
| 'ajgljquerybundle.php' => 1, | |
| 'ajglh5bpbundle.php' => 1, | |
| 'ajglcpmbundle.php' => 1, | |
| 'transformation_trait_docs.html' => 1, | |
| 'paymentgatewaybundle.php' => 1, | |
| 'newscoopslideshowpluginbundle.php' => 1, | |
| 'ahspersonabundle.php' => 1, | |
| 'pimdirecttomongodbbundle.php' => 1, | |
| 'lti_tool_provider.php' => 1, | |
| 'testphpconfig.ini' => 1, | |
| 'aegisjwtauthenticationbundle.php' => 1, | |
| 'license-manager' => 1, | |
| 'stundenplan' => 1, | |
| 'portfolio.php' => 1, | |
| 'pamm.php' => 1, | |
| 'active.php' => 1, | |
| 'advancingustripesubscriptionbundle.php' => 1, | |
| 'lti-tables-oracle.sql' => 1, | |
| 'lti-tables-oracle-pdo.sql' => 1, | |
| 'lti-tables-mysql.sql' => 1, | |
| 'lti-tables-mssql.sql' => 1, | |
| 'lti_data_connector_pdo.php' => 1, | |
| 'madalynnplumbundle.php' => 1, | |
| 'lti_data_connector_oci.php' => 1, | |
| 'lti_data_connector_none.php' => 1, | |
| 'lti_data_connector_mysqli.php' => 1, | |
| 'lti_data_connector_mysql.php' => 1, | |
| 'retrieval.php' => 1, | |
| 'adticketmediabackendimagehostingbundle.php' => 1, | |
| 'adticketgeonamesbundle.php' => 1, | |
| 'adrotecwebapibundle.php' => 1, | |
| 'leyertranslationadditionbundle.php' => 1, | |
| 'abanalyzer' => 1, | |
| 'silexbundle.php' => 1, | |
| 'aboauth2facebookgrantbundle.php' => 1, | |
| 'aotranslationbundle.php' => 1, | |
| 'aequasimemcachedbundle.php' => 1, | |
| 'plum.php' => 1, | |
| 'ahsweatherpluginbundle.php' => 1, | |
| 'agentsibcrontabbundle.php' => 1, | |
| 'ahsbelferpluginbundle.php' => 1, | |
| 'platform-util' => 1, | |
| 'openpayu_php' => 1, | |
| 'first.php' => 1, | |
| 'sharkformloggerbundle.php' => 1, | |
| 'agitprofilebundle.php' => 1, | |
| 'agitpagebundle.php' => 1, | |
| 'agitcronbundle.php' => 1, | |
| 'agitapibundle.php' => 1, | |
| 'agitadminbundle.php' => 1, | |
| 'agentsibsphinxbundle.php' => 1, | |
| 'jsonrpcbundle.php' => 1, | |
| 'agazzirestclientauthenticatorbundle.php' => 1, | |
| 'codeigniterinstallerplugin.php' => 1, | |
| 'grunthashassetsbundle.php' => 1, | |
| 'wpasseticbootstrap.php' => 1, | |
| 'test_hardened.sh' => 1, | |
| 'phpunit.hardened.xml' => 1, | |
| 'afrihostbasecommandbundle.php' => 1, | |
| 'github-updater.php' => 1, | |
| 'routertest.php' => 1, | |
| 'gatewaymodule.php' => 1, | |
| 'ferrandinixhprofbundle.php' => 1, | |
| 'ferrandinipdosessionbundle.php' => 1, | |
| 'ferrandinidisablebundle.php' => 1, | |
| 'gpl-v.2.0' => 1, | |
| 'custominstaller.php' => 1, | |
| 'pimdevtoolboxbundle.php' => 1, | |
| 'pimenhancedconnectorbundle.php' => 1, | |
| 'subsiteadminextension.php' => 1, | |
| 'vector.php' => 1, | |
| 'afmasseticamazons3bundle.php' => 1, | |
| 'module.zpm' => 1, | |
| 'mailmaster.php' => 1, | |
| 'historizer.php' => 1, | |
| 'schema-oracle.sql' => 1, | |
| 'clickatellhttp.php' => 1, | |
| 'ahistorizer.php' => 1, | |
| 'alazjjsimplebootstrapbundle.php' => 1, | |
| 'horus.php' => 1, | |
| 'html-index.png' => 1, | |
| 'science.php' => 1, | |
| 'vectorinterface.php' => 1, | |
| 'length.php' => 1, | |
| 'sitestatuscheckerbundle.php' => 1, | |
| 'encrypterinterface.php' => 1, | |
| 'decrypterinterface.php' => 1, | |
| 'alamedadoctrineextensionsbundle.php' => 1, | |
| 'dateinterval.php' => 1, | |
| 'bomifier.php' => 1, | |
| 'alk13bomifierbundle.php' => 1, | |
| 'const.php' => 1, | |
| 'quicks' => 1, | |
| 'extended_parse_url' => 1, | |
| 'bank.php' => 1, | |
| 'git_pull_example.sh' => 1, | |
| 'loft_data_grids.info' => 1, | |
| 'kit_php.info' => 1, | |
| 'jpnforphpbundle.php' => 1, | |
| 'afmtranslatableroutepathbundle.php' => 1, | |
| 'user.mail.tpl' => 1, | |
| 'generate-soap' => 1, | |
| 'tdbclient.php' => 1, | |
| 'pgstmt.php' => 1, | |
| 'pgexception.php' => 1, | |
| 'nemiro.data.php.sln' => 1, | |
| 'nemiro.data.php.phpproj' => 1, | |
| 'idbclient.php' => 1, | |
| 'dbparametertype.php' => 1, | |
| 'dbparametercollection.php' => 1, | |
| 'dbparameter.php' => 1, | |
| 'connectionmode.php' => 1, | |
| 'excel-column-iterator.php' => 1, | |
| 'rurupay.config-dist.php' => 1, | |
| 'hi.php' => 1, | |
| '.gitginore' => 1, | |
| 'authsubscriber.php' => 1, | |
| 'iso3166test.php' => 1, | |
| 'iso3166.php' => 1, | |
| 'exiftool.exe' => 1, | |
| 'emailhelper.php' => 1, | |
| 'onpath.php' => 1, | |
| 'alcalynpayplugbundle.php' => 1, | |
| 'jsvars.php' => 1, | |
| 'alcalynflushonkernelterminatebundle.php' => 1, | |
| 'casuser.php' => 1, | |
| 'casinterface.php' => 1, | |
| 'experientbundle.php' => 1, | |
| 'tltanerpvbundle.php' => 1, | |
| 'user.tpl' => 1, | |
| 'user.layer.json' => 1, | |
| 'changelog-1.6' => 1, | |
| 'showcontacts.js' => 1, | |
| 'noimg.jpg' => 1, | |
| 'noimage.psd' => 1, | |
| 'noimage.png' => 1, | |
| 'mark.psd' => 1, | |
| 'manual.mht' => 1, | |
| 'manual.docx' => 1, | |
| 'imager.php' => 1, | |
| 'imager.inc.php' => 1, | |
| 'empty.png' => 1, | |
| '.mark.png' => 1, | |
| 'xlsx.php' => 1, | |
| 'mht.php' => 1, | |
| 'contacts.tpl' => 1, | |
| 'infrajs.php' => 1, | |
| 'contacts.layer.json' => 1, | |
| 'contacts.css' => 1, | |
| 'cont.php' => 1, | |
| 'cont.mail.tpl' => 1, | |
| 'builddocsontravis.sh' => 1, | |
| 'akeneomeasurebundle.php' => 1, | |
| 'pimmagentoconnectorbundle.php' => 1, | |
| 'pimicecatdemobundle.php' => 1, | |
| 'pimdeltaexportbundle.php' => 1, | |
| 'pimconnectormappingbundle.php' => 1, | |
| 'akeneobatchbundle.php' => 1, | |
| 'demoextensionbundle.php' => 1, | |
| 'pimexcelconnectorbundle.php' => 1, | |
| '.test.js' => 1, | |
| 'infrajs.js' => 1, | |
| 'user.js' => 1, | |
| 'metrika.tpl' => 1, | |
| 'sentemail.php' => 1, | |
| 'sitemap.tpl' => 1, | |
| 'seo.tpl' => 1, | |
| 'seo.layer.js' => 1, | |
| 'seo.js' => 1, | |
| 'seo.inc.php' => 1, | |
| 'seo.ext.js' => 1, | |
| 'rss.tpl' => 1, | |
| 'pages.css' => 1, | |
| 'mht.json' => 1, | |
| 'rambler.tpl' => 1, | |
| 'rambler.layer.js' => 1, | |
| 'metrika.layer.js' => 1, | |
| 'initjs.php' => 1, | |
| 'mail.layer.js' => 1, | |
| 'liveinternet.tpl' => 1, | |
| 'liveinternet.layer.js' => 1, | |
| 'counters.tpl' => 1, | |
| 'counters.layer.php' => 1, | |
| 'counters.layer.js' => 1, | |
| 'counters.json' => 1, | |
| 'analytics.tpl' => 1, | |
| 'analytics.layer.js' => 1, | |
| 'version.tpl' => 1, | |
| 'make.js' => 1, | |
| 'loader-red.gif' => 1, | |
| 'loader-green.gif' => 1, | |
| 'subsitemodelextension.php' => 1, | |
| 'adpapiuserinfo.class.php' => 1, | |
| 'zephyreditablebundle.php' => 1, | |
| 'osrssbundle.php' => 1, | |
| 'ably-loader.php' => 1, | |
| 'ably-common' => 1, | |
| 'kyelabundle.php' => 1, | |
| 'imagemagic.php' => 1, | |
| 'mail.blade.php' => 1, | |
| 'installermodule.php' => 1, | |
| 'coderefactorbundle.php' => 1, | |
| 'expandedcollectionbundle.php' => 1, | |
| 'ostoolsbundle.php' => 1, | |
| 'osormadapter.php' => 1, | |
| 'ossitemapbundle.php' => 1, | |
| 'rssgenerator.php' => 1, | |
| 'tcclass3-2011.pem' => 1, | |
| 'abcjobbundle.php' => 1, | |
| 'ospaymentbundle.php' => 1, | |
| 'openskysitemapbundle.php' => 1, | |
| 'osexcelbundle.php' => 1, | |
| 'oshookbundle.php' => 1, | |
| 'oscompanyreportsbundle.php' => 1, | |
| 'companyreports.php' => 1, | |
| 'instapush.class.php' => 1, | |
| 'maskedinputdatepicker.php' => 1, | |
| 'extendedhighcharts.php' => 1, | |
| 'formitemsfacade.php' => 1, | |
| 'slimsavant.php' => 1, | |
| 'savant.php' => 1, | |
| 'resolve_url.php' => 1, | |
| 'abcprocesscontrolbundle.php' => 1, | |
| 'wpenv.php' => 1, | |
| 'predefinedwordlistresourcehandle.php' => 1, | |
| 'wordlistnormalizerinterface.php' => 1, | |
| 'wordlistnormalizerawareproxytrait.php' => 1, | |
| 'wordlistnormalizerawareinterface.php' => 1, | |
| 'wordlistnormalizer.php' => 1, | |
| 'wordlistinterface.php' => 1, | |
| 'wordlistcomparatorinterface.php' => 1, | |
| 'wordlistcomparatorawareinterface.php' => 1, | |
| 'wordlistanalyzerinterface.php' => 1, | |
| 'wordlistanalyzerawareinterface.php' => 1, | |
| 'wordlist.php' => 1, | |
| 'sieveinterface.php' => 1, | |
| 'sieveawareinterface.php' => 1, | |
| 'overallsimilaritywordlistcomparator.php' => 1, | |
| 'abcresourcelockbundle.php' => 1, | |
| 'genericmatchertrait.php' => 1, | |
| 'fullcoveragewordlistcomparator.php' => 1, | |
| 'aggregatedsieveinterface.php' => 1, | |
| 'aggregatedmatcherinterface.php' => 1, | |
| 'aggregatedmatcher.php' => 1, | |
| 'example_config.xml' => 1, | |
| 'example-warning.ico' => 1, | |
| 'example-unknown.ico' => 1, | |
| 'example-ok.ico' => 1, | |
| 'example-critical.ico' => 1, | |
| 'doku.pdf' => 1, | |
| 'abcsequencebundle.php' => 1, | |
| 'abcschedulerbundle.php' => 1, | |
| 'grunt.js' => 1, | |
| '.wpenv.example.yml' => 1, | |
| 'guidproviderawareinterface.php' => 1, | |
| 'cachecleanerbundle.php' => 1, | |
| 'zorbusgallerybundle.php' => 1, | |
| 'zorbusfaqbundle.php' => 1, | |
| 'zorbusdocumentbundle.php' => 1, | |
| 'zorbuscontactbundle.php' => 1, | |
| 'zorbusbannerbundle.php' => 1, | |
| 'zorbusarticlebundle.php' => 1, | |
| 'ircconnection.php' => 1, | |
| 'irceventlistener.php' => 1, | |
| 'template.class.php' => 1, | |
| 'ovhbundle.php' => 1, | |
| 'ovhapi.php' => 1, | |
| 'gatekeeperbundle.php' => 1, | |
| 'php-json-server' => 1, | |
| 'zorbuslinkbundle.php' => 1, | |
| 'ziiwebfrontendbundle.php' => 1, | |
| 'ziggeo.php' => 1, | |
| 'zzseotk.php' => 1, | |
| 'hreflang-canonical-image.jpg' => 1, | |
| 'zzcleanurls.php' => 1, | |
| 'formextrabundle.php' => 1, | |
| 'galleryimagemodel.php' => 1, | |
| 'synchronize-github-drupal.bat' => 1, | |
| 'media_mediahaven.module' => 1, | |
| 'media_mediahaven.info' => 1, | |
| 'media_mediahaven.css' => 1, | |
| 'zertzphotobundle.php' => 1, | |
| 'prepros.cfg' => 1, | |
| 'zorbusglossarybundle.php' => 1, | |
| 'zorbusmenubundle.php' => 1, | |
| 'wp-cli-updates-command.php' => 1, | |
| 'baconuserbundle.php' => 1, | |
| 'pl2x-remote-purge.php' => 1, | |
| 'page.gamma.php' => 1, | |
| 'page.epsilon.php' => 1, | |
| 'page.delta.php' => 1, | |
| 'page.beta.php' => 1, | |
| 'page.alpha.php' => 1, | |
| 'pagelines-developer.php' => 1, | |
| 'nag-squelcher.php' => 1, | |
| 'thumb.png' => 1, | |
| 'container.config.php' => 1, | |
| 'a2lixtranslationformbundle.php' => 1, | |
| 'a2lixi18ndoctrinebundle.php' => 1, | |
| 'bacontranslationformbundle.php' => 1, | |
| 'zorbusnewsletterbundle.php' => 1, | |
| 'baconrdstationbundle.php' => 1, | |
| 'baconmenubundle.php' => 1, | |
| 'baconlanguagebundle.php' => 1, | |
| 'bacongeneratorbundle.php' => 1, | |
| 'baconcorebundle.php' => 1, | |
| 'blinker_test.php' => 1, | |
| 'array-converter.php' => 1, | |
| 'zzvalidationextrabundle.php' => 1, | |
| 'zzcorebundle.php' => 1, | |
| 'zzchezzzortellbundle.php' => 1, | |
| 'zrgisanewrelicbundle.php' => 1, | |
| 'zorbustrafficbundle.php' => 1, | |
| 'zorbuspollbundle.php' => 1, | |
| 'guidprovider.php' => 1, | |
| 'guidproviderawaretrait.php' => 1, | |
| 'adpapiutility.class.php' => 1, | |
| 'acseobaserestbundle.php' => 1, | |
| 'alswaggeruibundle.php' => 1, | |
| 'example-self-hosted.php' => 1, | |
| 'example-cloud.php' => 1, | |
| 'activdevnoclinebundle.php' => 1, | |
| 'xmlrpcs.inc.php' => 1, | |
| 'xmlrpc_wrappers.inc' => 1, | |
| 'xmlrpc.inc.php' => 1, | |
| 'acseosqlserverbundle.php' => 1, | |
| 'acseographicbundle.php' => 1, | |
| 'acseofastshowgeneratorbundle.php' => 1, | |
| 'acseodynamicformbundle.php' => 1, | |
| 'acseochangepasswordbundle.php' => 1, | |
| 'php-fmt.sh' => 1, | |
| 'quick-start' => 1, | |
| 'derivedkey.php' => 1, | |
| 'acquiasearchservice.php' => 1, | |
| 'acquiasearchclient.php' => 1, | |
| 'acquiasearchauthplugin.php' => 1, | |
| 'signatureabstract.php' => 1, | |
| 'servicemanageraware.php' => 1, | |
| 'randomstringnoncer.php' => 1, | |
| 'noncerinterface.php' => 1, | |
| 'noncerabstract.php' => 1, | |
| 'acquianetworkclient.php' => 1, | |
| 'jsoninterface.php' => 1, | |
| 'environmentinterface.php' => 1, | |
| 'memcacheserviceinterface.php' => 1, | |
| 'actualysdrupalcommerceconnectorbundle.php' => 1, | |
| 'dxf colortable.ods' => 1, | |
| 'memcachecredentials.php' => 1, | |
| 'aww.php' => 1, | |
| 'adpapiconnection.class.php' => 1, | |
| 'fcgiget.php' => 1, | |
| 'adnsummernotebundle.php' => 1, | |
| 'pitechkernelinterface.php' => 1, | |
| 'pitechkernel.php' => 1, | |
| 'pitechbundleinterface.php' => 1, | |
| 'pitechbundle.php' => 1, | |
| 'install_apps.sh' => 1, | |
| 'expressofoobundle.php' => 1, | |
| 'defterdar.php' => 1, | |
| 'aefeaturebundle.php' => 1, | |
| 'deruweslugifybundle.php' => 1, | |
| 'aww' => 1, | |
| 'linetype.php' => 1, | |
| 'example.lock.php' => 1, | |
| 'histogram.php' => 1, | |
| 'gauge.php' => 1, | |
| 'adanfmbeonpopapibundle.php' => 1, | |
| 'adamquailefieldsetbundle.php' => 1, | |
| 'flatbase.json' => 1, | |
| 'flatbase' => 1, | |
| 'cli-demo.gif' => 1, | |
| 'phpunit_functional.xml' => 1, | |
| 'env-example.php' => 1, | |
| 'regex.json' => 1, | |
| 'sculpin.lock' => 1, | |
| 'sculpin.json' => 1, | |
| 'memcacheservice.php' => 1, | |
| 'localenvironment.php' => 1, | |
| 'guidproviderinterface.php' => 1, | |
| 'llum' => 1, | |
| 'accestoinstallerbundle.php' => 1, | |
| 'setpayu.php' => 1, | |
| 'payupaymentfactory.php' => 1, | |
| 'payugatewayfactory.php' => 1, | |
| 'openpayuwrapper.php' => 1, | |
| 'workerbundleevents.php' => 1, | |
| 'workerbundle.php' => 1, | |
| 'remoteserverbundle.php' => 1, | |
| 'dispatcherbundle.php' => 1, | |
| 'acfwurflbundle.php' => 1, | |
| 'test_teardown.sh' => 1, | |
| 'test_setup.sh' => 1, | |
| 'old-readme' => 1, | |
| '_composer.json' => 1, | |
| 'adminlte-laravel' => 1, | |
| 'test-with-adminlte.sh' => 1, | |
| 'sandbox_setup_withadminlte.sh' => 1, | |
| 'laravoole' => 1, | |
| 'imagist' => 1, | |
| 'testkernel.php' => 1, | |
| 'memorysessionstorage.php' => 1, | |
| 'kerneltestcase.php' => 1, | |
| 'customcallbackcompilerpass.php' => 1, | |
| 'accessdeniedlistener.php' => 1, | |
| 'reflectionmethodhelper.php' => 1, | |
| 'namegeneratortrait.php' => 1, | |
| 'nameawareinterface.php' => 1, | |
| '_readme' => 1, | |
| '_phpunit.xml.dist' => 1, | |
| 'cloudenvironmentinterface.php' => 1, | |
| 'modifier.php' => 1, | |
| 'cloudenvironmentaware.php' => 1, | |
| 'cloudenvironment.php' => 1, | |
| 'databaseserviceinterface.php' => 1, | |
| 'databasecredentials.php' => 1, | |
| 'cloudapiclient.php' => 1, | |
| 'cloudapiauthplugin.php' => 1, | |
| 'composer_travis.json' => 1, | |
| 'acmephpbundle.php' => 1, | |
| 'sample_captcha.php' => 1, | |
| 'lwihdbundle.php' => 1, | |
| 'entryinterface.php' => 1, | |
| 'ac_module_internals.png' => 1, | |
| 'zmcimagebundle.php' => 1, | |
| '_travis.yml' => 1, | |
| 'aciliaviewcounterbundle.php' => 1, | |
| 'aciliavideoproviderbundle.php' => 1, | |
| 'aciliatranslationbundle.php' => 1, | |
| 'aciliasearchenginebundle.php' => 1, | |
| 'aciliaratingbundle.php' => 1, | |
| 'aciliaoauth2bundle.php' => 1, | |
| 'aciliametatagsbundle.php' => 1, | |
| 'aciliadbloggerbundle.php' => 1, | |
| 'aciliacorebundle.php' => 1, | |
| 'aciliabannerbundle.php' => 1, | |
| 'receivdata.php' => 1, | |
| 'ftpupload.php' => 1, | |
| 'webanalytics.local.php.dist' => 1, | |
| 'phoreman' => 1, | |
| 'orbitaletranslationbundle.php' => 1, | |
| 'i18n.php.example' => 1, | |
| 'phpresquebundle.php' => 1, | |
| 'cekurtemailerbundle.php' => 1, | |
| 'cekurtelivebuzzbundle.php' => 1, | |
| 'cekurteinsightlytaskbundle.php' => 1, | |
| 'cekurteinsightlybundle.php' => 1, | |
| 'cekurtegoogleapibundle.php' => 1, | |
| 'cekurtegeneratorbundle.php' => 1, | |
| 'cekurtefixturesbundle.php' => 1, | |
| 'cavejatoshlbundle.php' => 1, | |
| 'default-template.odt' => 1, | |
| 'default-template.ods' => 1, | |
| 'default-template-with-replaces.odt' => 1, | |
| 'spreadsheet.php' => 1, | |
| 'phpresque.php' => 1, | |
| 'cekurteuploaderbundle.php' => 1, | |
| 'kdbparametersbundle.php' => 1, | |
| 'res.7z' => 1, | |
| 'prepare.bash' => 1, | |
| 'integrationtest.xml' => 1, | |
| 'loadfail.php' => 1, | |
| 'errorhandling.php' => 1, | |
| 'canaltptyrbundle.php' => 1, | |
| 'canaltpsammonitoringbundle.php' => 1, | |
| 'canaltpsamecoreusermanagerbundle.php' => 1, | |
| 'canaltpsamecoresecuritybundle.php' => 1, | |
| 'commonbusinessinterface.php' => 1, | |
| 'canaltpsamecoreapplicationmanagerbundle.php' => 1, | |
| 'cekurtepagebundle.php' => 1, | |
| 'cekurteuserbundle.php' => 1, | |
| 'canaltpsamcorebundle.php' => 1, | |
| 'engines.ini.dist' => 1, | |
| 'opengraphprotocol.php' => 1, | |
| 'library.json' => 1, | |
| 'instance.sh' => 1, | |
| 'ec2-attached-volumes-snapshot.php' => 1, | |
| 'ec2-attached-volumes-prune.php' => 1, | |
| 'backup.sh.default' => 1, | |
| 'parsepowermail.php' => 1, | |
| 'chmatexcelbundle.php' => 1, | |
| 'go.bat' => 1, | |
| 'doxygen.ini.dist' => 1, | |
| 'doc.xml.dist' => 1, | |
| 'cmclasses.ini.dist' => 1, | |
| 'doc.xml' => 1, | |
| 'sepadirectdebitfile.php' => 1, | |
| 'mail.ini' => 1, | |
| 'setrights.sh' => 1, | |
| 'index.php5' => 1, | |
| 'checkfilepermissions.php' => 1, | |
| 'boot.php5' => 1, | |
| '.htpasswd' => 1, | |
| 'doc-creator.php' => 1, | |
| 'doc-creator.xml' => 1, | |
| 'compat.php' => 1, | |
| 'autoload.php5' => 1, | |
| 'common.ini' => 1, | |
| 'cethyworkszopimchatbundle.php' => 1, | |
| 'cssparsed.css' => 1, | |
| 'slugify.php' => 1, | |
| 'canaltpsamcorebridgebundle.php' => 1, | |
| 'task_restart.php' => 1, | |
| 'campaignchaincampaignscheduledcampaignbundle.php' => 1, | |
| 'campaignchaindistributioncebundle.php' => 1, | |
| 'campaignchaincorebundle.php' => 1, | |
| 'campaignchainchannelwebsitebundle.php' => 1, | |
| 'campaignchainchanneltwitterbundle.php' => 1, | |
| 'campaignchainchannellinkedinbundle.php' => 1, | |
| 'campaignchainchannelgoogleanalyticsbundle.php' => 1, | |
| 'campaignchainchannelfacebookbundle.php' => 1, | |
| 'campaignchainchannelezplatformbundle.php' => 1, | |
| 'campaignchainchannelcitrixbundle.php' => 1, | |
| 'changelog-1.0.0-beta' => 1, | |
| 'changelog-1.0.0-alpha' => 1, | |
| 'campaignchaincampaigntemplatebundle.php' => 1, | |
| 'campaignchaincampaignrepeatingbundle.php' => 1, | |
| 'campaignchainhookassigneebundle.php' => 1, | |
| 'campaignchainactivitytwitterbundle.php' => 1, | |
| 'campaignchainactivitysocialmediabundle.php' => 1, | |
| 'campaignchainactivitymailchimpbundle.php' => 1, | |
| 'campaignchainactivitylinkedinbundle.php' => 1, | |
| 'campaignchainactivitygotowebinarbundle.php' => 1, | |
| 'campaignchainactivityfacebookbundle.php' => 1, | |
| 'campaignchainactivityezplatformbundle.php' => 1, | |
| 'client-map' => 1, | |
| 'aeria.php' => 1, | |
| 'aeria-activator.php' => 1, | |
| 'alexpsocialauthbundle.php' => 1, | |
| 'stravastrategy.php' => 1, | |
| 'license.rtf' => 1, | |
| 'campaignchaindochtmlbundle.php' => 1, | |
| 'campaignchainhookdaterepeatbundle.php' => 1, | |
| 'canaltpnmmportalbundle.php' => 1, | |
| 'campaignchainoperationmailchimpbundle.php' => 1, | |
| 'canaltpnmmportalbridgebundle.php' => 1, | |
| 'navitiaprofilerbundle.php' => 1, | |
| 'navitiaexceptionfactory.php' => 1, | |
| 'abstractfactory.php' => 1, | |
| 'canaltpmediamanagerbundle.php' => 1, | |
| 'campaignchainsecurityauthenticationserveroauthbundle.php' => 1, | |
| 'campaignchainsecurityauthenticationclientoauthbundle.php' => 1, | |
| 'campaignchainreportgoogleanalyticsbundle.php' => 1, | |
| 'campaignchainreportanalyticsmetricsperactivitybundle.php' => 1, | |
| 'campaignchainreportanalyticsctatrackingbundle.php' => 1, | |
| 'campaignchainoperationtwitterbundle.php' => 1, | |
| 'campaignchainoperationsocialmediabundle.php' => 1, | |
| 'campaignchainoperationlinkedinbundle.php' => 1, | |
| 'campaignchainhookduebundle.php' => 1, | |
| 'campaignchainoperationgotowebinarbundle.php' => 1, | |
| 'campaignchainoperationfacebookbundle.php' => 1, | |
| 'campaignchainoperationezplatformbundle.php' => 1, | |
| 'campaignchainmilestonescheduledmilestonebundle.php' => 1, | |
| 'campaignchainlocationwebsitebundle.php' => 1, | |
| 'campaignchainlocationtwitterbundle.php' => 1, | |
| 'campaignchainlocationlinkedinbundle.php' => 1, | |
| 'campaignchainlocationgoogleanalyticsbundle.php' => 1, | |
| 'campaignchainlocationfacebookbundle.php' => 1, | |
| 'campaignchainlocationezplatformbundle.php' => 1, | |
| 'campaignchainlocationcitrixbundle.php' => 1, | |
| 'campaignchainhooktimespanbundle.php' => 1, | |
| 'campaignchainhookdurationbundle.php' => 1, | |
| 'yandextranslatorbundle.php' => 1, | |
| 'worker_restart.php' => 1, | |
| 'cpalexsurchargebundlebundle.php' => 1, | |
| 'doctrine1.php' => 1, | |
| 'barrating.php' => 1, | |
| 'pharer.php' => 1, | |
| 'style_guide.php' => 1, | |
| 'coderspottingtoastmessagebundle.php' => 1, | |
| 'delorean' => 1, | |
| 'twig_gear.services.yml' => 1, | |
| 'twig_gear.module' => 1, | |
| 'twig_gear.info.yml' => 1, | |
| 'angulasil.theme' => 1, | |
| 'angulasil.libraries.yml' => 1, | |
| 'angulasil.info.yml' => 1, | |
| 'script.robo' => 1, | |
| 'ffmpegmovie.php' => 1, | |
| 'barratingpluginasset.php' => 1, | |
| 'ffmpegframe.php' => 1, | |
| 'ffmpegautoloader.php' => 1, | |
| 'ffmpeganimatedgif.php' => 1, | |
| 'repositoryaliasbundle.php' => 1, | |
| 'rulesenginefactory.php' => 1, | |
| 'rulesengine.php' => 1, | |
| 'codememerulesbundle.php' => 1, | |
| 'codememeironmqbundle.php' => 1, | |
| 'codeloversloggingbundle.php' => 1, | |
| 'codeloversjshintbundle.php' => 1, | |
| 'codeloversrestbundle.php' => 1, | |
| 'codeloversphpstormbundle.php' => 1, | |
| 'barratingasset.php' => 1, | |
| 'guielement.php' => 1, | |
| 'codeloversdoctrineencryptbundle.php' => 1, | |
| 'iobject.php' => 1, | |
| 'frontcontrollerinterface.php' => 1, | |
| 'errorhandlinginterface.php' => 1, | |
| 'dateinterface.php' => 1, | |
| 'code-generator.php' => 1, | |
| 'negotiation.php' => 1, | |
| 'http-verbs.php' => 1, | |
| 'first-example.php' => 1, | |
| 'objectsinglecollection.php' => 1, | |
| 'objectmulticollection.php' => 1, | |
| 'iobjectsinglecollection.php' => 1, | |
| 'iobjectmulticollection.php' => 1, | |
| 'iobjectcollection.php' => 1, | |
| 'idb.php' => 1, | |
| 'guiframe.php' => 1, | |
| 'abstractdb.php' => 1, | |
| 'viewscontroller.php' => 1, | |
| 'methodscontroller.php' => 1, | |
| 'localconfig.php' => 1, | |
| 'idynamiccollection.php' => 1, | |
| 'dynamiccollection.php' => 1, | |
| 'responsetype.php' => 1, | |
| 'requesttype.php' => 1, | |
| 'calltype.php' => 1, | |
| 'guistring.php' => 1, | |
| 'guiscrollablewindow.php' => 1, | |
| 'guiresizeevent.php' => 1, | |
| 'guiprogressbar.php' => 1, | |
| 'typename.php' => 1, | |
| 'codeloversangularbundle.php' => 1, | |
| 'chokapixjcropimagebundle.php' => 1, | |
| 'acf-modules-setup.json' => 1, | |
| 'organismtemplate.php' => 1, | |
| 'atomtemplate.php' => 1, | |
| 'cnp-molecule-builder.php' => 1, | |
| 'queried-object-parser.php' => 1, | |
| 'print-on-present.php' => 1, | |
| 'p2p-connections.php' => 1, | |
| 'nav-filters.php' => 1, | |
| 'inline-svg.php' => 1, | |
| 'human-timing.php' => 1, | |
| 'highest-ancestor.php' => 1, | |
| 'add-favicon.php' => 1, | |
| 'acf-modules.php' => 1, | |
| 'haversine.php' => 1, | |
| 'application_enter.php' => 1, | |
| 'cnp-atom-builder.php' => 1, | |
| 'ciscajabugminerestbundle.php' => 1, | |
| 'circleutilitybundle.php' => 1, | |
| 'circlerestclientbundle.php' => 1, | |
| 'cimusgeobundle.php' => 1, | |
| 'cimusgearmanbundle.php' => 1, | |
| 'timelinejsbundle.php' => 1, | |
| 'mercurialnode.php' => 1, | |
| 'mercurialmanager.php' => 1, | |
| 'interkassabundle.php' => 1, | |
| 'christianvermeulenpostalcodebundle.php' => 1, | |
| 'christianriesenpasswordhashbundle.php' => 1, | |
| 'ckrupahubicapibundle.php' => 1, | |
| 'includes.php' => 1, | |
| 'config_social_default.php' => 1, | |
| 'codeloversaclbundle.php' => 1, | |
| '.cleantalk.class.php.swp' => 1, | |
| 'init.production.php' => 1, | |
| 'init.development.php' => 1, | |
| 'encryption.key' => 1, | |
| 'codagrestfabricationbundle.php' => 1, | |
| 'codagpredictioniobundle.php' => 1, | |
| 'codagalchemyapibundle.php' => 1, | |
| 'optionallocalebundle.php' => 1, | |
| 'db_example.sql' => 1, | |
| 'clickandmortarimportbundle.php' => 1, | |
| 'cleeng_api.php' => 1, | |
| 'cleantalkvalidator.php' => 1, | |
| 'cleantalkapi.php' => 1, | |
| 'clasticuserbundle.php' => 1, | |
| 'classpreloader.php' => 1, | |
| 'clastictextbundle.php' => 1, | |
| 'clastictaxonomybundle.php' => 1, | |
| 'clasticsecuritybundle.php' => 1, | |
| 'clasticnodebundle.php' => 1, | |
| 'clasticgeneratorbundle.php' => 1, | |
| 'clasticfrontbundle.php' => 1, | |
| 'nodeevents.php' => 1, | |
| 'clasticcorebundle.php' => 1, | |
| 'clasticblockbundle.php' => 1, | |
| 'clasticnewsbundle.php' => 1, | |
| 'clastichttpcachebundle.php' => 1, | |
| 'clasticgoogleanalyticsbundle.php' => 1, | |
| 'clasticblogbundle.php' => 1, | |
| 'testwidgetbundle.php' => 1, | |
| 'moukmoukibundle.php' => 1, | |
| 'randomstringinterface.php' => 1, | |
| 'yamm.php' => 1, | |
| 'yiiquickswapmodule.php' => 1, | |
| 'merrorhandler.php' => 1, | |
| 'bdkenquirybundle.php' => 1, | |
| 'bdkasyncdispatcherbundle.php' => 1, | |
| 'bobrdschedulerbundle.php' => 1, | |
| 'processmanager.phar' => 1, | |
| 'bobrdmessagebusbundle.php' => 1, | |
| 'architect-composer.sublime-project' => 1, | |
| 'yandexmoneygatewayfactory.php' => 1, | |
| 'graythemeasset.php' => 1, | |
| 'bluethemeasset.php' => 1, | |
| 'yammasset.php' => 1, | |
| 'blueteapushnotificationsbundle.php' => 1, | |
| 'iactivate.php' => 1, | |
| 'blueteajirarestapibundle.php' => 1, | |
| 'blueteaimportevents.php' => 1, | |
| 'blueteaimportbundle.php' => 1, | |
| 'blueteaexportevents.php' => 1, | |
| 'blueteaexportbundle.php' => 1, | |
| 'blueteacrowdauthenticationbundle.php' => 1, | |
| 'testdox-output' => 1, | |
| 'create-sqlite.sql' => 1, | |
| 'create-pgsql.sql' => 1, | |
| 'create-mysql.sql' => 1, | |
| 'test results' => 1, | |
| 'pubspec.yaml' => 1, | |
| 'admin.info' => 1, | |
| 'data_tools.info' => 1, | |
| 'bloghovenjekyllproviderbundle.php' => 1, | |
| 'botanickserializerbundle.php' => 1, | |
| 'woocommerce-role-based-coupons.php' => 1, | |
| 'bs-unset-free.php' => 1, | |
| 'divi_cpt_builder.php' => 1, | |
| '.php.tags' => 1, | |
| 'bbitsqscommandqueuebundle.php' => 1, | |
| 'subtree.sh' => 1, | |
| 'bbitblogbundle.php' => 1, | |
| 'bbitauditlogbundle.php' => 1, | |
| 'bbitasyncdispatcherbundle.php' => 1, | |
| 'branchbitairgrambundle.php' => 1, | |
| 'cortex-plugin.php' => 1, | |
| '.envrc' => 1, | |
| 'expect.php' => 1, | |
| 'data_tools.php' => 1, | |
| 'imagsimplecachebundle.php' => 1, | |
| 'imagnotifierbundle.php' => 1, | |
| 'bomoicalbundle.php' => 1, | |
| 'imagfilesbundle.php' => 1, | |
| 'imagetherpadbundle.php' => 1, | |
| 'imagcsvbundle.php' => 1, | |
| 'toolsconvert.php' => 1, | |
| 'toolsblanknode.php' => 1, | |
| 'parserturtle.php' => 1, | |
| 'parsersparqlresult.php' => 1, | |
| 'conversionmimetype.php' => 1, | |
| 'eyiipdf.php' => 1, | |
| 'downloader.php' => 1, | |
| 'bluebearbasebundle.php' => 1, | |
| 'bloghovenblosxomdirproviderbundle.php' => 1, | |
| 'todo.dev' => 1, | |
| 'module-payment.csv' => 1, | |
| 'module-sales-sequence.csv' => 1, | |
| 'module-sales-rule.csv' => 1, | |
| 'module-rule.csv' => 1, | |
| 'module-rss.csv' => 1, | |
| 'module-review.csv' => 1, | |
| 'module-require-js.csv' => 1, | |
| 'module-reports.csv' => 1, | |
| 'module-quote.csv' => 1, | |
| 'module-product-video.csv' => 1, | |
| 'module-product-alert.csv' => 1, | |
| 'module-persistent.csv' => 1, | |
| 'module-paypal.csv' => 1, | |
| 'module-page-cache.csv' => 1, | |
| 'module-search.csv' => 1, | |
| 'module-offline-shipping.csv' => 1, | |
| 'module-offline-payments.csv' => 1, | |
| 'module-newsletter.csv' => 1, | |
| 'module-multishipping.csv' => 1, | |
| 'module-msrp.csv' => 1, | |
| 'module-media-storage.csv' => 1, | |
| 'module-marketplace.csv' => 1, | |
| 'module-layered-navigation.csv' => 1, | |
| 'module-integration.csv' => 1, | |
| 'module-indexer.csv' => 1, | |
| 'module-import-export.csv' => 1, | |
| 'module-grouped-product.csv' => 1, | |
| 'module-grouped-import-export.csv' => 1, | |
| 'module-sales.csv' => 1, | |
| 'module-send-friend.csv' => 1, | |
| 'bloghovenblogbundle.php' => 1, | |
| 'module-webapi.csv' => 1, | |
| 'bloghovenabstractthemebundle.php' => 1, | |
| 'phpdoccheck' => 1, | |
| 'pluginconfig.php.example' => 1, | |
| 'loggerconfig.php.example' => 1, | |
| 'daemonise' => 1, | |
| '.phpci.yml' => 1, | |
| 'octocmd' => 1, | |
| 'theme-frontend-luma.csv' => 1, | |
| 'theme-frontend-blank.csv' => 1, | |
| 'module-wishlist.csv' => 1, | |
| 'module-widget.csv' => 1, | |
| 'module-weee.csv' => 1, | |
| 'module-version.csv' => 1, | |
| 'module-shipping.csv' => 1, | |
| 'module-variable.csv' => 1, | |
| 'module-usps.csv' => 1, | |
| 'module-user.csv' => 1, | |
| 'module-url-rewrite.csv' => 1, | |
| 'module-ups.csv' => 1, | |
| 'module-ui.csv' => 1, | |
| 'module-translation.csv' => 1, | |
| 'module-theme.csv' => 1, | |
| 'module-tax.csv' => 1, | |
| 'module-tax-import-export.csv' => 1, | |
| 'module-swatches.csv' => 1, | |
| 'module-store.csv' => 1, | |
| 'module-sitemap.csv' => 1, | |
| 'woocommerce-referralcandy.php' => 1, | |
| 'bfosbrasilbundle.php' => 1, | |
| 'cpalexdashboardbundle.php' => 1, | |
| 'bureaupieperstoreebundle.php' => 1, | |
| 'media_bynder.install' => 1, | |
| 'media_bynder.info' => 1, | |
| 'media_bynder.css' => 1, | |
| 'bushidoioqrcodebundle.php' => 1, | |
| 'bushidoiopdfbundle.php' => 1, | |
| 'wsdl.php' => 1, | |
| 'autodiscover.php' => 1, | |
| 'part.php' => 1, | |
| 'glaze-old.php' => 1, | |
| 'keyvaluecontainer.php' => 1, | |
| 'burgovkeyvalueformbundle.php' => 1, | |
| 'burgovcmsbundle.php' => 1, | |
| 'thunder.profile' => 1, | |
| 'eventmapper.php' => 1, | |
| 'thunder.install' => 1, | |
| 'thunder.info.yml' => 1, | |
| 'premake.sh' => 1, | |
| 'drupal-org.make.yml' => 1, | |
| 'drupal-org-core.make.yml' => 1, | |
| 'drupal-org-core.make' => 1, | |
| 'develop.make.yml' => 1, | |
| 'develop.make' => 1, | |
| 'build-thunder.make.yml' => 1, | |
| 'build-thunder.make' => 1, | |
| 'ivw_integration.tokens.inc' => 1, | |
| 'ivw_integration.services.yml' => 1, | |
| 'ivw_integration.routing.yml' => 1, | |
| 'media_bynder.module' => 1, | |
| 'ccetcerrorreportbundle.php' => 1, | |
| 'ivw_integration.links.menu.yml' => 1, | |
| 'update_production.sh' => 1, | |
| 'simucpabundle.php' => 1, | |
| 'simusantechatbundle.php' => 1, | |
| 'convconvbundle.php' => 1, | |
| 'cpasimusanteexoverridebundle.php' => 1, | |
| 'cpasimusantesimusanteoverridebundle.php' => 1, | |
| 'cpasimusantesimupollbundle.php' => 1, | |
| 'cpasimusanteprocompetencybundle.php' => 1, | |
| 'cpasimusanteitemselectorbundle.php' => 1, | |
| 'cpasimusanteclarolinelayoutoverridebundle.php' => 1, | |
| 'cpasimusanteclacoadminbundle.php' => 1, | |
| 'cpasimusantechartnewbundle.php' => 1, | |
| 'cpasimusantechartjsbundle.php' => 1, | |
| 'management_utils.sh' => 1, | |
| 'ccetcdirectorybundle.php' => 1, | |
| 'install_config.sh' => 1, | |
| 'env_config.base' => 1, | |
| 'email_config.base' => 1, | |
| 'db_config.base' => 1, | |
| 'schemasyncwrapper.sh' => 1, | |
| 'config.autoload.dao.orm.global.php' => 1, | |
| 'config.autoload.auth.page.local.php' => 1, | |
| 'config.autoload.auth.login.local.php' => 1, | |
| 'ngen_ant.xml' => 1, | |
| 'certunlpngenbundle.php' => 1, | |
| 'libkml.php' => 1, | |
| 'ccetcimportbundle.php' => 1, | |
| 'ccetcdirectoryuserbundle.php' => 1, | |
| 'ivw_integration.module' => 1, | |
| 'ivw_integration.install' => 1, | |
| 'bfosfretebraspressbundle.php' => 1, | |
| 'aceadminjqgridasset.php' => 1, | |
| 'scehma' => 1, | |
| 'configuration.yml' => 1, | |
| 'broutouspageeditorbundle.php' => 1, | |
| 'pulseconnect.php' => 1, | |
| 'briteapicontact.php' => 1, | |
| 'briteapiclient.php' => 1, | |
| 'default.ini' => 1, | |
| 'restsdk.php' => 1, | |
| 'enabledinterface.php' => 1, | |
| 'example-layout.php' => 1, | |
| 'aceadminwysiwygasset.php' => 1, | |
| 'aceadminwizardasset.php' => 1, | |
| 'aceadminasset.php' => 1, | |
| 'smarthome.php' => 1, | |
| 'skin.json' => 1, | |
| 'script.sh' => 1, | |
| 'refreshed.skin.php' => 1, | |
| 'brein-api-library-php.iml' => 1, | |
| 'bfostwigextensionsbundle.php' => 1, | |
| 'bfossynccontentbundle.php' => 1, | |
| 'bfossettingsmanagementbundle.php' => 1, | |
| 'bfospagsegurobundle.php' => 1, | |
| 'bfospagamentodigitalbundle.php' => 1, | |
| 'bfospagamentobundle.php' => 1, | |
| 'bfosnotafiscalbundle.php' => 1, | |
| 'bfosgatewaylocawebbundle.php' => 1, | |
| 'bfosfretebundle.php' => 1, | |
| 'mysqli.php' => 1, | |
| 'cltr.php' => 1, | |
| 'ivw_integration.info.yml' => 1, | |
| 'bukashk0zzztimestamptypebundle.php' => 1, | |
| 'breakpoint_js_settings.routing.yml' => 1, | |
| 'breakpoint_js_settings.module' => 1, | |
| 'breakpoint_js_settings.links.menu.yml' => 1, | |
| 'breakpoint_js_settings.info.yml' => 1, | |
| 'ad_integration.tokens.inc' => 1, | |
| 'ad_integration.services.yml' => 1, | |
| 'ad_integration.routing.yml' => 1, | |
| 'ad_integration.module' => 1, | |
| 'ad_integration.links.menu.yml' => 1, | |
| 'ad_integration.libraries.yml' => 1, | |
| 'ad_integration.install' => 1, | |
| 'ad_integration.info.yml' => 1, | |
| 'sample-microbilt.php' => 1, | |
| 'vk_methods' => 1, | |
| 'microbiltwsdlclass.php' => 1, | |
| 'microbiltclassmap.php' => 1, | |
| 'microbiltautoload.php' => 1, | |
| 'bukashk0zzzliipimagineserializationbundle.php' => 1, | |
| 'bukashk0zzzhellosignbundle.php' => 1, | |
| 'bukashk0zzzfilterbundle.php' => 1, | |
| 'file2add' => 1, | |
| 'default.xlf' => 1, | |
| 'branch_beta' => 1, | |
| 'modulebotstatisticsversion.php' => 1, | |
| 'composer.json.back' => 1, | |
| 'yadr.php' => 1, | |
| 'vkdr.php' => 1, | |
| 'numbertotextinterface.php' => 1, | |
| 'siteinterface.php' => 1, | |
| 'module-google-analytics.csv' => 1, | |
| 'eccube_install.sh' => 1, | |
| 'egyg33kcsvbundle.php' => 1, | |
| 'eetestsgeneratorbundle.php' => 1, | |
| 'eetysbundle.php' => 1, | |
| 'eelightuserbundle.php' => 1, | |
| 'eeextramailerbundle.php' => 1, | |
| 'eeexceptionjsbundle.php' => 1, | |
| 'eeembedlybundle.php' => 1, | |
| 'eedataexporterbundle.php' => 1, | |
| 'edsitechsirtrevorbundle.php' => 1, | |
| 'saferedisclient.php' => 1, | |
| 'redisguzzlecache.php' => 1, | |
| 'edsitechgandibundle.php' => 1, | |
| 'campaigncommandernotificationmessagingexception.php' => 1, | |
| 'epicr2riobundle.php' => 1, | |
| 'campaigncommandernotificationmessaging.php' => 1, | |
| 'campaigncommandermemberexception.php' => 1, | |
| 'campaigncommandermember.php' => 1, | |
| 'evencesoftdeleteableextensionbundle.php' => 1, | |
| 'evencegridbundle.php' => 1, | |
| 'voicesofpoll.php' => 1, | |
| 'polldb.php' => 1, | |
| 'dwollaswagger.php' => 1, | |
| 'dbsr_gui_bootstrapper.php' => 1, | |
| 'dbsr_gui.php' => 1, | |
| 'dbsr_cli_bootstrapper.php' => 1, | |
| 'dbsr_cli.php' => 1, | |
| 'egyg33kdomainparserbundle.php' => 1, | |
| 'esnesnbundle.php' => 1, | |
| 'dudytzdoctrineuuidbundle.php' => 1, | |
| 'workerregistry.php' => 1, | |
| 'poi.php' => 1, | |
| 'voice.php' => 1, | |
| 'transfer.php' => 1, | |
| 'shortvideo.php' => 1, | |
| 'music.php' => 1, | |
| 'encryptionexception.php' => 1, | |
| 'devicehttpexception.php' => 1, | |
| 'init-error-handling.php' => 1, | |
| 'init-environment.php' => 1, | |
| '.ppi-settings.json' => 1, | |
| '.ppi-settings-metadata.json' => 1, | |
| '.eipi.json' => 1, | |
| 'serviceawareworkerfactory.php' => 1, | |
| 'etsechosignbundle.php' => 1, | |
| 'exsystworkerbundle.php' => 1, | |
| 'workerpool.php' => 1, | |
| 'workerfactory.php' => 1, | |
| 'sharedworkerimplementationinterface.php' => 1, | |
| 'sharedworker.php' => 1, | |
| 'rawworkerimplementationinterface.php' => 1, | |
| 'eventedworkerimplementationinterface.php' => 1, | |
| 'exsystsecuritybundle.php' => 1, | |
| 'stateinterface.php' => 1, | |
| 'sink.php' => 1, | |
| 'selectableinterface.php' => 1, | |
| 'exsystapibundle.php' => 1, | |
| 'etspaymentdotpaybundle.php' => 1, | |
| 'dbsr.php' => 1, | |
| 'dzcronmanagerbundle.php' => 1, | |
| 'badrequestexception.php' => 1, | |
| 'difanecontentpartbundle.php' => 1, | |
| 'divipropelloggerbundle.php' => 1, | |
| 'orkestraapcbundle.php' => 1, | |
| 'diviajaxloginbundle.php' => 1, | |
| 'ddgetdocuments_snippet.php' => 1, | |
| 'modx.ddtools.class.php' => 1, | |
| 'displore.json' => 1, | |
| 'deploymentbundle.php' => 1, | |
| 'dildenfeedbackasset.php' => 1, | |
| 'dildenfeedback.php' => 1, | |
| 'mikepearceeasybacklogapibundle.php' => 1, | |
| 'helper.less' => 1, | |
| 'difanetwigdatabasebundle.php' => 1, | |
| 'robin.class.php' => 1, | |
| 'exiguousecommerceitem.php' => 1, | |
| 'yiidisquswidget.php' => 1, | |
| 'actionplugin.php' => 1, | |
| 'aclpath.php' => 1, | |
| 'consoledemo.php' => 1, | |
| 'console-php.php' => 1, | |
| 'ecommerce.xsd' => 1, | |
| 'entitygeneratorbundle.php' => 1, | |
| 'hofplexexportbundle.php' => 1, | |
| 'treenodesreorderaction.php' => 1, | |
| 'treenodemoveaction.php' => 1, | |
| 'jstreeassetbundle.php' => 1, | |
| 'contextmenuhelper.php' => 1, | |
| 'adjacencyfulltreedataaction.php' => 1, | |
| 'basketitem.php' => 1, | |
| 'djamygooglecalendarbundle.php' => 1, | |
| 'rootca' => 1, | |
| '_before_test.php' => 1, | |
| 'drensoicalbundle.php' => 1, | |
| 'example.html.php' => 1, | |
| 'sqls.iml' => 1, | |
| 'typo3.xml' => 1, | |
| 'qa.xml' => 1, | |
| 'ladder.json.sample' => 1, | |
| 'license-orig' => 1, | |
| 'naith.php' => 1, | |
| 'naith' => 1, | |
| 'naithjunitreport.class.php' => 1, | |
| 'naithclirunner.class.php' => 1, | |
| 'naithclireport.class.php' => 1, | |
| 'templator.php' => 1, | |
| 'davidjegatasseticminifierbundle.php' => 1, | |
| 'templator.js' => 1, | |
| 'devreadme' => 1, | |
| 'logintemplate.tpl' => 1, | |
| 'commonjs.php' => 1, | |
| 'beforeaftercontrollershooksbundle.php' => 1, | |
| 'dwdqiniusdkbundle.php' => 1, | |
| 'dowdowleagueoflegendsapibundle.php' => 1, | |
| 'src.zip' => 1, | |
| 'mysheet.tar' => 1, | |
| 'sam.json.example' => 1, | |
| '.scutinizer.yml' => 1, | |
| 'djegjambundle.php' => 1, | |
| 'davidjegatjimportbundle.php' => 1, | |
| 'semantic.php' => 1, | |
| 'guard.php' => 1, | |
| 'activerecordbehavior.php' => 1, | |
| 'pure' => 1, | |
| 'elorfinresourcebundle.php' => 1, | |
| 'elorfinjsonapibundle.php' => 1, | |
| 'oxidfactory.php' => 1, | |
| 'oxidawaretrait.php' => 1, | |
| 'oxidawareinterface.php' => 1, | |
| 'oxidaware.php' => 1, | |
| 'databaseinstaller.php' => 1, | |
| 'assettransitions.php' => 1, | |
| 'search_hooks.php' => 1, | |
| 'icondirect.php' => 1, | |
| 'topicposts.php' => 1, | |
| 'elgg.xml' => 1, | |
| 'console.config.php.example' => 1, | |
| 'elsassseeraiweresarticlebundle.php' => 1, | |
| 'monologfluentdbundle.php' => 1, | |
| 'elendevwidgetbundle.php' => 1, | |
| 'elendevroxyfilemanbundle.php' => 1, | |
| 'simpleimageproxyfactory.php' => 1, | |
| 'simpleimageproxy.php' => 1, | |
| 'nofileimageproxy.php' => 1, | |
| 'imageproxyfactory.php' => 1, | |
| 'imageproxy.php' => 1, | |
| 'elendevimagebundle.php' => 1, | |
| 'elendevcheckoutbundle.php' => 1, | |
| 'checkoutserviceprovider.php' => 1, | |
| 'checkoutservice.php' => 1, | |
| 'elorfinuserbundle.php' => 1, | |
| 'elsassseeraiweresbarbundle.php' => 1, | |
| 'elasticpushbundle.php' => 1, | |
| 'omnidesk.php' => 1, | |
| 'modelguidbase.php' => 1, | |
| 'managerbase.php' => 1, | |
| 'componentbase.php' => 1, | |
| 'epdoctrinelockbundle.php' => 1, | |
| 'epdisplaybundle.php' => 1, | |
| 'epasynceventdispatcherbundle.php' => 1, | |
| 'basebox' => 1, | |
| 'frisbee-demo.gif' => 1, | |
| 'plafile.yml' => 1, | |
| 'phpsql.php' => 1, | |
| 'oneline.php' => 1, | |
| 'phpa2o.php' => 1, | |
| 'cachesubscriber.php' => 1, | |
| 'elsassseeraiweresmenubundle.php' => 1, | |
| 'twiginflectionbundle.php' => 1, | |
| 'twigcachebundle.php' => 1, | |
| 'simplearraybundle.php' => 1, | |
| 'placeholditprovider.php' => 1, | |
| 'gravatarbundle.php' => 1, | |
| 'fakerserviceprovider.php' => 1, | |
| 'fakerbundle.php' => 1, | |
| 'embedlyserviceprovider.php' => 1, | |
| 'embedlybundle.php' => 1, | |
| 'emagistermemcachedbundle.php' => 1, | |
| 'tabular.php' => 1, | |
| 'composer.json.meow' => 1, | |
| 'elsassseeraiweresuserbundle.php' => 1, | |
| 'checkoutresult.php' => 1, | |
| 'webprofilerextrabundle.php' => 1, | |
| 'staff.php' => 1, | |
| 'suggestions.php' => 1, | |
| 'zipcodevalidator.php' => 1, | |
| 'pricevalidator.php' => 1, | |
| 'paymentresponse.php' => 1, | |
| 'omnikassa.php' => 1, | |
| '.phpqa.yml' => 1, | |
| 'edgetexybundle.php' => 1, | |
| 'overseer.php' => 1, | |
| 'edgeanalyticsbundle.php' => 1, | |
| 'edge5appbackendbundle.php' => 1, | |
| 'stringtype.php' => 1, | |
| 'arraytype.php' => 1, | |
| 'tweets.php' => 1, | |
| 'streaming.php' => 1, | |
| 'psyduck.php' => 1, | |
| 'saved.php' => 1, | |
| 'friends.php' => 1, | |
| 'directmessage.php' => 1, | |
| 'fql.php' => 1, | |
| 'venue.php' => 1, | |
| 'organizer.php' => 1, | |
| 'fileoperations.php' => 1, | |
| 'accounts.php' => 1, | |
| 'generatedcodebar.php' => 1, | |
| 'config.rb.dst' => 1, | |
| 'phpspec.travis.yml' => 1, | |
| 'propel.yml' => 1, | |
| 'easytekdoctrinecacheinvalidatorbundle.php' => 1, | |
| 'eduardtrayanfaststoragebundle.php' => 1, | |
| 'hasherinterface.php' => 1, | |
| 'twigprofilerengine.php' => 1, | |
| 'cli-dom' => 1, | |
| 'elaoerrornotifierbundle.php' => 1, | |
| 'elaothemetwitterbootstrap3bundle.php' => 1, | |
| 'elaoparameterizerbundle.php' => 1, | |
| 'elaojsonhttpformbundle.php' => 1, | |
| 'elaoformtranslationbundle.php' => 1, | |
| 'elaoformbundle.php' => 1, | |
| 'elaobrowserdetectorbundle.php' => 1, | |
| 'elaoadminbundle.php' => 1, | |
| 'elaocmsslotbundle.php' => 1, | |
| 'notes tbd' => 1, | |
| 'cli-xed' => 1, | |
| 'hls-downloader-cli' => 1, | |
| 'xpath-cli' => 1, | |
| 'hashertrait.php' => 1, | |
| 'ua.list' => 1, | |
| 'cli-cache' => 1, | |
| 'cache-cli' => 1, | |
| 'phpunit_1.xml' => 1, | |
| '.gitignore_1' => 1, | |
| 'uricomponentinterface.php' => 1, | |
| 'tld.php' => 1, | |
| 'schemes.php' => 1, | |
| 'httpscheme.php' => 1, | |
| 'constantstrait.php' => 1, | |
| 'standarddeshasher.php' => 1, | |
| 'saltinterface.php' => 1, | |
| 'hashes.php' => 1, | |
| 'aqlexpression.php' => 1, | |
| 'acehelper.php' => 1, | |
| 'textinterface.php' => 1, | |
| 'phplinqprovider.sln' => 1, | |
| 'croncronbundle.php' => 1, | |
| 'installhandler.php' => 1, | |
| 'templates' => 1, | |
| 'courtyardforumbundle.php' => 1, | |
| 'inkstandplugintestbundle.php' => 1, | |
| 'basic-example.php' => 1, | |
| 'twigprofiledengine.php' => 1, | |
| 'corespheretwigprofilerbundle.php' => 1, | |
| 'controllerserviceprovider.php' => 1, | |
| 'controllerinspector.php' => 1, | |
| 'randlib.c.patch' => 1, | |
| 'phplinqprovider.v12.suo' => 1, | |
| 'wordpress.sh' => 1, | |
| 'crossknowledgedevicedetectbundle.php' => 1, | |
| 'speed-up-essentials-plugin.php' => 1, | |
| 'screenshot_categories.jpg' => 1, | |
| 'screenshot_access_rights.jpg' => 1, | |
| 'screenshot_categories_view.jpg' => 1, | |
| 'screenshot_backend_view.jpg' => 1, | |
| 'tiersarchivagemap.php' => 1, | |
| 'tiersarchivage.php' => 1, | |
| 'ecoffrefort.php' => 1, | |
| 'consoneoecoffrefortbundle.php' => 1, | |
| 'coffremap.php' => 1, | |
| 'coffre.php' => 1, | |
| 'connectsbtranslationbundle.php' => 1, | |
| 'crossknowledgedatatablebundle.php' => 1, | |
| 'crowdreactivecloudresizerbundle.php' => 1, | |
| 'connecthollandpiccolocontentbundle.php' => 1, | |
| 'audittrailmodule.php' => 1, | |
| 'd2personmodule.php' => 1, | |
| 'd2messagesmodule.php' => 1, | |
| 'd2mailermodule.php' => 1, | |
| 'd2fixrmodule.php' => 1, | |
| 'd2finvmodule.php' => 1, | |
| 'd2filesmodule.php' => 1, | |
| 'd2companymodule.php' => 1, | |
| 'd2calendarmodule.php' => 1, | |
| 'd1statusmodule.php' => 1, | |
| 'd1filesmodule.php' => 1, | |
| 'translation_app.php' => 1, | |
| 'd1companymodule.php' => 1, | |
| 'personal_finance_level_data.sql' => 1, | |
| 'spell' => 1, | |
| 'd1systemmodule.php' => 1, | |
| 'edifactdatamodule.php' => 1, | |
| 'dbdiff' => 1, | |
| 'flitch' => 1, | |
| 'dabsquaredmssqlbundle.php' => 1, | |
| 'dabsquaredpushnotificationsbundle.php' => 1, | |
| 'cydopresenterbundle.php' => 1, | |
| 'cuteninjapersonabundle.php' => 1, | |
| 'cuteninjaparabolabundle.php' => 1, | |
| 'cuteninjamemoriabundle.php' => 1, | |
| 'cscorebundle.php' => 1, | |
| 'xmltemp.xml' => 1, | |
| 'xmlgenerator.php' => 1, | |
| 'tulipapibundle.php' => 1, | |
| 'connecthollandpiccolocmsbundle.php' => 1, | |
| 'finvmodule.php' => 1, | |
| 'lengthexception.php' => 1, | |
| 'handleresponseinterface.php' => 1, | |
| 'formatinterface.php' => 1, | |
| 'fieldhandlerusagetrait.php' => 1, | |
| 'fieldhandlerinterface.php' => 1, | |
| 'constraintinterface.php' => 1, | |
| 'unexpectedvalueexception.php' => 1, | |
| 'underflowexception.php' => 1, | |
| 'rangeexception.php' => 1, | |
| 'overflowexception.php' => 1, | |
| 'outofrangeexception.php' => 1, | |
| 'outofboundsexception.php' => 1, | |
| 'logicexception.php' => 1, | |
| 'exceptioninterface.php' => 1, | |
| 'redirectinterface.php' => 1, | |
| 'exceptionhandlerinterface.php' => 1, | |
| 'errorthrownasexception.php' => 1, | |
| 'domainexception.php' => 1, | |
| 'badfunctioncallexception.php' => 1, | |
| 'usereventinterface.php' => 1, | |
| 'updateeventinterface.php' => 1, | |
| 'triggerinterface.php' => 1, | |
| 'systemeventinterface.php' => 1, | |
| 'readeventinterface.php' => 1, | |
| 'initialiseeventinterface.php' => 1, | |
| 'displayeventinterface.php' => 1, | |
| 'deleteeventinterface.php' => 1, | |
| 'createeventinterface.php' => 1, | |
| 'validateresponseinterface.php' => 1, | |
| 'uploadinterface.php' => 1, | |
| 'urlhistorybehavior.php' => 1, | |
| 'paginationinterface.php' => 1, | |
| 'urlhistory.php' => 1, | |
| 'userdatainterface.php' => 1, | |
| 'messagesinterface.php' => 1, | |
| 'flashmessageinterface.php' => 1, | |
| 'encryptinterface.php' => 1, | |
| 'cookieinterface.php' => 1, | |
| 'authorisationinterface.php' => 1, | |
| 'authenticationinterface.php' => 1, | |
| 'activityinterface.php' => 1, | |
| 'namespaceinterface.php' => 1, | |
| 'classloaderinterface.php' => 1, | |
| 'parseinterface.php' => 1, | |
| 'updatemodelinterface.php' => 1, | |
| 'factorybatchinterface.php' => 1, | |
| 'updatecontrollerinterface.php' => 1, | |
| 'readmodelinterface.php' => 1, | |
| 'readcontrollerinterface.php' => 1, | |
| 'queryusagetrait.php' => 1, | |
| 'modelregistryinterface.php' => 1, | |
| 'initialisecontrollerinterface.php' => 1, | |
| 'deletemodelinterface.php' => 1, | |
| 'deletecontrollerinterface.php' => 1, | |
| 'createmodelinterface.php' => 1, | |
| 'createcontrollerinterface.php' => 1, | |
| 'translateinterface.php' => 1, | |
| 'captureuntranslatedstringinterface.php' => 1, | |
| 'scheduleinterface.php' => 1, | |
| 'd2tasksmodule.php' => 1, | |
| 'personmodule.php' => 1, | |
| 'aceasset.php' => 1, | |
| 'datavalues.php' => 1, | |
| 'decibel.config.php' => 1, | |
| 'mustache.php' => 1, | |
| 'preview.jpg' => 1, | |
| 'ajaxpageloading.js' => 1, | |
| 'trovitapi.php' => 1, | |
| 'paris-generator' => 1, | |
| 'shellstartup.php' => 1, | |
| 'davidmikesimonbotticellibundle.php' => 1, | |
| 'davidforestimgbundle.php' => 1, | |
| 'davidbadurafixturesbundle.php' => 1, | |
| 'davidbadurafakerbundle.php' => 1, | |
| 'cf.php' => 1, | |
| 'datavalues.mw.php' => 1, | |
| 'decibel.manifest.xml' => 1, | |
| 'datavalues.i18n.php' => 1, | |
| 'dolldapbundle.php' => 1, | |
| 'darvinwebmaillinkerbundle.php' => 1, | |
| 'darvinutilsbundle.php' => 1, | |
| 'darvinuserbundle.php' => 1, | |
| 'darvinsitemapbundle.php' => 1, | |
| 'darvinimagebundle.php' => 1, | |
| 'darvincontentbundle.php' => 1, | |
| 'darvinbotdetectorbundle.php' => 1, | |
| 'nntmux' => 1, | |
| 'nnbase.php' => 1, | |
| 'two.php' => 1, | |
| 'three.php' => 1, | |
| 'decibel.info.php' => 1, | |
| 'decibel.php' => 1, | |
| 'wallposterbundle.php' => 1, | |
| 'derstoffelcarreraloggerbundle.php' => 1, | |
| 'ace.php' => 1, | |
| 'aureolmanagerbundle.php' => 1, | |
| 'd4mebaybundle.php' => 1, | |
| 'permissiontrait.php' => 1, | |
| 'laravelpermissionrolesserviceprovider.php' => 1, | |
| 'cli-install.php' => 1, | |
| 'deskpro-api.php' => 1, | |
| 'dprepobundle.php' => 1, | |
| 'exportation_documentation' => 1, | |
| 'license.jscookmenu' => 1, | |
| 'readme.php-saml' => 1, | |
| 'license.php-saml' => 1, | |
| 'apiauth.php' => 1, | |
| 'decibel.tables.xml' => 1, | |
| 'recordreplacer.php' => 1, | |
| 'kmjzillowbundle.php' => 1, | |
| 'kmjupdatebundle.php' => 1, | |
| 'kmjtoolkitbundle.php' => 1, | |
| 'kmjsyncbundle.php' => 1, | |
| 'kmjpaypalbridgebundle.php' => 1, | |
| 'kmjcronbundle.php' => 1, | |
| 'kmjchanneladvisorbundle.php' => 1, | |
| 'kmjawsbundle.php' => 1, | |
| 'calendarlinks.php' => 1, | |
| 'defaultvalueakeneoinlineeditbundle.php' => 1, | |
| 'deepomatic.php' => 1, | |
| 'decibeluninstaller.php' => 1, | |
| 'one.php' => 1, | |
| 'recaptchabundle.php' => 1, | |
| 'tlbexcel.php' => 1, | |
| 'srceen_shot_list_settings.png' => 1, | |
| 'formatnum.i18n.magic.php' => 1, | |
| 'formatnum.hooks.php' => 1, | |
| 'dzunkeslackbundle.php' => 1, | |
| 'dzunkefeatureflagsbundle.php' => 1, | |
| 'genconfig.php' => 1, | |
| 'iocapp' => 1, | |
| 'test-steam-api-key.php_sample' => 1, | |
| 'treeassets.php' => 1, | |
| 'tcpdi_parser.php' => 1, | |
| 'tcpdi.php' => 1, | |
| 'selenium-server.jar' => 1, | |
| 'dhorchlersympatchbundle.php' => 1, | |
| 'srceen_shot_edit_multiplechoice_setting.png' => 1, | |
| 'formatnum.php' => 1, | |
| 'srceen_shot_edit_integer_setting.png' => 1, | |
| 'srceen_shot_edit_date_setting.png' => 1, | |
| 'dhorchlerconfigbundle.php' => 1, | |
| 'schedulerhelperdate.php' => 1, | |
| 'schedulerhelperconnector.php' => 1, | |
| 'schedulerhelper.php' => 1, | |
| 'recurringtype.php' => 1, | |
| 'dhtmlxasset.php' => 1, | |
| 'dgoptimizedaccessdecisionmanagerbundle.php' => 1, | |
| 'jqplotgraphwidget.php' => 1, | |
| 'wikimodule.php' => 1, | |
| 'trucksmodule.php' => 1, | |
| 'tlbexcelview.php' => 1, | |
| 'formatnum.i18n.php' => 1, | |
| 'piwik.hooks.php' => 1, | |
| 'alice' => 1, | |
| 'mongomodel.php' => 1, | |
| 'userbitcoinaddresses.settings.php' => 1, | |
| 'userbitcoinaddresses.php' => 1, | |
| 'userbitcoinaddresses.i18n.aliases.php' => 1, | |
| 'wsdltoclass' => 1, | |
| 'travis-after.sh' => 1, | |
| 'example_cache.php' => 1, | |
| 'quandl.php' => 1, | |
| 'rust.php' => 1, | |
| 'reset-symlinks.sh' => 1, | |
| 'gekko-shortener.sublime-project' => 1, | |
| '.example.env.php' => 1, | |
| 'elements.sublime-workspace' => 1, | |
| 'mongodoc.php' => 1, | |
| 'localhostbrowser.php' => 1, | |
| 'mongodbconnection.php' => 1, | |
| 'runttest.php' => 1, | |
| 'php.js' => 1, | |
| 'lowmemoryclassloader.php' => 1, | |
| 'releaseinfo.php' => 1, | |
| 'phpstorm.meta.php' => 1, | |
| 'gravatario.php' => 1, | |
| 'daminoushkasimplejqueryvalidationbundle.php' => 1, | |
| 'damdamdbootstrapbundle.php' => 1, | |
| 'daemonsimplifybundle.php' => 1, | |
| 'daemongallerybundle.php' => 1, | |
| 'daemonfilestoragebundle.php' => 1, | |
| 'filesfinderbundle.php' => 1, | |
| 'module-google-optimizer.csv' => 1, | |
| 'module-google-adwords.csv' => 1, | |
| 'repositorybase.php' => 1, | |
| 'doxygenlayout.xml' => 1, | |
| 'ampisoftdeploybundle.php' => 1, | |
| 'autogettersettertrait.php' => 1, | |
| 'arrayfactorytrait.php' => 1, | |
| 'annotationreaderfetcher.php' => 1, | |
| 'annotatedgettersettertrait.php' => 1, | |
| 'abstractgettersettertrait.php' => 1, | |
| 'acmodeltraitsbundle.php' => 1, | |
| 'acloginconveniencebundle.php' => 1, | |
| 'testwatch' => 1, | |
| 'containerawareroleauthorizer.php' => 1, | |
| 'ackalinkabundle.php' => 1, | |
| 'doxygen-filter.php' => 1, | |
| 'acfiendishbundle.php' => 1, | |
| 'fixturesloader.php' => 1, | |
| 'serviceresponse.php' => 1, | |
| 'acwebservicesbundle.php' => 1, | |
| 'actranscodingbundle.php' => 1, | |
| 'transcoder.php' => 1, | |
| 'preset.php' => 1, | |
| 'mimemap.php' => 1, | |
| 'filehandlerdefinition.php' => 1, | |
| 'mutate.conf.php' => 1, | |
| 'mediainfo.php' => 1, | |
| 'acmediainfobundle.php' => 1, | |
| 'amenophisprincebundle.php' => 1, | |
| 'amenophissocialbundle.php' => 1, | |
| 'ampuserbundle.php' => 1, | |
| 'gatherer.php' => 1, | |
| 'wr-dist.ini' => 1, | |
| 'typo.php' => 1, | |
| 'cosenary' => 1, | |
| 'basketinterface.php' => 1, | |
| 'basketcomponent.php' => 1, | |
| 'imagesbehavior.php' => 1, | |
| 'crudactionupdate.php' => 1, | |
| 'crudactiondelete.php' => 1, | |
| 'crudactioncreate.php' => 1, | |
| 'crudactionbase.php' => 1, | |
| 'checkowner.php' => 1, | |
| 'catalogadmin.php' => 1, | |
| 'cryptokey' => 1, | |
| 'typorules.php' => 1, | |
| 'rutils.php' => 1, | |
| 'gathererhelper.php' => 1, | |
| 'numeral.php' => 1, | |
| 'dt.php' => 1, | |
| '.prjide' => 1, | |
| 'phpunit_init.php' => 1, | |
| 'dbmsmodule.php' => 1, | |
| 'bookmarkmodule.php' => 1, | |
| 'accessmodule.php' => 1, | |
| 'selftest.php' => 1, | |
| 'rar.php' => 1, | |
| 'fixturesfromdbgenerator.php' => 1, | |
| 'amstaffixextjsrestcommonbundle.php' => 1, | |
| 'extjsmodelssaver.php' => 1, | |
| 'extjsgetallrequestcreator.php' => 1, | |
| 'wr-test.ini' => 1, | |
| 'diagrama.png' => 1, | |
| 'nf.php' => 1, | |
| 'pmg-cdn.php' => 1, | |
| 'app.functions.php' => 1, | |
| 'app.debugmode.php' => 1, | |
| 'instapush.php' => 1, | |
| 'votemodule.php' => 1, | |
| 'akhannstaticpagebundle.php' => 1, | |
| 'redmine-reminder' => 1, | |
| 'closuretablebehavior.php' => 1, | |
| 'hypemailchimpbundle.php' => 1, | |
| 'hypedynamicdatatablesbundle.php' => 1, | |
| 'cnertamailingbundle.php' => 1, | |
| 'cnertabreadcrumbbundle.php' => 1, | |
| 'cnertabehindaproxybundle.php' => 1, | |
| 'google-tag-manager.php' => 1, | |
| 'grumpy-cat-meme-hmmm.jpg' => 1, | |
| 'fu-autop.php' => 1, | |
| 'yuzupipelinebundle.php' => 1, | |
| 'yuzuarcgisbundle.php' => 1, | |
| 'symclass.php' => 1, | |
| 'editor-style.css' => 1, | |
| 'aequivocarestbundle.php' => 1, | |
| 'thumbnailimage.php' => 1, | |
| 'aws.global.php.dist' => 1, | |
| 'signout.php' => 1, | |
| 'ffaboard.sql' => 1, | |
| 'createtopic.php' => 1, | |
| 'shopifybundle.php' => 1, | |
| 'run_phantomjs.sh' => 1, | |
| 'app.init.php' => 1, | |
| 'esngalaxyauthserviceprovider.php' => 1, | |
| 'diagram.uml' => 1, | |
| 'mar.php' => 1, | |
| 'acsacspanelwordpressbundle.php' => 1, | |
| 'acsacspanelusersbundle.php' => 1, | |
| 'release.key' => 1, | |
| 'acsacspanelsettingsbundle.php' => 1, | |
| 'acsacspanelbundle.php' => 1, | |
| 'acinst3bundle.php' => 1, | |
| 'alsatianformbundle.php' => 1, | |
| 'alphalabspaginationbundle.php' => 1, | |
| 'alphalabsfoundationbundle.php' => 1, | |
| 'alphalabsfilterenginebundle.php' => 1, | |
| 'extendedrights.php' => 1, | |
| 'testcases.php' => 1, | |
| 'style' => 1, | |
| 'theme-sample.php' => 1, | |
| 'nginxpushstreambundle.php' => 1, | |
| 'locationbundle.php' => 1, | |
| 'brixtemplatebundle.php' => 1, | |
| 'brixcorebundle.php' => 1, | |
| 'brixadminbundle.php' => 1, | |
| 'symbolclass.php' => 1, | |
| 'qevix.php' => 1, | |
| 'laravel-5.png' => 1, | |
| 'initdatabase.php' => 1, | |
| 'timeagoformatter.php' => 1, | |
| 'alexdpysimpleaclbundle.php' => 1, | |
| 'alexdpyaclbundle.php' => 1, | |
| 'phpaudit' => 1, | |
| 'batch.cmd' => 1, | |
| 'nf_define.php' => 1, | |
| 'field_collection.theme.css' => 1, | |
| 'eventreposity.php' => 1, | |
| 'guildrank.php' => 1, | |
| 'guildproperties.php' => 1, | |
| 'guildmembership.php' => 1, | |
| 'playerproperties.php' => 1, | |
| 'playeronline.php' => 1, | |
| 'accountregistration.php' => 1, | |
| 'accountproperties.php' => 1, | |
| '.stepuprc' => 1, | |
| 'identity.php' => 1, | |
| 'anunapress.php' => 1, | |
| 'speedtest.php' => 1, | |
| 'gremlin.php' => 1, | |
| 'basiccron.php' => 1, | |
| 'creature.php' => 1, | |
| 'strogeinterface.php' => 1, | |
| 'stroge.php' => 1, | |
| 'encryptedstroge.php' => 1, | |
| 'drivernotfoundexception.php' => 1, | |
| 'cachesessionhandler.php' => 1, | |
| 'typehint.php' => 1, | |
| 'securitykeygenerator.php' => 1, | |
| 'keygeneratorinterface.php' => 1, | |
| 'csrftokeninterface.php' => 1, | |
| 'accesssecurity.php' => 1, | |
| 'terminateinterface.php' => 1, | |
| 'routematcherinterface.php' => 1, | |
| 'newsitem.php' => 1, | |
| 'gender.php' => 1, | |
| 'routematchexception.php' => 1, | |
| 'appventusdatamigrationbundle.php' => 1, | |
| 'taigabundle.php' => 1, | |
| 'avpixelartbundle.php' => 1, | |
| 'avphpdocfillbundle.php' => 1, | |
| 'avmultidomainbundle.php' => 1, | |
| 'orderevents.php' => 1, | |
| 'appventusmangopayevents.php' => 1, | |
| 'appventusmangopaybundle.php' => 1, | |
| 'pre-commit.add.sample' => 1, | |
| 'appventus.pre-commit.tester' => 1, | |
| 'appventusfacebookgraphbundle.php' => 1, | |
| 'dybapibundle.php.fix-case' => 1, | |
| 'dybapibundle.php' => 1, | |
| 'bankconnector.php' => 1, | |
| 'spell.php' => 1, | |
| 'avbootstrapalmanachbundle.php' => 1, | |
| 'aviarybundle.php' => 1, | |
| 'avtwitterposterbundle.php' => 1, | |
| 'avawesomespoolmailerbundle.php' => 1, | |
| 'avossusbundle.php' => 1, | |
| 'avlistbundle.php' => 1, | |
| 'avbitlybundle.php' => 1, | |
| 'avawesomeshortcutsbundle.php' => 1, | |
| 'avajaxbundle.php' => 1, | |
| 'avautoformfillbundle.php' => 1, | |
| 'avasseticinjectorbundle.php' => 1, | |
| 'world.php' => 1, | |
| 'vocation.php' => 1, | |
| 'routematcher.php' => 1, | |
| 'routecollector.php' => 1, | |
| 'nf_functions.php' => 1, | |
| 'bigmath.php' => 1, | |
| 'prediscachedriver.php' => 1, | |
| 'memcachedriver.php' => 1, | |
| 'flushableinterface.php' => 1, | |
| 'filecachedriver.php' => 1, | |
| 'drivernotflushableexception.php' => 1, | |
| 'driveradapterinterface.php' => 1, | |
| 'driveradapter.php' => 1, | |
| 'configrepository.php' => 1, | |
| 'arraycachedriver.php' => 1, | |
| 'apccachedriver.php' => 1, | |
| 'numeralsystem.php' => 1, | |
| 'bignumber.php' => 1, | |
| 'threadpool.php' => 1, | |
| 'rediscachedriver.php' => 1, | |
| 'thread.php' => 1, | |
| 'simplethread.php' => 1, | |
| 'socketstream.php' => 1, | |
| 'socketreal.php' => 1, | |
| 'asocket.php' => 1, | |
| 'phpgen.php' => 1, | |
| 'iphpgenerable.php' => 1, | |
| 'customcode.php' => 1, | |
| 'eventbuffer.php' => 1, | |
| 'eventbasic.php' => 1, | |
| 'eventbase.php' => 1, | |
| 'hookpiwikanalytics.php' => 1, | |
| 'nfc.php' => 1, | |
| 'predisclientexception.php' => 1, | |
| 'xcachedriver.php' => 1, | |
| 'modeldispatcher.php' => 1, | |
| 'swiftattachment.php' => 1, | |
| 'middlewareexception.php' => 1, | |
| 'filtermatchexception.php' => 1, | |
| 'filterbag.php' => 1, | |
| 'controllerdispatcherinterface.php' => 1, | |
| 'ascollector.php' => 1, | |
| 'actiondispatcherinterface.php' => 1, | |
| 'actiondispatcher.php' => 1, | |
| 'accessdispatcherinterface.php' => 1, | |
| 'accessdispatcher.php' => 1, | |
| 'accessbag.php' => 1, | |
| 'swiftmailerdriver.php' => 1, | |
| 'swiftattachmentinterface.php' => 1, | |
| 'phpmailerdriver.php' => 1, | |
| 'zenddatacache.php' => 1, | |
| 'phpmailerattachmentinterface.php' => 1, | |
| 'phpmailerattachment.php' => 1, | |
| 'attachmentinterface.php' => 1, | |
| 'serverhttpheaders.php' => 1, | |
| 'routenotfoundexception.php' => 1, | |
| 'requestheaders.php' => 1, | |
| 'redirecturlemptyexception.php' => 1, | |
| 'httpresponseexception.php' => 1, | |
| 'filenotuploadedexception.php' => 1, | |
| 'eventnotfoundexception.php' => 1, | |
| 'eventnameexception.php' => 1, | |
| 'eventlistenerexception.php' => 1, | |
| 'eventcollector.php' => 1, | |
| 'field_collections-1316162-227.patch' => 1, | |
| 'field_collection.test' => 1, | |
| 'appscoassertionvoterbundle.php' => 1, | |
| 'multiselectlistbox.php' => 1, | |
| 'buttontableexport.php' => 1, | |
| 'resourcemanagerinterface.php' => 1, | |
| 'filesystemresourcemanager.php' => 1, | |
| 'amazons3resourcemanager.php' => 1, | |
| 'pjaxfilter.php' => 1, | |
| 'inboundmessage.php' => 1, | |
| 'inboundcallbackevent.php' => 1, | |
| 'inboundcallbackaction.php' => 1, | |
| 'deliveryreceipt.php' => 1, | |
| 'deliverycallbackevent.php' => 1, | |
| 'deliverycallbackaction.php' => 1, | |
| 'multiselectlistboxasset.php' => 1, | |
| 'multiselect.php' => 1, | |
| 'tableexportaction.php' => 1, | |
| 'togglecolumnasset.php' => 1, | |
| 'toggleaction.php' => 1, | |
| 'place.php' => 1, | |
| 'timezonepicker.php' => 1, | |
| 'statepicker.php' => 1, | |
| 'phoneinput.php' => 1, | |
| 'numberinput.php' => 1, | |
| 'languagepicker.php' => 1, | |
| 'googlefontpicker.php' => 1, | |
| 'fontsizepicker.php' => 1, | |
| 'fontpicker.php' => 1, | |
| 'currencypicker.php' => 1, | |
| 'buttontableexportasset.php' => 1, | |
| 'translateablebehavior.php' => 1, | |
| 'colorpicker.php' => 1, | |
| 'selenium-server-standalone-2.47.1.jar' => 1, | |
| 'missing-builtins.php' => 1, | |
| 'inimltest.php' => 1, | |
| 'iniml.php' => 1, | |
| 'pdo2test.php' => 1, | |
| 'pdo2.php' => 1, | |
| 'archiemltest.php' => 1, | |
| 'archieml.php' => 1, | |
| 'init_framework.php' => 1, | |
| 'init_config_javascript.php' => 1, | |
| 'licence_cecill-b_v1-fr' => 1, | |
| 'licence_cecill-b_v1-en' => 1, | |
| 'towel.php' => 1, | |
| 'update.ps1' => 1, | |
| 'basetransliteratorhelper.php' => 1, | |
| 'fortytwo-2fa.php' => 1, | |
| '.rsyncignore' => 1, | |
| 'tagging.xml' => 1, | |
| 'idna.php' => 1, | |
| 'additional.php' => 1, | |
| 'a3mgrussianpostbundle.php' => 1, | |
| 'your.log' => 1, | |
| 'tito.php' => 1, | |
| '1.php' => 1, | |
| 'photoitem.php' => 1, | |
| 'photocollection.php' => 1, | |
| 'carbon-pagination.php' => 1, | |
| 'transliteratorhelper.php' => 1, | |
| 'countrypicker.php' => 1, | |
| 'bootstrapformhelperstrait.php' => 1, | |
| 'tagtest.php' => 1, | |
| 'helper-functions.php' => 1, | |
| 'twentystepswemonitbundle.php' => 1, | |
| 'twentystepsplacetelbundle.php' => 1, | |
| 'twentystepscommonsensurebundle.php' => 1, | |
| 'ensureexception.php' => 1, | |
| 'ensure.php' => 1, | |
| 'twentystepscollmexbundle.php' => 1, | |
| 'twentystepsautotablesbundle.php' => 1, | |
| 'composer-autoload.php' => 1, | |
| 'contao-sass-watch-settings.png' => 1, | |
| 'oneupflysystembundle.php' => 1, | |
| 'oneupaclbundle.php' => 1, | |
| 'composer-bootstrap.php' => 1, | |
| 'customizer.php' => 1, | |
| 'teslaclientbundle.php' => 1, | |
| 'intaropostgressearchbundle.php' => 1, | |
| 'intaronativequerybuilderbundle.php' => 1, | |
| 'intaromemcachedtagsbundle.php' => 1, | |
| 'slackhookserviceprovider.php' => 1, | |
| 'htmltotext.php' => 1, | |
| 'thecsv.php' => 1, | |
| 'wp_mock.php' => 1, | |
| 'swiftstream.php' => 1, | |
| 'hive' => 1, | |
| 'meuptagcommanderbundle.php' => 1, | |
| 'meupgeolocationbundle.php' => 1, | |
| 'osirisdevshortcutsbundle.php' => 1, | |
| 'application.ini-dist' => 1, | |
| 'teslaapikeysecuritybundle.php' => 1, | |
| 'assembler.php' => 1, | |
| 'bootstrapformhelpersasset.php' => 1, | |
| 'efeeditemrss2.php' => 1, | |
| 's3command.php' => 1, | |
| 's3assetmanager.php' => 1, | |
| 'cdnassetmanager.php' => 1, | |
| 'assetmanagertrait.php' => 1, | |
| 'iresourcemanager.php' => 1, | |
| 'efsresourcemanager.php' => 1, | |
| 'eamazons3resourcemanager.php' => 1, | |
| 'escriptboost.php' => 1, | |
| 'eclientscriptboost.php' => 1, | |
| 'eassetmanagerboost.php' => 1, | |
| 'egeoip.php' => 1, | |
| 'efeedtag.php' => 1, | |
| 'efeeditemrss1.php' => 1, | |
| 'assemblerinterface.php' => 1, | |
| 'efeeditematom.php' => 1, | |
| 'efeeditemabstract.php' => 1, | |
| 'efeed.php' => 1, | |
| '.editoconfig' => 1, | |
| 'zweigrammjqueryuibundle.php' => 1, | |
| 'zweigrammjquerybundle.php' => 1, | |
| 'notificationserviceinterface.php' => 1, | |
| 'notificationreceiverinterface.php' => 1, | |
| 'abstractnotificationservice.php' => 1, | |
| 'teslaesyncbundle.php' => 1, | |
| 'teslawsbundle.php' => 1, | |
| 'tesladtobundle.php' => 1, | |
| 'metadatareader.php' => 1, | |
| 'config-defaults.php' => 1, | |
| 'fdevsblockbundle.php' => 1, | |
| 'field_collection.pages.inc' => 1, | |
| 'picture.php' => 1, | |
| 'asoccompassomatorbundle.php' => 1, | |
| 'asocasseticangularjsbundle.php' => 1, | |
| 'evercookiewidget.php' => 1, | |
| 'artackmxapi.php' => 1, | |
| 'artackmxapibundle.php' => 1, | |
| 'update_package.sh' => 1, | |
| 'build.bootstrap.xml' => 1, | |
| 'phpalgo' => 1, | |
| 'googleplay-api.php' => 1, | |
| 'krsmailbundle.php' => 1, | |
| 'license.text' => 1, | |
| 'servicecontainerbuilder.php' => 1, | |
| 'authenticationfactory.php' => 1, | |
| 'basetype.php' => 1, | |
| 'abmundidatabasecommandsbundle.php' => 1, | |
| 'projectinventorybundle.php' => 1, | |
| 'a5syspdfbundle.php' => 1, | |
| 'overlaybundle.php' => 1, | |
| 'loggedinredirectionbundle.php' => 1, | |
| 'easyadminpopupbundle.php' => 1, | |
| 'doctrinetraitbundle.php' => 1, | |
| 'soaptest.php' => 1, | |
| 'test-s3.php' => 1, | |
| 'test-http.php' => 1, | |
| 'ergo.php' => 1, | |
| 'c975lxliffbundle.php' => 1, | |
| 'phpbb_session_handler.php' => 1, | |
| '.gitgnore' => 1, | |
| 'spsrapi.php' => 1, | |
| 'phpbbuservalidation.php' => 1, | |
| 'apyjsformvalidationbundle.php' => 1, | |
| 'field_collection.module' => 1, | |
| 'field_collection.migrate.inc' => 1, | |
| 'field_collection.install.orig' => 1, | |
| 'field_collection.install' => 1, | |
| 'field_collection.info.inc' => 1, | |
| 'field_collection.info' => 1, | |
| 'field_collection.api.php' => 1, | |
| 'field_collection.admin.inc' => 1, | |
| 'field-collection-item.tpl.php' => 1, | |
| 'accordpostmarkswiftmailerbundle.php' => 1, | |
| 'radius' => 1, | |
| 'jsfvevents.php' => 1, | |
| 'apybreadcrumbtrailbundle.php' => 1, | |
| 'spsrexception.php' => 1, | |
| 'triviabot.sql' => 1, | |
| 'questions.sql.zip' => 1, | |
| 'andikickboxbundle.php' => 1, | |
| 'websecurity.php' => 1, | |
| 'testindex.php' => 1, | |
| 'request_logging.php' => 1, | |
| 'ajax-get.php' => 1, | |
| 'about.php' => 1, | |
| 'wpcom-legacy-redirector.php' => 1, | |
| 'page-template-finder.php' => 1, | |
| 'ms-custom-signup.php' => 1, | |
| 'xml_synopsis' => 1, | |
| 'tbs_plugin_opentbs.html' => 1, | |
| 'phpbbclass.php' => 1, | |
| 'phpbb.php' => 1, | |
| 'fdevsbowerphpbundle.php' => 1, | |
| 'metabuilder.php' => 1, | |
| 'tagmanagerinterface.php' => 1, | |
| 'taginterface.php' => 1, | |
| 'fdevsstaticpagebundle.php' => 1, | |
| 'fdevssitemapbundle.php' => 1, | |
| 'fdevsroutingbundle.php' => 1, | |
| 'fdevspagebundle.php' => 1, | |
| 'abstractmigration.php' => 1, | |
| 'fdevsmigrationbundle.php' => 1, | |
| 'metaregistry.php' => 1, | |
| 'metainterface.php' => 1, | |
| 'metafactory.php' => 1, | |
| 'metabuilderinterface.php' => 1, | |
| 'fdevsmenuevents.php' => 1, | |
| 'fdevsfilebundle.php' => 1, | |
| 'fdevsmenubundle.php' => 1, | |
| 'translatorpriority.php' => 1, | |
| 'localetrait.php' => 1, | |
| 'localetextinterface.php' => 1, | |
| 'localeinterface.php' => 1, | |
| 'fdevsgeobundle.php' => 1, | |
| 'fdevselfinderbundle.php' => 1, | |
| 'fdevscontactusbundle.php' => 1, | |
| 'fdevscontactlistbundle.php' => 1, | |
| 'contactinterface.php' => 1, | |
| 'contactfactory.php' => 1, | |
| 'connectinterface.php' => 1, | |
| 'fdevscatalogbundle.php' => 1, | |
| 'fdevstagbundle.php' => 1, | |
| 'fdevslocale.php' => 1, | |
| 'phpbbwebuser.php' => 1, | |
| 'emailbundle.php' => 1, | |
| 'assistbundle.php' => 1, | |
| '.samurai' => 1, | |
| 'sevenmanagerbundle.php' => 1, | |
| 'gradle.properties' => 1, | |
| 'shswitchview.iml' => 1, | |
| 'typo3-probe.php' => 1, | |
| 'nanawebjapaneseholidaybundle.php' => 1, | |
| 'nanawebjapaneseformbundle.php' => 1, | |
| 'chbox.php' => 1, | |
| 'chbox.js' => 1, | |
| 'ocf.php' => 1, | |
| 'emailreader.php' => 1, | |
| 'withdrawform.php' => 1, | |
| 'fdevslocalebundle.php' => 1, | |
| 'arthemgraphqlbundle.php' => 1, | |
| 'following-diagram.png' => 1, | |
| 'publishablereadinterface.php' => 1, | |
| 'publishableinterface.php' => 1, | |
| 'publishworkflow.php' => 1, | |
| 'publishtimereadinterface.php' => 1, | |
| 'publishtimeinterface.php' => 1, | |
| 'publishstartreadinterface.php' => 1, | |
| 'publishstartinterface.php' => 1, | |
| 'publishreadinterface.php' => 1, | |
| 'publishinterface.php' => 1, | |
| 'publishendreadinterface.php' => 1, | |
| 'publishendinterface.php' => 1, | |
| 'appartincorebundle.php' => 1, | |
| 'bwccomponentfiribundle.php' => 1, | |
| 'module-gift-message.csv' => 1, | |
| 'test-update' => 1, | |
| 'besimplememcachedbundle.php' => 1, | |
| 'besimpledoctrinetypesbundle.php' => 1, | |
| 'baun' => 1, | |
| 'auto-install.php' => 1, | |
| 'symfony2locbundle.php' => 1, | |
| 'filestorage.php' => 1, | |
| 'server_start.sh' => 1, | |
| 'twr' => 1, | |
| 'triggermanager.php' => 1, | |
| 'processstatushandler.php' => 1, | |
| 'innmindprovisionerbundle.php' => 1, | |
| 'decisionmanager.php' => 1, | |
| 'test-relation' => 1, | |
| 'soapmessage.php' => 1, | |
| 'test-insert' => 1, | |
| 'test-init' => 1, | |
| 'test-get' => 1, | |
| 'test-delete' => 1, | |
| 'bancklehelpdeskbundle.php' => 1, | |
| 'bancklecrmbundle.php' => 1, | |
| 'update_info' => 1, | |
| 'radikal.php' => 1, | |
| 'range.php' => 1, | |
| 'clockpicker.php' => 1, | |
| 'bob.php' => 1, | |
| 'browseassets.php' => 1, | |
| 'abstractsoapbuilder.php' => 1, | |
| 'soaprequestfilter.php' => 1, | |
| '.apigen.neon' => 1, | |
| 'trakio.png' => 1, | |
| 'beelabsimplepagebundle.php' => 1, | |
| 'beelabrecaptcha2bundle.php' => 1, | |
| 'beelabphoneverificationbundle.php' => 1, | |
| 'beelabpaypalbundle.php' => 1, | |
| 'beelabmemoryrepositorybundle.php' => 1, | |
| 'beelablaptypebundle.php' => 1, | |
| 'becklynstaticrolesbundle.php' => 1, | |
| 'becklynradbundle.php' => 1, | |
| 'becklynpagetreebundle.php' => 1, | |
| 'becklynfacebookbundle.php' => 1, | |
| 'beatsbundle.php' => 1, | |
| 'sypexdumper.php' => 1, | |
| 'remote_url.png' => 1, | |
| 'soapresponsefilter.php' => 1, | |
| 'mixpanel.png' => 1, | |
| 'mailchimp.png' => 1, | |
| 'jira.png' => 1, | |
| 'hipchat.png' => 1, | |
| 'ui-test.php' => 1, | |
| 'highrise.png' => 1, | |
| 'constant_contact.png' => 1, | |
| 'campaignmonitor.png' => 1, | |
| 'soapserverbuilder.php' => 1, | |
| 'soapserver.php' => 1, | |
| 'wsdlhandler.php' => 1, | |
| 'wssecuritykey.php' => 1, | |
| 'wssecurityfilterclientserver.php' => 1, | |
| 'poem.ja' => 1, | |
| 'nmbtwigextensionsbundle.php' => 1, | |
| 'beelabtestbundle.php' => 1, | |
| 'phpdoc.cmd' => 1, | |
| 'harbourreleasebundle.module.xml' => 1, | |
| 'harbourmailerbundle.php' => 1, | |
| 'harbourmailerbundle.module.xml' => 1, | |
| 'harbourloggerbundle.php' => 1, | |
| 'harbourloggerbundle.module.xml' => 1, | |
| 'coralsitebundle.php' => 1, | |
| 'coralfilebundle.php' => 1, | |
| 'coralfilebundle.module.xml' => 1, | |
| 'coralcorebundle.php' => 1, | |
| 'coralcontentbundle.php' => 1, | |
| 'coralcontentbundle.module.xml' => 1, | |
| 'atipikhoawebsocketbundle.php' => 1, | |
| 'translator.class.php' => 1, | |
| 'harbourunsubscribebundle.module.xml' => 1, | |
| 'ashleydawsonsimplepaginationbundle.php' => 1, | |
| 'adperfilbundle.php' => 1, | |
| 'addependselectbundle.php' => 1, | |
| 'adboletabundle.php' => 1, | |
| 'wxrnewsbundle.php' => 1, | |
| 'wxrgeobundle.php' => 1, | |
| 'wxreventbundle.php' => 1, | |
| 'wxrdirectorybundle.php' => 1, | |
| 'wxrcontentbundle.php' => 1, | |
| 'wxrcommonbundle.php' => 1, | |
| 'wxrcategorybundle.php' => 1, | |
| 'options.yml' => 1, | |
| 'artbreadcrumbsbundle.php' => 1, | |
| 'harbourreleasebundle.php' => 1, | |
| 'harbourunsubscribebundle.php' => 1, | |
| 'nmbtinymcebundle.php' => 1, | |
| 'predict.php' => 1, | |
| 'iodocsgen' => 1, | |
| 'update_project_components_statuses.drush.inc' => 1, | |
| 'variables.sh' => 1, | |
| 'drupal-builder' => 1, | |
| 'highcosphinxbundle.php' => 1, | |
| 'nocsrf.php' => 1, | |
| 'bear.php' => 1, | |
| 'php-config.ini' => 1, | |
| 'cucumber.yml' => 1, | |
| 'filemoduletrait.php' => 1, | |
| 'filemodule.php' => 1, | |
| 'search.xml' => 1, | |
| 'phpbu.xml_example' => 1, | |
| 'phpspec.yml.hhvm.7' => 1, | |
| 'avtonomsemaphorebundle.php' => 1, | |
| 'avtonommediastorageclientbundle.php' => 1, | |
| 'avtonomcreolebundle.php' => 1, | |
| 'thekwastiwikibundle.php' => 1, | |
| 'formalin.uml' => 1, | |
| 'autobotposterbundle.php' => 1, | |
| 'test-sample-codes.sh' => 1, | |
| 'sample-code-php' => 1, | |
| 'genclass.sh' => 1, | |
| 'aitcmsbundle.php' => 1, | |
| 'aurejajobqueuebundle.php' => 1, | |
| 'rick.png' => 1, | |
| 'phpunit_bs.php' => 1, | |
| 'beelabtagbundle.php' => 1, | |
| 'beelabuserbundle.php' => 1, | |
| 'iqsms_json.php' => 1, | |
| 'symfony2appbundle.php' => 1, | |
| 'module-bundle.csv' => 1, | |
| 'module-bundle-import-export.csv' => 1, | |
| 'module-braintree.csv' => 1, | |
| 'module-backup.csv' => 1, | |
| 'module-backend.csv' => 1, | |
| 'module-authorizenet.csv' => 1, | |
| 'module-authorization.csv' => 1, | |
| 'module-advanced-pricing-import-export.csv' => 1, | |
| 'module-admin-notification.csv' => 1, | |
| 'ftp.class.php' => 1, | |
| 'assertions' => 1, | |
| 'env.ministryplatform' => 1, | |
| 'blackboxcodepandocontentbundle.php' => 1, | |
| 'module-captcha.csv' => 1, | |
| 'webpack.config.js' => 1, | |
| 'image_moo.php' => 1, | |
| 'license-grocery-crud' => 1, | |
| 'examples_database.sql.zip' => 1, | |
| 'woocommerce-facebook-remarketing.php' => 1, | |
| 'emails' => 1, | |
| 'emails.php' => 1, | |
| 'emails.json' => 1, | |
| 'design' => 1, | |
| 'bips' => 1, | |
| 'birkneralexxenforoauthbundle.php' => 1, | |
| 'sub-plugins.php' => 1, | |
| 'ikadockcfinderbundle.php' => 1, | |
| 'module-cache-invalidate.csv' => 1, | |
| 'module-catalog-import-export.csv' => 1, | |
| 'resultobject.php' => 1, | |
| 'module-cron.csv' => 1, | |
| 'module-fedex.csv' => 1, | |
| 'module-encryption-key.csv' => 1, | |
| 'module-email.csv' => 1, | |
| 'module-eav.csv' => 1, | |
| 'module-downloadable.csv' => 1, | |
| 'module-downloadable-import-export.csv' => 1, | |
| 'module-directory.csv' => 1, | |
| 'module-dhl.csv' => 1, | |
| 'module-developer.csv' => 1, | |
| 'module-customer.csv' => 1, | |
| 'module-customer-import-export.csv' => 1, | |
| 'module-currency-symbol.csv' => 1, | |
| 'module-cookie.csv' => 1, | |
| 'module-catalog-inventory.csv' => 1, | |
| 'module-contact.csv' => 1, | |
| 'module-configurable-product.csv' => 1, | |
| 'module-configurable-import-export.csv' => 1, | |
| 'module-config.csv' => 1, | |
| 'module-cms.csv' => 1, | |
| 'module-cms-url-rewrite.csv' => 1, | |
| 'module-checkout.csv' => 1, | |
| 'module-checkout-agreements.csv' => 1, | |
| 'module-catalog.csv' => 1, | |
| 'module-catalog-widget.csv' => 1, | |
| 'module-catalog-url-rewrite.csv' => 1, | |
| 'module-catalog-search.csv' => 1, | |
| 'module-catalog-rule.csv' => 1, | |
| 'cleaninstall' => 1, | |
| 'bigfishuserbundle.php' => 1, | |
| 'beelabuserpasswordbundle.php' => 1, | |
| 'stylista-blogger-navigation.php' => 1, | |
| 'mysql.address.sql' => 1, | |
| 'bootstrap.tests.php' => 1, | |
| 'antwebbundle.php' => 1, | |
| 'antuserbundle.php' => 1, | |
| 'antmediabundle.php' => 1, | |
| 'antadminbundle.php' => 1, | |
| 'white-album-external-header.php' => 1, | |
| 'wp-s3-must-use.php' => 1, | |
| 'wp-manual-cu.php' => 1, | |
| 'wp-cxense.php' => 1, | |
| 'wa-external-header-v2.php' => 1, | |
| 'stylista-menu-plugin.php' => 1, | |
| 'bloggernavigation.php' => 1, | |
| 'brapibundle.php' => 1, | |
| 'trapp' => 1, | |
| 'indexsearch' => 1, | |
| 'bonnier-admin' => 1, | |
| 'bencsigeobundle.php' => 1, | |
| 'pubkey.pem' => 1, | |
| 'example-quick-configure.json' => 1, | |
| 'bellashayepaypalbundle.php' => 1, | |
| 'betaup.jpg' => 1, | |
| 'modalbasset.php' => 1, | |
| 'modalb.php' => 1, | |
| 'libpath.php' => 1, | |
| 'behatbundle.php' => 1, | |
| 'bktrackerhubbundle.php' => 1, | |
| 'salesforcestrategy.php' => 1, | |
| 'brauthbundle.php' => 1, | |
| 'nestedmatcher.php' => 1, | |
| 'eavpersisterevents.php' => 1, | |
| 'bigfishroutingbundle.php' => 1, | |
| 'resolveresourceentities.php' => 1, | |
| 'bigfishresourcebundle.php' => 1, | |
| 'pagekitgridtypes.php' => 1, | |
| 'bigfishpagekitbundle.php' => 1, | |
| 'resolvemediaentities.php' => 1, | |
| 'mediatypes.php' => 1, | |
| 'bigfishmediabundle.php' => 1, | |
| 'resolvelanguageentities.php' => 1, | |
| 'bigfishlanguagebundle.php' => 1, | |
| 'bigfishgridbundle.php' => 1, | |
| 'resolveeaventities.php' => 1, | |
| 'eavevents.php' => 1, | |
| 'brtokenbundle.php' => 1, | |
| 'eavcategories.php' => 1, | |
| 'bigfisheavbundle.php' => 1, | |
| 'testrouting.php' => 1, | |
| 'resolvecoreentities.php' => 1, | |
| 'bigfishcorebundle.php' => 1, | |
| 'resolvecontextentities.php' => 1, | |
| 'bigfishcontextbundle.php' => 1, | |
| 'bigfishconfigurationbundle.php' => 1, | |
| 'brspineapplebundle.php' => 1, | |
| 'ebsco-widget.php' => 1, | |
| 'bgazeparsedownbundle.php' => 1, | |
| 'ocok' => 1, | |
| 'bruserapibundle.php' => 1, | |
| 'phpunit.example.conf' => 1, | |
| 'rtf.class.php' => 1, | |
| 'firi.php' => 1, | |
| 'movie.rb' => 1, | |
| 'taxgator.rb' => 1, | |
| 'stocktickerservlet.rb' => 1, | |
| 'scratchx' => 1, | |
| 'queue.rb~' => 1, | |
| 'queue.rb' => 1, | |
| 'qaerodiacorp.sav' => 1, | |
| 'product.rb' => 1, | |
| 'osstartscreen.py' => 1, | |
| 'num.rb' => 1, | |
| 'notakerpro.aia' => 1, | |
| 'mysqldumper1.24.4.zip' => 1, | |
| 'movielibrary.rb' => 1, | |
| 'middleware' => 1, | |
| 'ticker.rb~' => 1, | |
| 'middleware.rb' => 1, | |
| 'mapsly.zip' => 1, | |
| 'mapsly (3).zip' => 1, | |
| 'mapsly (2).zip' => 1, | |
| 'malaika.zip' => 1, | |
| 'listing.rb' => 1, | |
| 'f16shell.rb' => 1, | |
| 'f16mudtape.rb' => 1, | |
| 'f16mudcockpitservlet.rb' => 1, | |
| 'chesstize.zip' => 1, | |
| 'chesstize (2).zip' => 1, | |
| 'bingcherry.zip' => 1, | |
| 'ticker.rb' => 1, | |
| 'weakhash.rb' => 1, | |
| 'archervmexception.rb' => 1, | |
| 'american_imperialism2.ppt' => 1, | |
| 'compiler.py' => 1, | |
| 'collaborant-0.1.0.gem' => 1, | |
| 'codecip.py' => 1, | |
| 'cockpitguess.py' => 1, | |
| 'cargo.cmd' => 1, | |
| 'cargo.bat' => 1, | |
| 'cards.py' => 1, | |
| 'bucketwise-master.zip' => 1, | |
| 'autoexec.bat' => 1, | |
| 'arp.php' => 1, | |
| 'archersys-logo.png' => 1, | |
| 'arbylog.rb' => 1, | |
| 'alarmpy.py' => 1, | |
| 'wikipage.rb' => 1, | |
| 'ager.py' => 1, | |
| 'activate_docs_gen' => 1, | |
| 'activate_docs_gen.bat' => 1, | |
| 'acoserver_moodle.sql' => 1, | |
| 'acoserver_games.sql' => 1, | |
| 'acoserver_admin.sql' => 1, | |
| 'acoserver_acoserver.sql' => 1, | |
| 'acoserver_acoserver (2).sql' => 1, | |
| '_.swp' => 1, | |
| '_.swo' => 1, | |
| '_.swn' => 1, | |
| 'zlibengine.rb' => 1, | |
| 'wikipage.rb~' => 1, | |
| 'bingcherry.bryapp' => 1, | |
| 'archervmcashewtimeserver.rb~' => 1, | |
| 'contacts.db' => 1, | |
| '158671-owncloud_editdoc.zip' => 1, | |
| '.git.cmd.swp' => 1, | |
| '.buildinfo' => 1, | |
| '.authorize.php.swp' => 1, | |
| '.ticker.rb.swp' => 1, | |
| '.aerodiaserver.rb.swp' => 1, | |
| '.302.html.swp' => 1, | |
| '-interactive' => 1, | |
| 'occ' => 1, | |
| 'indie.json' => 1, | |
| 'db_structure.xml' => 1, | |
| 'copying-agpl' => 1, | |
| '160265-ocdashboard_v1.3.1.zip' => 1, | |
| 'tourlib.js' => 1, | |
| '.index.php.swp' => 1, | |
| 'landing-page.css' => 1, | |
| 'jquery.hipchat.js' => 1, | |
| 'canvashoppe-css.css' => 1, | |
| 'bootstrap-tour.min.js' => 1, | |
| 'bootstrap-tour.min.css' => 1, | |
| 'bootstrap-tour.js' => 1, | |
| 'bootstrap-tour.css' => 1, | |
| 'bootstrap-tour-tutorial' => 1, | |
| 'pdfljs.js' => 1, | |
| 'copy of index.php' => 1, | |
| 'arcavias.php' => 1, | |
| 'apichange' => 1, | |
| 'arachniasfoundationbundle.php' => 1, | |
| '.index.php.swo' => 1, | |
| '.irb.cmd.swp' => 1, | |
| 'archervmcashewtimeserver.rb' => 1, | |
| 'aerodiaserver.rb~' => 1, | |
| 'archervmcashewlogger.rb~' => 1, | |
| 'archervmcashewlogger.rb' => 1, | |
| 'archervmcashewdelegator.rb' => 1, | |
| 'archersysosoptionsparser.rb~' => 1, | |
| 'archersysosoptionsparser.rb' => 1, | |
| 'archersysosdate.rb' => 1, | |
| 'archersysos.rb' => 1, | |
| 'archersysos.gemspec' => 1, | |
| 'archerscript' => 1, | |
| 'archerdbm.rb' => 1, | |
| 'archercgi' => 1, | |
| 'aerodiaserver' => 1, | |
| 'aerodiaserver.rb' => 1, | |
| '.irb_history' => 1, | |
| 'aerodia2.scn' => 1, | |
| 'abstractimplementation.rb' => 1, | |
| 'abstractarrbyklass.rb' => 1, | |
| '8_imperialism_by_the_united_states2.ppt' => 1, | |
| '7imperialisminjapan2.ppt' => 1, | |
| '302.html' => 1, | |
| '.vimstarter.bat.swp' => 1, | |
| '.taskmanager.py.swp' => 1, | |
| '.login.php.swp' => 1, | |
| '.login.php.swo' => 1, | |
| '.login.php.swn' => 1, | |
| '.irbrc~' => 1, | |
| '.irbrc' => 1, | |
| 'conchtack_id.dat' => 1, | |
| 'contrib-update.cmd' => 1, | |
| 'webicqpro.class.php' => 1, | |
| 'tess.py' => 1, | |
| 'yo' => 1, | |
| 'wallpaper.php' => 1, | |
| 'virtphp.phar' => 1, | |
| 'vimstarter.bat' => 1, | |
| 'uru_rt.exe' => 1, | |
| 'uru.ps1.bak' => 1, | |
| 'uru.ps1' => 1, | |
| 'uru.bat.bak' => 1, | |
| 'uru.bat' => 1, | |
| 'urllib2.py' => 1, | |
| 'time.html' => 1, | |
| 'time.css' => 1, | |
| 'startup.png' => 1, | |
| 'hello-world.php' => 1, | |
| 'startscreen.py' => 1, | |
| 'startscreen.php' => 1, | |
| 'specs.4.8.gz' => 1, | |
| 'specs.4.8' => 1, | |
| 'sinatra-1.4.5.gem' => 1, | |
| 'setupgit.bat' => 1, | |
| 'setupgit.ba' => 1, | |
| 'setup-owncloud.php' => 1, | |
| 'setup-account.py' => 1, | |
| 'searchindex.js' => 1, | |
| 'sample' => 1, | |
| 'rustc.cmd' => 1, | |
| 'runestone' => 1, | |
| 'yo.cmd' => 1, | |
| 'test-gravatar.php' => 1, | |
| 'rockpaperscissors.py' => 1, | |
| 'validcommentaire.php' => 1, | |
| 'erdiko.php' => 1, | |
| 'defaultconfiguration.php' => 1, | |
| 'arrogancemailrelaybundle.php' => 1, | |
| 'apimethodinterface.php' => 1, | |
| 'migrator' => 1, | |
| 'anonymizer' => 1, | |
| 'reactioncompatible.php' => 1, | |
| 'reaction.php' => 1, | |
| 'actioncompatible.php' => 1, | |
| 'config.sample.yml' => 1, | |
| 'newstab.php' => 1, | |
| 'categorybreadcrumb.php' => 1, | |
| 'testlink.php' => 1, | |
| 'wp-bird.php' => 1, | |
| 'resizeimage.php' => 1, | |
| 'readlog.php' => 1, | |
| 'maintenance.html' => 1, | |
| 'indexok.php' => 1, | |
| 'indexmaintenance2.php' => 1, | |
| 'imagezoomzone.php' => 1, | |
| 'getphotosquare.php' => 1, | |
| 'getphotoredimensionnee.php' => 1, | |
| 'getphotohome.php' => 1, | |
| 'findorphans.php' => 1, | |
| 'copypersons.php' => 1, | |
| 'mcd archi-strasbourg.mwb' => 1, | |
| 'archi_v2.sql' => 1, | |
| 'run_f16.rb' => 1, | |
| 'riphone.php' => 1, | |
| 'contrib-update.cmd~' => 1, | |
| 'git.cmd~' => 1, | |
| 'latest_specs.4.8.gz' => 1, | |
| 'latest_specs.4.8' => 1, | |
| 'irb.cmd~' => 1, | |
| 'irb.cmd' => 1, | |
| 'iostarter.py' => 1, | |
| 'installer_apps.php' => 1, | |
| 'htdocs.gemspec~' => 1, | |
| 'htdocs.gemspec' => 1, | |
| 'histogram.py' => 1, | |
| 'grillo' => 1, | |
| 'gitstat.php' => 1, | |
| 'githubstats.phjp' => 1, | |
| 'git-lfs.exe' => 1, | |
| 'meter.js' => 1, | |
| 'genindex.html' => 1, | |
| 'game1.py' => 1, | |
| 'ftpindex.php' => 1, | |
| 'forum.php' => 1, | |
| 'f18mud.rb' => 1, | |
| 'evennia' => 1, | |
| 'etupgit.bat' => 1, | |
| 'drupal-7.34.zip' => 1, | |
| 'dictionary_of_words.db' => 1, | |
| 'dict.rb' => 1, | |
| 'desktop-w10.php' => 1, | |
| 'desktop-modo.php' => 1, | |
| 'decompiler.py' => 1, | |
| 'login.php~' => 1, | |
| 'moodle.sqk' => 1, | |
| 'radius.py' => 1, | |
| 'os-mobile.php' => 1, | |
| 'pyvenv.cfg' => 1, | |
| 'pygubu-asos.py' => 1, | |
| 'pyconsole.py' => 1, | |
| 'puttytel.exe' => 1, | |
| 'putty.exe' => 1, | |
| 'pscp.exe' => 1, | |
| 'profile_weldon.jpg' => 1, | |
| 'prerelease_specs.4.8.gz' => 1, | |
| 'prerelease_specs.4.8' => 1, | |
| 'pip-selfcheck.json' => 1, | |
| 'phpliteadmin_v1-9-5.zip' => 1, | |
| 'phpldapadmin-1.2.3.zip' => 1, | |
| 'os-desktop.php' => 1, | |
| 'moodle.sql' => 1, | |
| 'objects.inv' => 1, | |
| 'npm.cmd' => 1, | |
| 'npm' => 1, | |
| 'now.bat' => 1, | |
| 'notifications-gateway.php' => 1, | |
| 'nodevars.bat' => 1, | |
| 'nodejs-portable.bat' => 1, | |
| 'node_perfctr_provider.man' => 1, | |
| 'node_etw_provider.man' => 1, | |
| 'node.exe' => 1, | |
| 'news.py' => 1, | |
| 'mud_login.rb' => 1, | |
| 'movielibrary.rhtml' => 1, | |
| 'modelkeybase.php' => 1, | |
| 'retrieveresult.php' => 1, | |
| 'stg' => 1, | |
| 'barcode.php' => 1, | |
| 'lightmakerdynamosessionhandlerbundle.php' => 1, | |
| 'lightmakercomplexifybundle.php' => 1, | |
| 'lightmakerawsbundle.php' => 1, | |
| 'litcvideoplayerbundle.php' => 1, | |
| 'litctestbundle.php' => 1, | |
| 'litckeywordbundle.php' => 1, | |
| 'litcheadbundle.php' => 1, | |
| 'lextyflashybundle.php' => 1, | |
| 'timesync.php' => 1, | |
| 'memory.php' => 1, | |
| 'gdata.php' => 1, | |
| 'dojo.php' => 1, | |
| 'levelabdoctrinediscriminatorbundle.php' => 1, | |
| 'lilaconceptsbestpracticebundle.php' => 1, | |
| 'level42notjaxbbundle.php' => 1, | |
| 'gitlabhookbundle.php' => 1, | |
| 'dice.php' => 1, | |
| 'axel.php' => 1, | |
| 'leobenoistsocketbundle.php' => 1, | |
| 'swsmapigenericbundle.php' => 1, | |
| 'alphavisitortrackingbundle.php' => 1, | |
| 'alphatwigbundle.php' => 1, | |
| 'alphatagbundle.php' => 1, | |
| 'gocardlessenterprisebundle.php' => 1, | |
| 'whoopsbundle.php' => 1, | |
| 'twitterbundle.php' => 1, | |
| 'likibuclient.phar' => 1, | |
| 'limeniusaramblageneratorbundle.php' => 1, | |
| 'oauthsignaturemethodplaintext.php' => 1, | |
| 'nodecollection.php' => 1, | |
| 'altstuvizbundle.php' => 1, | |
| 'searchaction.php' => 1, | |
| 'requestquerytrait.php' => 1, | |
| 'curlevent.php' => 1, | |
| 'countaction.php' => 1, | |
| 'locationpicker.php' => 1, | |
| '.license_header' => 1, | |
| 'userserviceprovider.php' => 1, | |
| 'transserviceprovider.php' => 1, | |
| 'trans.php' => 1, | |
| 'languagenegotiator.php' => 1, | |
| 'assetcontainer.php' => 1, | |
| 'menuserviceprovider.php' => 1, | |
| 'limeniusfilesystemrouterbundle.php' => 1, | |
| 'hashidsserviceprovider.php' => 1, | |
| 'litgrouphttpclientbundle.php' => 1, | |
| 'litgroupgearmanbundle.php' => 1, | |
| 'litgroupeventloopbundle.php' => 1, | |
| 'litgroupdnsbundle.php' => 1, | |
| 'service_container.module' => 1, | |
| 'service_container.install' => 1, | |
| 'service_container.info' => 1, | |
| 'hack' => 1, | |
| 'linkvaluemobilenotifbundle.php' => 1, | |
| 'dynamicformaware.php' => 1, | |
| 'filehandlerfactory.php' => 1, | |
| 'limeniusreactbundle.php' => 1, | |
| 'oauthsignaturemethodrsasha1.php' => 1, | |
| 'oauthsignaturemethodhmacsha1.php' => 1, | |
| 'altstuvizmain.php' => 1, | |
| 'laravist' => 1, | |
| 'flowjswidget.php' => 1, | |
| 'flowjscontroller.php' => 1, | |
| 'flowjsasset.php' => 1, | |
| 'flowjs.php' => 1, | |
| 'skeletondump.sql' => 1, | |
| '._license' => 1, | |
| 'laurentschoolbundle.php' => 1, | |
| 'laurentpiabundle.php' => 1, | |
| 'laurentbulletinbundle.php' => 1, | |
| 'api_details.dist.php' => 1, | |
| 'laulamanappsodrbundle.php' => 1, | |
| 'daybreakstudiosairbrakebundle.php' => 1, | |
| 'lapalabsuserprofilebundle.php' => 1, | |
| 'megaplanauth.php' => 1, | |
| 'lapalabsskeletonbundle.php' => 1, | |
| 'lapalabsratingbundle.php' => 1, | |
| 'lapalabscurrencybundle.php' => 1, | |
| 'lapalabscountrybundle.php' => 1, | |
| 'readme-1.0' => 1, | |
| 'landmarxuserbundle.php' => 1, | |
| 'landmarxlocationbundle.php' => 1, | |
| 'landmarxlandmarkbundle.php' => 1, | |
| 'lankitjquerybundle.php' => 1, | |
| 'lankitdatatablesbundle.php' => 1, | |
| 'netlicensing.php' => 1, | |
| 'integrationtest.sh' => 1, | |
| 'lpisearchbundle.php' => 1, | |
| 'mpauthexception.php' => 1, | |
| 'refresh.sh' => 1, | |
| 'modelstate.php' => 1, | |
| 'funmismsbundle.php' => 1, | |
| 'lightaccessbundle.php' => 1, | |
| 'imodel.php' => 1, | |
| 'generatorbundle.php' => 1, | |
| 'distributionbundle.php' => 1, | |
| 'libreoffice.cde' => 1, | |
| 'convert.cde' => 1, | |
| 'cde.uname' => 1, | |
| 'cde.options' => 1, | |
| 'cde.log' => 1, | |
| 'cde.full-environment' => 1, | |
| 'cde-exec' => 1, | |
| 'smshandler.php' => 1, | |
| 'responsehandler.php' => 1, | |
| 'lswautomaticupdatebundle.php' => 1, | |
| 'funmiresponserbundle.php' => 1, | |
| 'pagehandler.php' => 1, | |
| 'funmipaginationbundle.php' => 1, | |
| 'picturehandler.php' => 1, | |
| 'funmifilebundle.php' => 1, | |
| 'ledjinsyliussagepaybundle.php' => 1, | |
| 'ledjinsagepaybundle.php' => 1, | |
| 'lswversioninformationbundle.php' => 1, | |
| 'lswsecurecontrollerbundle.php' => 1, | |
| 'lswremotetemplatebundle.php' => 1, | |
| 'lswguzzlebundle.php' => 1, | |
| 'lswgettexttranslationbundle.php' => 1, | |
| 'lswdefaultroutingbundle.php' => 1, | |
| 'altstuvizcolorhelper.php' => 1, | |
| 'shellcommand.php' => 1, | |
| 'lpikernelbundle.php' => 1, | |
| 'mwsimplecrudgeneratorbundle.php' => 1, | |
| 'banner.jpg' => 1, | |
| 'test_streamer.php' => 1, | |
| 'doc_config.ini' => 1, | |
| 'phpta.xsd' => 1, | |
| 'phpta.xml' => 1, | |
| 'phpta' => 1, | |
| 'aippreferencebundle' => 1, | |
| 'provisioner.sh' => 1, | |
| 'ma27apikeyauthenticationevents.php' => 1, | |
| 'ma27apikeyauthenticationbundle.php' => 1, | |
| 'mwsimplelinodednsmanagerbundle.php' => 1, | |
| 'forobundle.php' => 1, | |
| 'mwsimplecrawlsitebundle.php' => 1, | |
| 'juidatepicker.php' => 1, | |
| 'mwsimpleadmincrudbundle.php' => 1, | |
| 'genfunctions.php' => 1, | |
| 'my_plugin.php' => 1, | |
| 'bootstrap-confirmation.js' => 1, | |
| 'mesduserbundle.php' => 1, | |
| 'mesdsettingsbundle.php' => 1, | |
| 'mesdphantasosclientbundle.php' => 1, | |
| 'mesdjasperreportviewerbundle.php' => 1, | |
| 'mesdjasperreportbundle.php' => 1, | |
| 'license-flowl-jasper' => 1, | |
| 'phpvs' => 1, | |
| 'subfieldinterface.php' => 1, | |
| 'bottomline.php' => 1, | |
| 'juidatepickerasset.php' => 1, | |
| 'subspecinterface.php' => 1, | |
| 'streamperklandingbundle.php' => 1, | |
| 'el_gr.csv' => 1, | |
| 'da_dk.csv' => 1, | |
| 'cs_cz.csv' => 1, | |
| 'ar_sa.csv' => 1, | |
| 'twigster.phar' => 1, | |
| 'magloftezmagicbundle.php' => 1, | |
| 'finfo.php' => 1, | |
| 'streamperkuserbundle.php' => 1, | |
| 'streamperkthemebundle.php' => 1, | |
| 'streamperkserverbundle.php' => 1, | |
| 'streamperkschedulebundle.php' => 1, | |
| 'streamperkpollbundle.php' => 1, | |
| 'streamperkcorebundle.php' => 1, | |
| 'juidatepickerlanguageasset.php' => 1, | |
| 'madrakiopersistentcommandbundle.php' => 1, | |
| 'madrakioextendablepermissionsbundle.php' => 1, | |
| 'madrakioextendableconfigurationbundle.php' => 1, | |
| 'madrakioeasyparameterdeploymentbundle.php' => 1, | |
| 'madrakioeasycrondeploymentbundle.php' => 1, | |
| 'madrakioeasyadminbundle.php' => 1, | |
| 'statemachinevisualizationbundle.php' => 1, | |
| 'pave' => 1, | |
| 'mactroniquephpcachebundle.php' => 1, | |
| 'juitimepicker.php' => 1, | |
| 'juidatetimepickerlanguageasset.php' => 1, | |
| 'juidatetimepickerasset.php' => 1, | |
| 'juidatetimepicker.php' => 1, | |
| 'subfield.php' => 1, | |
| 'subspec.php' => 1, | |
| 'shellresult.php' => 1, | |
| '.htaccess.alt' => 1, | |
| 'humanreadablecache.php' => 1, | |
| 'compose.php' => 1, | |
| 'commentparser.php' => 1, | |
| 'pageannotatorbundle.php' => 1, | |
| 'lumbendilrottentomatoesbundle.php' => 1, | |
| 'lumbendilsharedroutersbundle.php' => 1, | |
| 'genetic' => 1, | |
| 'amp-console.php' => 1, | |
| 'amp-console' => 1, | |
| '.kitchen.yml' => 1, | |
| 'lukaszmordawskicampaignmonitorbundle.php' => 1, | |
| 'download-configuration.php' => 1, | |
| 'luisdeimosencryptbundle.php' => 1, | |
| 'iauthenticate.php' => 1, | |
| 'lpfactorynestedsetroutingbundle.php' => 1, | |
| 'googlecustomsearch.php' => 1, | |
| 'favoritebundle.php' => 1, | |
| 'multilingualbegavior.php' => 1, | |
| 'lorenzschaefhelppagesbundle.php' => 1, | |
| 'helppages.php' => 1, | |
| 'lordbainefusionchartsbundle.php' => 1, | |
| 'lordbaineamchartsbundle.php' => 1, | |
| 'phpsass.php' => 1, | |
| 'test.scss' => 1, | |
| 'l8actioncolumn.php' => 1, | |
| 'vlchttpbundle.php' => 1, | |
| 'terminal.php' => 1, | |
| 'restler.php' => 1, | |
| 'icompose.php' => 1, | |
| 'speciterator.php' => 1, | |
| 'm6webapiexceptionbundle.php' => 1, | |
| 'positionorrangeinterface.php' => 1, | |
| 'positionorrange.php' => 1, | |
| 'marcspecparser.php' => 1, | |
| 'marcspecinterface.php' => 1, | |
| 'marcspec.php' => 1, | |
| 'comparisonstringinterface.php' => 1, | |
| 'comparisonstring.php' => 1, | |
| 'wild_combination.php' => 1, | |
| 'm6webphpprocessmanagerbundle.php' => 1, | |
| 'm6webfirewallbundle.php' => 1, | |
| 'm6webdomainuserbundle.php' => 1, | |
| 'coke' => 1, | |
| 'm4nuobjectroutebundle.php' => 1, | |
| 'iidentifyuser.php' => 1, | |
| 'm4numultidomainbundle.php' => 1, | |
| 'sqlgeo.php' => 1, | |
| 'geojsonsql.php' => 1, | |
| 'nmi3step.php' => 1, | |
| 'glide.php' => 1, | |
| 'fpdiext.php' => 1, | |
| 'git-pre-commit' => 1, | |
| 'fb-channel.php' => 1, | |
| 'conversion' => 1, | |
| 'xero.php' => 1, | |
| 'appserver.php' => 1, | |
| 'iuseauthentication.php' => 1, | |
| 'iprovidemultiversionapi.php' => 1, | |
| 'lpinewsbundle.php' => 1, | |
| 'lpifilebundle.php' => 1, | |
| 'en_us.csv' => 1, | |
| 'loginnotificatorinterface.php' => 1, | |
| 'kphoenrulerzbundle.php' => 1, | |
| 'kphoensmssenderbundle.php' => 1, | |
| 'kphoencontactbundle.php' => 1, | |
| 'hoarouterbundle.php' => 1, | |
| 'kphoendoctrinestatemachinebundle.php' => 1, | |
| 'justtexts-plugin.js' => 1, | |
| 'rulematcher.php' => 1, | |
| 'pagetemplate.php' => 1, | |
| 'pagegenerator.php' => 1, | |
| 'flushcache.php' => 1, | |
| 'userrepositoryinterface.php' => 1, | |
| 'loginservicetest.php' => 1, | |
| 'authenticatortest.php' => 1, | |
| 'janrain-union.php' => 1, | |
| 'authservicetestbase.php' => 1, | |
| 'activateservicetest.php' => 1, | |
| 'checkcwdplugin.php' => 1, | |
| 'listviewer.php' => 1, | |
| 'infologbundle.php' => 1, | |
| 'jjstoolchainbundle.php' => 1, | |
| 'jjssystemsettingsbundle.php' => 1, | |
| 'jjsresponseconverterbundle.php' => 1, | |
| 'joshuaestesgooglebundle.php' => 1, | |
| 'build.yml' => 1, | |
| 'joshuaestesamazonbundle.php' => 1, | |
| 'dutchdigitvalidator.php' => 1, | |
| 'kphoengaufretteextrasbundle.php' => 1, | |
| 'dataset.sql' => 1, | |
| 'jonnnhdynamicbundle.php' => 1, | |
| 'testovani' => 1, | |
| 'kfkitbundle.php' => 1, | |
| 'kfiuploadbundle.php' => 1, | |
| 'kfigeobundle.php' => 1, | |
| 'kfiframeworkbundle.php' => 1, | |
| 'webpageutils.php' => 1, | |
| 'kficmsbundle.php' => 1, | |
| 'kfibackupbundle.php' => 1, | |
| 'wtechrestbundle.php' => 1, | |
| 'wtechformbundle.php' => 1, | |
| 'html_icon.svg' => 1, | |
| 'validatorpanel.php' => 1, | |
| 'xxxx.blemc' => 1, | |
| 'somefoo' => 1, | |
| 'knonetranslatebundle.php' => 1, | |
| 'x' => 1, | |
| 'console.json' => 1, | |
| 'karolnettwigratingfilterbundle.php' => 1, | |
| '.updateignore' => 1, | |
| 'changesfetcher.php' => 1, | |
| 'changesfetcherbundle.php' => 1, | |
| 'activpikentitymanagergeneratorbundle.php' => 1, | |
| 'activpikstompbundle.php' => 1, | |
| 'activpikfeedbackbundle.php' => 1, | |
| 'usage_with_anax-mvc' => 1, | |
| 'connectionpdo.php' => 1, | |
| 'migration_array.php' => 1, | |
| 'dbug.doxyfile' => 1, | |
| 'dutchdigitserviceprovider.php' => 1, | |
| 'user_recovery_password.sql' => 1, | |
| 'topdown.php' => 1, | |
| 'jsondumpdata.php' => 1, | |
| 'romannumberformatter.php' => 1, | |
| 'entrypoint.php' => 1, | |
| 'parserhooks.php' => 1, | |
| 'parserhooks.i18n.php' => 1, | |
| 'defaultconfig.php' => 1, | |
| 'maps_settings.php' => 1, | |
| 'maps.resources.php' => 1, | |
| 'maps.php' => 1, | |
| 'maps.i18n.namespaces.php' => 1, | |
| 'maps.i18n.magic.php' => 1, | |
| 'maps.i18n.alias.php' => 1, | |
| 'maps.hooks.php' => 1, | |
| 'jazawordpressintegrationbundle.php' => 1, | |
| 'subpagelist.i18n.magic.php' => 1, | |
| 'jazadrupalintegrationbundle.php' => 1, | |
| 'm3d.php' => 1, | |
| 'env.inc.php' => 1, | |
| 'triageclient.php' => 1, | |
| 'composer.json.sample' => 1, | |
| 'composerscripts.php' => 1, | |
| 'strip' => 1, | |
| 'structure.mdj' => 1, | |
| 'phpthumb.config.php.default' => 1, | |
| 'var-dump-check.php' => 1, | |
| 'var-dump-check' => 1, | |
| 'parallel-lint.php' => 1, | |
| 'parallel-lint' => 1, | |
| 'romannumberformattertest.php' => 1, | |
| 'subpagelist.php' => 1, | |
| 'user_permission.sql' => 1, | |
| 'rssitemawareinterface.php' => 1, | |
| 'jokubasrlithuaniannamesdeclensionbundle.php' => 1, | |
| 'jpcportfoliobundle.php' => 1, | |
| 'base-db.sql' => 1, | |
| 'walt' => 1, | |
| 'phpspec-coverage.yml' => 1, | |
| 'qt-faststart' => 1, | |
| 'ffprobe' => 1, | |
| 'ffmpeg' => 1, | |
| 'jmoatiswarrotbootstrapbundle.php' => 1, | |
| 'jmoatigeneratorbundle.php' => 1, | |
| 'jmoatiexiftoolbundle.php' => 1, | |
| 'rssitemawaretrait.php' => 1, | |
| 'rsschannelawaretrait.php' => 1, | |
| 'subpagelist.settings.php' => 1, | |
| 'rsschannelawareinterface.php' => 1, | |
| 'cmfrssbundle.php' => 1, | |
| 'jtuserbundle.php' => 1, | |
| 'jtadsbundle.php' => 1, | |
| 'gozer_config_template.php' => 1, | |
| 'create_oauth_tables.sql' => 1, | |
| 'checkoutruapi.php' => 1, | |
| 'jquery.masked.datevalidator.min.js' => 1, | |
| 'jquery.masked.datevalidator.js' => 1, | |
| 'jhovanictcpdfbundle.php' => 1, | |
| 'blockmodelsasset.php' => 1, | |
| 'blockmodels.php' => 1, | |
| 'validator.i18n.php' => 1, | |
| 'ongoingsitemapbundle.php' => 1, | |
| 'compare_schemas.drush.inc' => 1, | |
| 'lcpdocusignbundle.php' => 1, | |
| 'kunstmaangeneratorbundle.php' => 1, | |
| 'kunstmaanseobundle.php' => 1, | |
| 'kunstmaansearchbundle.php' => 1, | |
| 'kunstmaanredirectbundle.php' => 1, | |
| 'kunstmaanpagepartbundle.php' => 1, | |
| 'kunstmaannodesearchbundle.php' => 1, | |
| 'kunstmaannodebundle.php' => 1, | |
| 'kunstmaannewrelicbundle.php' => 1, | |
| 'kunstmaanmenubundle.php' => 1, | |
| 'kunstmaanmediapagepartbundle.php' => 1, | |
| 'kunstmaanlivereloadbundle.php' => 1, | |
| 'kunstmaanleadgenerationbundle.php' => 1, | |
| 'kunstmaanlanguagechooserbundle.php' => 1, | |
| 'kunstmaanformbundle.php' => 1, | |
| 'kunstmaantaggingbundle.php' => 1, | |
| 'kunstmaanfixturesbundle.php' => 1, | |
| 'kunstmaandashboardbundle.php' => 1, | |
| 'setup_project.sh' => 1, | |
| 'upgrade-x.x' => 1, | |
| 'upgrade-3.5' => 1, | |
| 'kunstmaanbehatbundle.php' => 1, | |
| 'kunstmaanarticlebundle.php' => 1, | |
| 'kunstmaanadminnodebundle.php' => 1, | |
| 'kunstmaanadminlistbundle.php' => 1, | |
| 'pangu.php' => 1, | |
| 'pangu-test.php' => 1, | |
| 'pangu-cli.php' => 1, | |
| 'config_databases.php' => 1, | |
| 'kunstmaansitemapbundle.php' => 1, | |
| 'kunstmaanusermanagementbundle.php' => 1, | |
| 'personawidget.php' => 1, | |
| 'lcstudiosqacommandbundle.php' => 1, | |
| 'lzaztecnotificationbundle.php' => 1, | |
| 'example-advanced.php' => 1, | |
| 'lrotherfieldnotificationbundle.php' => 1, | |
| 'form_example.php' => 1, | |
| 'example_usage.php' => 1, | |
| 'lpuploaderbundle.php' => 1, | |
| 'userscontroller.php' => 1, | |
| 'wp-config-custom-sample.php' => 1, | |
| 'robots.txt.dist' => 1, | |
| 'template-selector.php' => 1, | |
| 'wpsymfonyform.php' => 1, | |
| 'reflectionfixturebundle.php' => 1, | |
| 'lcstudiosmetacommandbundle.php' => 1, | |
| 'kunstmaanutilitiesbundle.php' => 1, | |
| 'lcstudiosldapbundle.php' => 1, | |
| 'mainmigration.php' => 1, | |
| 'aceeditorwidget.php' => 1, | |
| 'sortlist.php' => 1, | |
| 'log_out.php' => 1, | |
| 'kyoushufoundationbundle.php' => 1, | |
| 'asseticcontrollersubstitute.php' => 1, | |
| 'kwrztwigexceptionbundle.php' => 1, | |
| 'odnoklassnikistrategy.php' => 1, | |
| 'spaceport' => 1, | |
| 'gfc' => 1, | |
| 'kunstmaanvotingbundle.php' => 1, | |
| 'kunstmaanviewbundle.php' => 1, | |
| 'to-do' => 1, | |
| 'personauseridentity.php' => 1, | |
| 'environment.drush.inc' => 1, | |
| 'crunchuseradminbundle.php' => 1, | |
| 'parameters.yml~' => 1, | |
| 'wellsfargoachbundle.php' => 1, | |
| 'kitanopelbundle.php' => 1, | |
| 'kitanopaymentsipsbundle.php' => 1, | |
| 'kitanopaymentfakebundle.php' => 1, | |
| 'kitanopaymentcmcicbundle.php' => 1, | |
| 'paymentexception.php' => 1, | |
| 'kitanopaymentevents.php' => 1, | |
| 'kitanopaymentbundle.php' => 1, | |
| 'kitanocachebundle.php' => 1, | |
| 'kingboard.zip' => 1, | |
| 'ccp' => 1, | |
| 'crunchssibundle.php' => 1, | |
| 'profilesbehat3drupal.yml.sample' => 1, | |
| 'crunchcachecontrolbundle.php' => 1, | |
| 'cache-control.phar' => 1, | |
| 'kutilbundle.php' => 1, | |
| 'biogena-data.php' => 1, | |
| 'kifdoctrinetotypescriptbundle.php' => 1, | |
| 'enforce.php' => 1, | |
| 'khaldounvatvalidationbundle.php' => 1, | |
| 'urlgenerator.class.php' => 1, | |
| 'sync_tools.drush.inc' => 1, | |
| 'multidrush.drush.inc' => 1, | |
| 'multidrush.class.php' => 1, | |
| 'diagnostics.drush.inc' => 1, | |
| 'example.env.drushrc.php' => 1, | |
| 'profiles.yml.sample' => 1, | |
| 'projects.yml.sample' => 1, | |
| 'persona.php' => 1, | |
| 'readme-sk.texy' => 1, | |
| 'inittool.php' => 1, | |
| 'kchsmsapibundle.php' => 1, | |
| 'facebookconnectrestbundle.php' => 1, | |
| 'pixiv.php' => 1, | |
| 'kotori.php' => 1, | |
| 'maxim3.jpg' => 1, | |
| 'koodimonni-modifications.php' => 1, | |
| 'yandexmetrikabundle.php' => 1, | |
| 'readme.rus' => 1, | |
| 'handlersocketbundle.php' => 1, | |
| 'asseticstaticgzipbundle.php' => 1, | |
| 'validate' => 1, | |
| 'brouziesphinxybundle.php' => 1, | |
| 'settings.yml.sample' => 1, | |
| 'brouziecrossdomainauthbundle.php' => 1, | |
| 'musefactory.php' => 1, | |
| 'muse.php' => 1, | |
| 'knptimebundle.php' => 1, | |
| 'knprevealbundle.php' => 1, | |
| 'gh-changelog-template.tpl' => 1, | |
| 'knppaginatorbundle.php' => 1, | |
| 'knpoauthbundle.php' => 1, | |
| 'knpmediaexposerbundle.php' => 1, | |
| 'knpmarkupvalidatorbundle.php' => 1, | |
| 'knpmailjetbundle.php' => 1, | |
| 'knplasttweetsbundle.php' => 1, | |
| 'knpconsoleautocompletebundle.php' => 1, | |
| 'en_pt.csv' => 1, | |
| 'es_es.csv' => 1, | |
| 'yiiquaggaasset.php' => 1, | |
| 'bmconsole.php' => 1, | |
| 'bmdataobjectmap.php' => 1, | |
| 'bmdataobjectfield.php' => 1, | |
| 'bmdataobject.php' => 1, | |
| 'bmdaemon.php' => 1, | |
| 'bmcustomwebsession.php' => 1, | |
| 'bmcustomuser.php' => 1, | |
| 'bmcustomtextprocessor.php' => 1, | |
| 'bmcustomsession.php' => 1, | |
| 'bmcustomremoteprocedure.php' => 1, | |
| 'bmcustomcontentprovider.php' => 1, | |
| 'bmcustomapplication.php' => 1, | |
| 'bmcurl.php' => 1, | |
| 'bmcgi.php' => 1, | |
| 'bmffdata.php' => 1, | |
| 'bmcachelink.php' => 1, | |
| 'bmapi.php' => 1, | |
| 'load_dumps.sh' => 1, | |
| 'lib' => 1, | |
| 'ignoredfiles.tar' => 1, | |
| 'backup.sh' => 1, | |
| 'nicparrycurlbundle.php' => 1, | |
| 'codememedaemonbundle.php' => 1, | |
| 'nibynoolfitbitstoragebundle.php' => 1, | |
| 'nibynoolfitbitinterfacebundle.php' => 1, | |
| 'nhacsamdatatablesbundle.php' => 1, | |
| 'nimworkerbundle.php' => 1, | |
| 'bmdatetime.php' => 1, | |
| 'bmffobject.php' => 1, | |
| 'nimvaccinebundle.php' => 1, | |
| 'bmreferencefield.php' => 1, | |
| 'karma' => 1, | |
| 'vhost.example' => 1, | |
| 'nicocontactbundle.php' => 1, | |
| 'corezoid.php' => 1, | |
| 'sonataextendsbundle' => 1, | |
| 'lumensonataextendsbundle.php' => 1, | |
| 'test-runner' => 1, | |
| 'bmxcache.php' => 1, | |
| 'bmtools.php' => 1, | |
| 'bmtextprocessor.php' => 1, | |
| 'bmstemmer.php' => 1, | |
| 'bmreferencemap.php' => 1, | |
| 'bmredis.php' => 1, | |
| 'bmfilemanager.php' => 1, | |
| 'bmpersistentcachelink.php' => 1, | |
| 'bmpage.php' => 1, | |
| 'bmphpsession.php' => 1, | |
| 'bmmysqllink.php' => 1, | |
| 'bmmigration.php' => 1, | |
| 'bmmetadataobject.php' => 1, | |
| 'bmmailer.php' => 1, | |
| 'bmlog.php' => 1, | |
| 'bmimageresizemodule.php' => 1, | |
| 'bmimigrate.php' => 1, | |
| 'bmhtmlpage.php' => 1, | |
| 'bmgenerator.php' => 1, | |
| 'bmflashsession.php' => 1, | |
| 'nimwebbundle.php' => 1, | |
| 'nimmissionbundle.php' => 1, | |
| 'filesource.php' => 1, | |
| 'sugarcrmrestbundle-devdoc-0.2.pdf' => 1, | |
| 'datatableevents.php' => 1, | |
| 'netteamdddbundle.php' => 1, | |
| 'vendors' => 1, | |
| 'nercuryreverseinjectionbundle.php' => 1, | |
| 'sample-web.php' => 1, | |
| 'sample-newsletter.php' => 1, | |
| 'fresque.ini' => 1, | |
| 'fresque' => 1, | |
| 'nxprutilsbundle.php' => 1, | |
| 'builds' => 1, | |
| 'neodorksonataredirectbundle.php' => 1, | |
| 'sugarrestbundle.php' => 1, | |
| 'nemfontawesomebundle.php' => 1, | |
| 'abstractcommtoolbuilder.php' => 1, | |
| 'nemangularjsbundle.php' => 1, | |
| 'neklandeditionbundle.php' => 1, | |
| 'neklandbaseadminbundle.php' => 1, | |
| 'neirda24toolsbundle.php' => 1, | |
| 'html2canvasproxyevents.php' => 1, | |
| 'html2canvasproxybundle.php' => 1, | |
| 'liipthemeprovidertags.php' => 1, | |
| 'liipthemeproviderbundle.php' => 1, | |
| 'nebumixrtvalidationbundle.php' => 1, | |
| 'update_doc.sh' => 1, | |
| 'sample_data.json' => 1, | |
| 'dicts.php' => 1, | |
| 'autocorrect.php' => 1, | |
| 'netteamdatatablebundle.php' => 1, | |
| 'campaigncommtool.php' => 1, | |
| 'nimformbundle.php' => 1, | |
| 'excelrowinterface.php' => 1, | |
| 'nimcorebundle.php' => 1, | |
| 'apache-2.4_vhost.conf' => 1, | |
| 'newbridgegreenextjsbundle.php' => 1, | |
| 'bootstrapmarkdown.php' => 1, | |
| 'composer.sh' => 1, | |
| 'gendoc.sh' => 1, | |
| 'netpositivediscriminatormapbundle.php' => 1, | |
| 'whosonlinebundle.php' => 1, | |
| 'uploadexcelevents.php' => 1, | |
| 'uploadexcelbundle.php' => 1, | |
| 'rowvalidatorinterface.php' => 1, | |
| 'mivalidador.php' => 1, | |
| 'excelrow.php' => 1, | |
| 'commtoolbuilderinterface.php' => 1, | |
| 'ejemplo.php' => 1, | |
| 'transactionalsending.php' => 1, | |
| 'jangomailfosuser.php' => 1, | |
| 'jangomailbundle.php' => 1, | |
| 'jangomail.php' => 1, | |
| 'campaignsending.php' => 1, | |
| 'abstractsending.php' => 1, | |
| 'sectionfactory.php' => 1, | |
| 'commtooltemplatebundle.php' => 1, | |
| 'templateview.php' => 1, | |
| 'optimecommtoolbundle.php' => 1, | |
| 'controlfactory.php' => 1, | |
| 'commtoolfactory.php' => 1, | |
| 'solidifier' => 1, | |
| 'nileadloaderbundle.php' => 1, | |
| 'iplocation.php' => 1, | |
| 'unisenderwrapper.php' => 1, | |
| 'openclassroomscachebundle.php' => 1, | |
| 'openclassroomsakismetbundle.php' => 1, | |
| '.srcutinizer.yml' => 1, | |
| 'openwidezendcaptchabundle.php' => 1, | |
| 'openwidesynchronizeldapuserbundle.php' => 1, | |
| 'openwidepublishservicebundle.php' => 1, | |
| 'openwideagendabundle.php' => 1, | |
| 'opaleexternaluribundle.php' => 1, | |
| 'opaleconsoleexceptionbundle.php' => 1, | |
| 'timestampmacro.php' => 1, | |
| 'redis-driver-installer.sh' => 1, | |
| 'unisender.php' => 1, | |
| 'olousouzianatlasbundle.php' => 1, | |
| 'openclassroomsdoctrinecacheextensionbundle.php' => 1, | |
| 'olousouzianakitabundle.php' => 1, | |
| 'ngsfformbundle.php' => 1, | |
| 'mongorevisionbehavior.php' => 1, | |
| 'winmerge images only.flt' => 1, | |
| 'winmerge client only.flt' => 1, | |
| 'fuelstart db.sql' => 1, | |
| 'fs' => 1, | |
| 'fuelphp license' => 1, | |
| 'fuel start license' => 1, | |
| 'chartistasset.php' => 1, | |
| 'chartist.php' => 1, | |
| 'steamio.php' => 1, | |
| 'openclassroomscustomeriobundle.php' => 1, | |
| 'openclassroomselasticsearchbundle.php' => 1, | |
| 'aws_et.php' => 1, | |
| 'opiferrulesenginebundle.php' => 1, | |
| 'orbitaleintegrationbundle.php' => 1, | |
| 'references.php' => 1, | |
| 'commandresponse.php' => 1, | |
| 'commandoptions.php' => 1, | |
| 'orbitalegrypbundle.php' => 1, | |
| 'orbitalegamebundle.php' => 1, | |
| 'entitymerger.php' => 1, | |
| 'emptyclassmetadata.php' => 1, | |
| 'baseentityrepository.php' => 1, | |
| 'orbitalecmsbundle.php' => 1, | |
| 'orbitaleapibundle.php' => 1, | |
| 'manload.php' => 1, | |
| 'opiferredirectbundle.php' => 1, | |
| 'openclassroomsoneskybundle.php' => 1, | |
| 'opiferformbundle.php' => 1, | |
| 'opifereavbundle.php' => 1, | |
| 'opifercrudbundle.php' => 1, | |
| 'testfile' => 1, | |
| 'eden.php' => 1, | |
| 'hafasxmlinterface.xsd' => 1, | |
| 'leggimi' => 1, | |
| 'opencontentopenmagazinebundle.php' => 1, | |
| 'openizijsonwebprofilerbundle.php' => 1, | |
| 'make_release.sh' => 1, | |
| 'openclassroomsusecasebundle.php' => 1, | |
| 'openclassroomstranslationbundle.php' => 1, | |
| 'openclassroomsserviceproxybundle.php' => 1, | |
| 'oire_mail.php' => 1, | |
| 'sendsmscomponent.php' => 1, | |
| 'basicobject.php' => 1, | |
| 'eauth.php' => 1, | |
| 'novaezresponsiveimagesbundle.php' => 1, | |
| 'notifierbundle.php' => 1, | |
| 'excelarray.class.php' => 1, | |
| 'apache.conf' => 1, | |
| 'iauthservice.php' => 1, | |
| 'eopenidservice.php' => 1, | |
| 'eoauthservice.php' => 1, | |
| 'eoauth2service.php' => 1, | |
| 'eauthwidget.php' => 1, | |
| 'eauthuseridentity.php' => 1, | |
| 'eauthservicebase.php' => 1, | |
| 'eauthredirectwidget.php' => 1, | |
| 'example-google_apps.php' => 1, | |
| 'sf2helperssftpbundle.php' => 1, | |
| '__autoload.php' => 1, | |
| 'nobox' => 1, | |
| 'nsutilbundle.php' => 1, | |
| 'nssecuritybundle.php' => 1, | |
| 'nsflashbundle.php' => 1, | |
| 'nsfilteredpaginationbundle.php' => 1, | |
| 'filteredpagination.php' => 1, | |
| 'nsdistancebundle.php' => 1, | |
| 'nssonatadoctrineormadminbundle.php' => 1, | |
| 'nsacesonatabundle.php' => 1, | |
| 'nsacebundle.php' => 1, | |
| 'validatingbasicobject.php' => 1, | |
| 'ibasicobjectmemcache.php' => 1, | |
| 'novaezseobundle.php' => 1, | |
| 'nyxisgooglemapbundle.php' => 1, | |
| 'iconsasset.php' => 1, | |
| 'init.yml' => 1, | |
| 'responsetemplate.php' => 1, | |
| 'octopod.php' => 1, | |
| 'basehandler.php' => 1, | |
| 'googleloginbutton.php' => 1, | |
| 'proxy-manager.svg' => 1, | |
| 'proxy-manager.png' => 1, | |
| 'stability' => 1, | |
| 'finalizer' => 1, | |
| 'oisfunctions.php' => 1, | |
| 'translator_config.yml' => 1, | |
| 'translator_config.diff.yml' => 1, | |
| 'spyc-0.5.zip' => 1, | |
| 'cache.appcache' => 1, | |
| 'october' => 1, | |
| 'oxikoneapibundle.php' => 1, | |
| 'cookbook.jpg' => 1, | |
| 'solrconfig.xml' => 1, | |
| 'solrconfig-5.xml' => 1, | |
| 'schema-5.xml' => 1, | |
| 'logging.properties' => 1, | |
| 'core.properties' => 1, | |
| 'synonyms' => 1, | |
| 'stopwords' => 1, | |
| 'opcvm360wrapperbundle.php' => 1, | |
| 'oktolabmediaevent.php' => 1, | |
| 'oktolabmediabundle.php' => 1, | |
| 'october.yaml' => 1, | |
| 'qqwry.dat' => 1, | |
| 'socialbundle.php' => 1, | |
| 'et_ee.csv' => 1, | |
| 'run-cept' => 1, | |
| 'sprite' => 1, | |
| 'make-junctions' => 1, | |
| 'sitcom.yml' => 1, | |
| 'sitcom' => 1, | |
| 'sigurd' => 1, | |
| 'signals-pre-false-filter.yml' => 1, | |
| 'signals-post-false-filter.yml' => 1, | |
| 'signals' => 1, | |
| 'make-links' => 1, | |
| 'composer-1426786617.json.bak' => 1, | |
| 'maquinette' => 1, | |
| 'run-cepts' => 1, | |
| 'make-messages' => 1, | |
| 'staple' => 1, | |
| 'make-cept' => 1, | |
| 'hedron' => 1, | |
| '.hedron.example.yml' => 1, | |
| 'travis-ocular.sh' => 1, | |
| 'i18n-extractor' => 1, | |
| 'twitterextension.php' => 1, | |
| 'authenticationexception.php' => 1, | |
| 'distancematrix.php' => 1, | |
| 'bytesdocraptorbundle.php' => 1, | |
| 'itunes-m3u' => 1, | |
| 'rce.sublime-workspace' => 1, | |
| 'rce.sublime-project' => 1, | |
| 'sprite.yml' => 1, | |
| 'whitelist.yml' => 1, | |
| 'marijnkoesencodegeneratorbundle.php' => 1, | |
| 'breadcrumbsutility.php' => 1, | |
| '.gitingore' => 1, | |
| 'herokuwebapiserviceprovider.php' => 1, | |
| 'herokuwebapi.php' => 1, | |
| 'rapidauthorization.php' => 1, | |
| 'clientpreferences.php' => 1, | |
| 'availablepreferences.php' => 1, | |
| 'tumblroauth.php' => 1, | |
| 'abstractoauthclient.php' => 1, | |
| 'linkedinoauth.php' => 1, | |
| 'instagramoauth.php' => 1, | |
| 'ccouchconnect.php' => 1, | |
| 'matthimatikeropcachebundle.php' => 1, | |
| 'annotationparserinterface.php' => 1, | |
| '.zamm-example.yml' => 1, | |
| 'annotationparameter.php' => 1, | |
| 'annotationobject.php' => 1, | |
| 'annotationmethod.php' => 1, | |
| 'annotationfunctiontrait.php' => 1, | |
| 'annotationfunction.php' => 1, | |
| 'annotationclass.php' => 1, | |
| 'techpafannotationfirewallbundle.php' => 1, | |
| 'mattdunbarusermicroservicebundle.php' => 1, | |
| 'matthecathtmlcompressorbundle.php' => 1, | |
| 'fort' => 1, | |
| 'htmlpurifier.standalone.php' => 1, | |
| 'autouploader.php' => 1, | |
| 'zamm' => 1, | |
| 'config.local.php-dist' => 1, | |
| 'mbrightrepresentbundle.php' => 1, | |
| 'bambooapibundle.php' => 1, | |
| 'phparray.class.php' => 1, | |
| 'sfs-mass-ip-checker.php' => 1, | |
| 'phpmussel.php' => 1, | |
| 'people' => 1, | |
| 'changelog-v1' => 1, | |
| 'baseassets.php' => 1, | |
| 'ajaxinputwidget.php' => 1, | |
| 'ajaxinputasset.php' => 1, | |
| 'routefinder.php' => 1, | |
| 'accessobject.php' => 1, | |
| 'eventloginterface.php' => 1, | |
| 'eventlogindb.php' => 1, | |
| 'phparray.test.php' => 1, | |
| 'magweldispatcherbundle.php' => 1, | |
| 'majescmsbundle.php' => 1, | |
| 'zh_cn.csv' => 1, | |
| 'uk_ua.csv' => 1, | |
| 'tr_tr.csv' => 1, | |
| 'sk_sk.csv' => 1, | |
| 'pt_pt.csv' => 1, | |
| 'pt_br.csv' => 1, | |
| 'nl_nl.csv' => 1, | |
| 'lv_lv.csv' => 1, | |
| 'it_it.csv' => 1, | |
| 'hu_hu.csv' => 1, | |
| 'hr_hr.csv' => 1, | |
| 'he_il.csv' => 1, | |
| 'fi_fi.csv' => 1, | |
| 'majesblogbundle.php' => 1, | |
| 'majescorebundle.php' => 1, | |
| 'v2.0.zip' => 1, | |
| 'logs-schema-mysql.sql' => 1, | |
| 'v1.1.zip' => 1, | |
| 'v1-0.zip' => 1, | |
| 'kanda.php' => 1, | |
| 'kbase.php' => 1, | |
| 'exception_handler' => 1, | |
| 'likebroapirequest.php' => 1, | |
| 'mannewhipchatbundle.php' => 1, | |
| 'mango.php' => 1, | |
| 'mmmediabundle.php' => 1, | |
| 'mmcmfroutingbundle.php' => 1, | |
| 'mmcmfnodebundle.php' => 1, | |
| 'mmcmfmenubundle.php' => 1, | |
| 'zendeskbundle.php' => 1, | |
| 'majesmediabundle.php' => 1, | |
| 'malwarebytestestbundle.php' => 1, | |
| 'malwarebytesformmetadatabundle.php' => 1, | |
| 'malwarebytesaltamirabundle.php' => 1, | |
| 'chartfactory.php' => 1, | |
| 'altamira-config.ini' => 1, | |
| 'asbowhoswhoevents.php' => 1, | |
| 'asbowhoswhobundle.php' => 1, | |
| 'alfrescodocument.php' => 1, | |
| 'alfrescodoc-joomla.xml' => 1, | |
| 'alfrescodoc-joomla.php' => 1, | |
| 'alfresco_cmis_api.php' => 1, | |
| 'majessocialbundle.php' => 1, | |
| 'majessearchbundle.php' => 1, | |
| 'mediamonksrestapibundle.php' => 1, | |
| 'daemonbundle.php' => 1, | |
| 'vssresourcesfirewallbundle.php' => 1, | |
| 'morphodoindexerbundle.php' => 1, | |
| 'mrgreenstuffaclsonataadminextensionbundle.php' => 1, | |
| 'url_shortener.sqlite' => 1, | |
| 'php.travis.ini' => 1, | |
| 'foundation' => 1, | |
| 'myext.php' => 1, | |
| 'steppaginationfactory.php' => 1, | |
| 'paginationiteratorinterface.php' => 1, | |
| 'paginationiterator.php' => 1, | |
| 'paginationfactoryinterface.php' => 1, | |
| 'neighbourpaginationfactory.php' => 1, | |
| 'logpaginationfactory.php' => 1, | |
| 'fullpaginationfactory.php' => 1, | |
| 'morphodocrawlerbundle.php' => 1, | |
| 'mrmentityvalidationbundle.php' => 1, | |
| 'platform.ini' => 1, | |
| 'php.5.5' => 1, | |
| 'repositories.json' => 1, | |
| 'morkethmvcbundle.php' => 1, | |
| 'morannonbundle.php' => 1, | |
| 'moovlyrecurlybundle.php' => 1, | |
| 'robots.prod' => 1, | |
| 'robots.dev' => 1, | |
| 'channel.html' => 1, | |
| 'getval' => 1, | |
| 'envfile.php' => 1, | |
| 'thbaseservicetest.php' => 1, | |
| 'thbaseservice.thrift' => 1, | |
| 'dbg.php' => 1, | |
| 'mrmisotestbundle.php' => 1, | |
| 'hbase.thrift' => 1, | |
| 'mykeestagbundle.php' => 1, | |
| 'vssoauthextensionbundle.php' => 1, | |
| 'phpoole.php' => 1, | |
| 'napasformextrabundle.php' => 1, | |
| 'user_guide_magento2.pdf' => 1, | |
| 'guide_utilisation_magento2.pdf' => 1, | |
| 'modify.php' => 1, | |
| 'add.php' => 1, | |
| 'nfcuploadbundle.php' => 1, | |
| 'pubstack' => 1, | |
| 'nzourlencryptorbundle.php' => 1, | |
| 'nzograbberbundle.php' => 1, | |
| 'nzofiledownloaderbundle.php' => 1, | |
| 'mykeesmediabundle.php' => 1, | |
| '.travis.yml~' => 1, | |
| 'mykeescommentbundle.php' => 1, | |
| 'mvcblogbundle.php' => 1, | |
| 'restedservice.php' => 1, | |
| 'restedbundle.php' => 1, | |
| 'abstractresource.php' => 1, | |
| 'mykrzysiusmsapibundle.php' => 1, | |
| 'tour.php' => 1, | |
| 'bootstraptourpluginasset.php' => 1, | |
| 'mustached_test.sql' => 1, | |
| 'myextensionslist.json' => 1, | |
| 'config.cson' => 1, | |
| 'bagel.cmd.html' => 1, | |
| '.tgitconfig' => 1, | |
| 'hbasetest.php' => 1, | |
| 'mollom.class.inc' => 1, | |
| 'jiraapibundle.php' => 1, | |
| 'adminltebootstrap.php' => 1, | |
| 'build-repo.php' => 1, | |
| 'wunderdatamailchimpbundle.php' => 1, | |
| 'filter' => 1, | |
| 'zsh_completion' => 1, | |
| 'moosh.php' => 1, | |
| 'framelayout.php' => 1, | |
| 'moderatorpanel.php' => 1, | |
| 'linkwidget.php' => 1, | |
| 'framewidget.php' => 1, | |
| 'imageuploadwidget.php' => 1, | |
| 'fileuploadwidget.php' => 1, | |
| 'brainthemebootstrap.php' => 1, | |
| 'blogbootstrap.php' => 1, | |
| 'bar.navigation.panel.latte' => 1, | |
| 'migrate.sh' => 1, | |
| 'makedb.sh' => 1, | |
| 'getconfig' => 1, | |
| 'appinit.bat' => 1, | |
| 'appinit' => 1, | |
| 'commentatorasset.php' => 1, | |
| 'fontcolorbyimage.class.php' => 1, | |
| 'mewesktwigexcelbundle.php' => 1, | |
| 'cjuidatetimepicker.php' => 1, | |
| 'dash.html' => 1, | |
| 'yii2_start_slider.sql' => 1, | |
| 'widgetapn.php' => 1, | |
| 'stashapibundle.php' => 1, | |
| 'navigationpanel.php' => 1, | |
| 'couchbaseconnection.php' => 1, | |
| 'xxxreadme' => 1, | |
| 'mmdhelperbundle.php' => 1, | |
| 'uploadreadme' => 1, | |
| 'viewcount.php' => 1, | |
| 'sendslackbestarticles.php' => 1, | |
| 'readerserviceprovider.php' => 1, | |
| 'ireader.php' => 1, | |
| 'crawlfeed.php' => 1, | |
| 'blogcontroller.php' => 1, | |
| 'articlecontroller.php' => 1, | |
| 'cashive.php' => 1, | |
| 'mmdsourceboxbundle.php' => 1, | |
| 'mmdmcmonitorbundle.php' => 1, | |
| 'mmdimprovbundle.php' => 1, | |
| 'mmdgooglewebfontscachebundle.php' => 1, | |
| 'quaver.sql' => 1, | |
| 'mmdgithubapicachebundle.php' => 1, | |
| 'mmdcassandrabundle.php' => 1, | |
| 'mmdcaptchabundle.php' => 1, | |
| 'mmdapebundle.php' => 1, | |
| 'igniterelasticachebundle.php' => 1, | |
| 'validate.json' => 1, | |
| '.validate.json' => 1, | |
| 'misatobootstrapduallistboxbundle.php' => 1, | |
| 'minify_html.php' => 1, | |
| 'minishlinkwebpushbundle.php' => 1, | |
| 'minecraftjp.php' => 1, | |
| 'testbootstrap.php' => 1, | |
| 'codeigniterinstructions' => 1, | |
| 'barcode-test.php' => 1, | |
| 'yiiquagga.php' => 1, | |
| 'epilgrimmodifyrequestheadersbundle.php' => 1, | |
| 'easyajax.php' => 1, | |
| 'urltoquery.php' => 1, | |
| 'reject-and-notify.php' => 1, | |
| 'raph.php' => 1, | |
| 'pentothal.php' => 1, | |
| 'occipital-in-theme-guide' => 1, | |
| 'occipital.php' => 1, | |
| 'screenshot-03.png' => 1, | |
| 'screenshot-02.png' => 1, | |
| 'screenshot-01.png' => 1, | |
| 'fcpch-helpers.php' => 1, | |
| 'fcpch-admin.php' => 1, | |
| 'fc-post-content-handler.php' => 1, | |
| 'cleverrules.php' => 1, | |
| 'url_to_query.php' => 1, | |
| 'ajax-template-part.php' => 1, | |
| 'checklist' => 1, | |
| 'jstorage.min.js' => 1, | |
| 'jstorage.js' => 1, | |
| 'jquery.md5.min.js' => 1, | |
| 'jquery.md5.js' => 1, | |
| 'gizlabtranslationbundle.php' => 1, | |
| 'single_post_layout.html' => 1, | |
| 'single_post_header.html' => 1, | |
| 'header.html' => 1, | |
| 'head.html' => 1, | |
| 'base.html' => 1, | |
| 'urltoqueryitem.php' => 1, | |
| 'gliferycrudabstractdatabundle.php' => 1, | |
| 'archive.plugin.php' => 1, | |
| 'providerservice.php' => 1, | |
| 'grcsinternalmessagesbundle.php' => 1, | |
| 'gouttewordpressbundle.php' => 1, | |
| 'gouttetreebundle.php' => 1, | |
| 'blackboard' => 1, | |
| 'wp-goracash.php' => 1, | |
| 'app.yaml.dist' => 1, | |
| 'gollumsflibsassbundle.php' => 1, | |
| 'bugsnagplugin.php' => 1, | |
| 'gterrortracker.php' => 1, | |
| 'goldenlineimgixbundle.php' => 1, | |
| 'goldenlinealgoliabundle.php' => 1, | |
| 'publisherservice.php' => 1, | |
| 'gointegrohateoasbundle.php' => 1, | |
| 'gliferyentityhiddentypebundle.php' => 1, | |
| 'mailchimpbundle.php' => 1, | |
| 'acltreebundle.php' => 1, | |
| 'dastatbundle.php' => 1, | |
| 'dapaginatorbundle.php' => 1, | |
| 'daoauthserverbundle.php' => 1, | |
| 'daoauthclientbundle.php' => 1, | |
| 'daauthcommonbundle.php' => 1, | |
| 'daapiserverbundle.php' => 1, | |
| 'daapiclientbundle.php' => 1, | |
| 'dalessbundle.php' => 1, | |
| 'dadibundle.php' => 1, | |
| 'gttcryptbundle.php' => 1, | |
| 'cryptorregistry.php' => 1, | |
| 'rss.plugin.php' => 1, | |
| 'archive.html' => 1, | |
| 'threads.php' => 1, | |
| 'haloapi.class.php' => 1, | |
| 'gcobngtablebundle.php' => 1, | |
| 'class-gamajo-template-loader.php' => 1, | |
| 'phpunit.record.xml' => 1, | |
| 'phpunit.live.xml' => 1, | |
| 'garethpsainsburryscraperbundle.php' => 1, | |
| 'garethpphotosbundle.php' => 1, | |
| 'garethpitsalwaysfivebundle.php' => 1, | |
| 'translatorbundle.php' => 1, | |
| 'gabe96multi5bundle.php' => 1, | |
| 'gayaphpsandboxbundle.php' => 1, | |
| 'ioformbundle.php' => 1, | |
| 'gtheronrestbundle.php' => 1, | |
| 'ggteambreadcrumbbundle.php' => 1, | |
| 'bugs.php' => 1, | |
| 'formdatepickerfield.php' => 1, | |
| 'datepickerfield.php' => 1, | |
| 'formaddresspickerfield.php' => 1, | |
| 'addresspickerfield.php' => 1, | |
| 'please' => 1, | |
| 'lensesframework.pdf' => 1, | |
| 'funstaffredirectevents.php' => 1, | |
| 'funstaffredirectbundle.php' => 1, | |
| 'fwslayoutbundle.php' => 1, | |
| 'frydrynotificationbundle.php' => 1, | |
| 'mqtranslate_xhaleera_addons.php' => 1, | |
| 'mqtranslate_wphacks.php' => 1, | |
| 'mqtranslate_widget_qtranslate-slug.php' => 1, | |
| 'externaltrackingbundle.php' => 1, | |
| 'demotext.php' => 1, | |
| 'write.html' => 1, | |
| 'widgettwigextension.php' => 1, | |
| 'posts.html' => 1, | |
| 'edit.html' => 1, | |
| 'admin_header.html' => 1, | |
| 'admin_head.html' => 1, | |
| 'admin_base.html' => 1, | |
| 'admin.plugin.php' => 1, | |
| 'admin.html' => 1, | |
| 'stream-laravel.sublime-project' => 1, | |
| 'gitignore' => 1, | |
| 'sfvoterbundle.php' => 1, | |
| 'mastersliderasset.php' => 1, | |
| 'masterslider.php' => 1, | |
| 'widgetregistryinterface.php' => 1, | |
| 'flatplane.inc.php' => 1, | |
| 'widgetregistry.php' => 1, | |
| 'ws_logo.jpeg' => 1, | |
| 'goswebsocketbundle.php' => 1, | |
| 'gospubsubrouterbundle.php' => 1, | |
| 'gosmailerbundle.php' => 1, | |
| 'gosformbundle.php' => 1, | |
| 'gosfixturebundle.php' => 1, | |
| 'fixture.php' => 1, | |
| 'querybuildableinterface.php' => 1, | |
| 'gosentityrepository.php' => 1, | |
| 'settings_sample.ini' => 1, | |
| 'genedyscsrfroutebundle.php' => 1, | |
| 'gendoriaparamconverterbundle.php' => 1, | |
| 'grcstorbundle.php' => 1, | |
| 'binstring.example1.php' => 1, | |
| 'mqtranslate_widget.inc.php' => 1, | |
| 'abstractcacheadapter.php' => 1, | |
| 'abstractentitybodydecorator.php' => 1, | |
| 'toarrayinterface.php' => 1, | |
| 'hasdispatcherinterface.php' => 1, | |
| 'fromconfiginterface.php' => 1, | |
| 'abstracthasdispatcher.php' => 1, | |
| 'zf2cacheadapter.php' => 1, | |
| 'zf1cacheadapter.php' => 1, | |
| 'nullcacheadapter.php' => 1, | |
| 'doctrinecacheadapter.php' => 1, | |
| 'closurecacheadapter.php' => 1, | |
| 'cacheadapterinterface.php' => 1, | |
| 'cacheadapterfactory.php' => 1, | |
| 'notifyingbatch.php' => 1, | |
| 'entitybody.php' => 1, | |
| 'historybatch.php' => 1, | |
| 'flushingbatch.php' => 1, | |
| 'exceptionbufferingbatch.php' => 1, | |
| 'batchtransferinterface.php' => 1, | |
| 'batchsizedivisor.php' => 1, | |
| 'batchrequesttransfer.php' => 1, | |
| 'batchinterface.php' => 1, | |
| 'batchdivisorinterface.php' => 1, | |
| 'batchcommandtransfer.php' => 1, | |
| 'batchclosuretransfer.php' => 1, | |
| 'batchclosuredivisor.php' => 1, | |
| 'batchbuilder.php' => 1, | |
| 'cachingentitybody.php' => 1, | |
| 'entitybodyinterface.php' => 1, | |
| 'dson.php' => 1, | |
| 'messageformatter.php' => 1, | |
| 'callbackbackoffstrategy.php' => 1, | |
| 'backoffstrategyinterface.php' => 1, | |
| 'backoffplugin.php' => 1, | |
| 'backofflogger.php' => 1, | |
| 'abstracterrorcodebackoffstrategy.php' => 1, | |
| 'abstractbackoffstrategy.php' => 1, | |
| 'asyncplugin.php' => 1, | |
| 'parserregistry.php' => 1, | |
| 'zf2logadapter.php' => 1, | |
| 'zf1logadapter.php' => 1, | |
| 'psrlogadapter.php' => 1, | |
| 'monologlogadapter.php' => 1, | |
| 'logadapterinterface.php' => 1, | |
| 'ioemittingentitybody.php' => 1, | |
| 'closurelogadapter.php' => 1, | |
| 'arraylogadapter.php' => 1, | |
| 'abstractlogadapter.php' => 1, | |
| 'methodproxyiterator.php' => 1, | |
| 'filteriterator.php' => 1, | |
| 'chunkediterator.php' => 1, | |
| 'appenditerator.php' => 1, | |
| 'precomputedinflector.php' => 1, | |
| 'memoizinginflector.php' => 1, | |
| 'inflectorinterface.php' => 1, | |
| 'staticclient.php' => 1, | |
| 'redirectplugin.php' => 1, | |
| 'readlimitentitybody.php' => 1, | |
| 'abstractbatchdecorator.php' => 1, | |
| 'guilroprotectionproxybundle.php' => 1, | |
| 'binstring.example2.php' => 1, | |
| 'emptytimespan.php' => 1, | |
| 'grossumcontactbundle.php' => 1, | |
| 'basejob.php' => 1, | |
| 'facebookserviceprovider.php' => 1, | |
| 'dgjiraauthbundle.php' => 1, | |
| 'grifisdoctrinetableprefixbundle.php' => 1, | |
| 'greibitpaneladminbundle.php' => 1, | |
| 'phpserial.php' => 1, | |
| 'tex2pnghandler.php' => 1, | |
| 'gregwartex2pngbundle.php' => 1, | |
| 'slidey.php' => 1, | |
| 'timespan.php' => 1, | |
| 'planning.php' => 1, | |
| 'phpnet.php' => 1, | |
| 'grossumcustomentitymanagerbundle.php' => 1, | |
| 'license.htm' => 1, | |
| 'gnuplot.php' => 1, | |
| 'gregwarcaptchabundle.php' => 1, | |
| 'csvfile.php' => 1, | |
| 'tasks.properties' => 1, | |
| 'joomla' => 1, | |
| 'icontaineraware.php' => 1, | |
| 'composer-screenshot.png' => 1, | |
| 'documentation.css' => 1, | |
| 'relativepath.example1.php' => 1, | |
| 'opencmd.bat' => 1, | |
| 'binstringstatic.php' => 1, | |
| 'binstring.php' => 1, | |
| 'grossumcorebundle.php' => 1, | |
| 'grossumextendedformtypebundle.php' => 1, | |
| 'phpcbf.phar' => 1, | |
| 'blockrepository.php' => 1, | |
| 'generator.js' => 1, | |
| 'gthmrdfbundle.php' => 1, | |
| '_inuit.scss' => 1, | |
| '_defaults.scss' => 1, | |
| 'gtacoolinuitcssbundle.php' => 1, | |
| 'gtacoolhtml5inuitcssboilerplatebundle.php' => 1, | |
| 'version.sh' => 1, | |
| 'userrepository.php' => 1, | |
| 'repositoryexception.php' => 1, | |
| 'optionrepository.php' => 1, | |
| 'langrepository.php' => 1, | |
| 'contentrepository.php' => 1, | |
| 'routetranslation.php' => 1, | |
| 'grossumfeedbackbundle.php' => 1, | |
| 'optioncategory.php' => 1, | |
| 'contenttranslation.php' => 1, | |
| 'blocktype.php' => 1, | |
| 'blocktranslation.php' => 1, | |
| 'basetree.php' => 1, | |
| 'laravel_helpers.php' => 1, | |
| 'optionsservice.php' => 1, | |
| 'cmsseeder.php' => 1, | |
| 'blockhandler.php' => 1, | |
| 'blockfinder.php' => 1, | |
| 'abstractserviceprovider.php' => 1, | |
| 'baseuservalidator.php' => 1, | |
| 'grossumnewsbundle.php' => 1, | |
| 'mqtranslate_widget.php' => 1, | |
| 'mqtranslate_utils.php' => 1, | |
| 'curlbackoffstrategy.php' => 1, | |
| 'inline_entity.module' => 1, | |
| 'levels.php' => 1, | |
| 'infos.php' => 1, | |
| 'block_xp.php' => 1, | |
| 'csv2md' => 1, | |
| 'loguser.php' => 1, | |
| 'grafizzi.dox' => 1, | |
| 'web_install.sh' => 1, | |
| 'code-mockup-dataprovider.php' => 1, | |
| 'build-release.ps1' => 1, | |
| 'fact-finder-php-library.sublime-project' => 1, | |
| 'eyjarestdemobundle.php' => 1, | |
| 'eyjarestbundle.php' => 1, | |
| 'inline_entity.info.yml' => 1, | |
| 'archinspec.yml.dist' => 1, | |
| 'wsdl_generator.info.yml' => 1, | |
| 'sql_users.php' => 1, | |
| 'secure.php' => 1, | |
| 'php-components.php' => 1, | |
| 'rfc-version-2-0' => 1, | |
| 'exeumiscbundle.php' => 1, | |
| 'exeuapaiiobundle.php' => 1, | |
| 'exeuamazonecsbundle.php' => 1, | |
| 'savewithaudittrailbehavior.php' => 1, | |
| 'searchresult.php' => 1, | |
| 'quickaddress.php' => 1, | |
| 'qaqueryheader.php' => 1, | |
| 'visuals.php' => 1, | |
| '.editorconf' => 1, | |
| 'qaauthentication.php' => 1, | |
| 'lcnimageuploaderbundle.php' => 1, | |
| 'fastspring.php' => 1, | |
| 'some-file' => 1, | |
| 'fastfeedbundle.php' => 1, | |
| 'key.pem' => 1, | |
| 'sparkleshare' => 1, | |
| 'objectevent.php' => 1, | |
| 'injectdispatcher.php' => 1, | |
| '.sparkleshare' => 1, | |
| '.scrutnizer.yml' => 1, | |
| 'apache_license' => 1, | |
| 'lcnweatherforecastbundle.php' => 1, | |
| 'lcntemplateblockbundle.php' => 1, | |
| 'submitresponse.php' => 1, | |
| 'laskgen' => 1, | |
| 'matchresponse.php' => 1, | |
| 'matchquery.php' => 1, | |
| 'flagresponse.php' => 1, | |
| 'factualsubmittor.php' => 1, | |
| 'factualrectangle.php' => 1, | |
| 'factualpost.php' => 1, | |
| 'factualpoint.php' => 1, | |
| 'factualflagger.php' => 1, | |
| 'factualclearor.php' => 1, | |
| 'factualboost.php' => 1, | |
| 'diffsresponse.php' => 1, | |
| 'diffsquery.php' => 1, | |
| 'bareresponse.php' => 1, | |
| 'qagetdata.php' => 1, | |
| 'promptset.php' => 1, | |
| 'filedb.inc' => 1, | |
| 'eriktrapmanreleasecommandbundle.php' => 1, | |
| 'userguide' => 1, | |
| 'exception' => 1, | |
| 'gliald' => 1, | |
| 'complex' => 1, | |
| '003-glial.conf' => 1, | |
| 'sf_logo.png' => 1, | |
| 'uitinytblwidget.php' => 1, | |
| 'jfixedheadertablewidget.php' => 1, | |
| 'tray-php.sublime-project' => 1, | |
| 'escape' => 1, | |
| 'ldap_auth.php' => 1, | |
| 'eriktrapmanwebcommandbundle.php' => 1, | |
| 'cycleargamebundle.php' => 1, | |
| 'bootstrapper.example.php' => 1, | |
| 'eriktrapmancqrankingparserbundle.php' => 1, | |
| 'ttl.php' => 1, | |
| 'rename.php' => 1, | |
| 'module_testcase.php' => 1, | |
| 'helpermodule.php' => 1, | |
| 'model.yml' => 1, | |
| 'license.skeleton' => 1, | |
| 'get_version.php' => 1, | |
| 'get_filetags.php' => 1, | |
| 'get_composer.php' => 1, | |
| 'dependency.php' => 1, | |
| 'precommit.php' => 1, | |
| 'createsymlinks.php' => 1, | |
| 'assegai' => 1, | |
| 'conf.example.php' => 1, | |
| 'picklist.php' => 1, | |
| 'evercodetwigextensionsbundle.php' => 1, | |
| 'formattedaddress.php' => 1, | |
| 'bulksearchresult.php' => 1, | |
| 'bulksearchitem.php' => 1, | |
| 'exercisehtmlpurifierbundle.php' => 1, | |
| 'exsterminalbundle.php' => 1, | |
| 'exserrorbundle.php' => 1, | |
| 'ex3vformerrorsbundle.php' => 1, | |
| 'diagnostics' => 1, | |
| 'slickasset.php' => 1, | |
| 'emsettingsbundle.php' => 1, | |
| 'emoauthbundle.php' => 1, | |
| 'evercodefaqbundle.php' => 1, | |
| 'evercodepagebundle.php' => 1, | |
| 'objectomatic.php' => 1, | |
| 'evercodehipchatmonologbundle.php' => 1, | |
| 'evercodeblogbundle.php' => 1, | |
| 'evercodebannerbundle.php' => 1, | |
| 'ekironmqbundle.php' => 1, | |
| 'classcountcollector.php' => 1, | |
| 'uml-generator-php.yml.dist' => 1, | |
| '.uml-generator-php.yml' => 1, | |
| 'upgrade_auto.sh' => 1, | |
| 'php_upgrade_to_5.5.sh' => 1, | |
| 'create_certificat_nginx.sh' => 1, | |
| 'base.sh' => 1, | |
| 'evelabsphealngbundle.php' => 1, | |
| 'edblogbundle.php' => 1, | |
| 'filedb' => 1, | |
| 'faultmem.php' => 1, | |
| 'mqtranslate_services.php' => 1, | |
| 'hgtanhellodoctrinemongodbbundle.php' => 1, | |
| '.blackfire.travis.ini.enc' => 1, | |
| 'benchmark.sh' => 1, | |
| 'cookbook-fixers' => 1, | |
| 'hgtanhellosalesforcebundle.php' => 1, | |
| 'hgtanhellorabbitmqbundle.php' => 1, | |
| 'hgtanhellojirarestapibundle.php' => 1, | |
| 'hgtanhellograylogbundle.php' => 1, | |
| 'fobhellouserbundle.php' => 1, | |
| 'fobhellorestbundle.php' => 1, | |
| 'fobhellooauthserverbundle.php' => 1, | |
| 'fobhellocommentbundle.php' => 1, | |
| 'fobhelloelasticabundle.php' => 1, | |
| 'foacronbundle.php' => 1, | |
| 'fosadvancedencoderbundle.php' => 1, | |
| 'acf-sync.php' => 1, | |
| 'scmsasset.php' => 1, | |
| 'sblogasset.php' => 1, | |
| 'categoriesasset.php' => 1, | |
| 'commonasset.php' => 1, | |
| 'oistwebauthbundle.php' => 1, | |
| 'fortibbcodebundle.php' => 1, | |
| 'square.php' => 1, | |
| 'formalibreworkspacesubscriptionbundle.php' => 1, | |
| 'formalibresupportbundle.php' => 1, | |
| 'formalibrereservationbundle.php' => 1, | |
| 'formalibrereadspeakerbundle.php' => 1, | |
| 'formalibrepresencebundle.php' => 1, | |
| 'sismo' => 1, | |
| 'foshttpcachebundle.php' => 1, | |
| 'formalibrepiabundle.php' => 1, | |
| 'dynamicloaderbar.php' => 1, | |
| 'mqtranslate_javascript.php' => 1, | |
| 'mqtranslate_hooks.php' => 1, | |
| 'mqtranslate_core.php' => 1, | |
| 'mqtranslate_configuration.php' => 1, | |
| 'mqtranslate.php' => 1, | |
| 'class-gf-bitrix24.php' => 1, | |
| 'bitrix24.php' => 1, | |
| 'validfluent.php' => 1, | |
| 'frojd-segments.php' => 1, | |
| 'frojd-image-menu.php' => 1, | |
| 'loader.latte' => 1, | |
| 'dynamicloaderexception.php' => 1, | |
| 'messengerplatform.php' => 1, | |
| 'locallang_csh_ttaddress.xml' => 1, | |
| 'victoirewidgetsocialpagebundle.php' => 1, | |
| 'victoirewidgetsearchbundle.php' => 1, | |
| 'victoirewidgetprogressbundle.php' => 1, | |
| 'victoirewidgetmailchimpnewsletterbundle.php' => 1, | |
| 'victoirewidgetloginbundle.php' => 1, | |
| 'victoirewidgetlocaleswitcherbundle.php' => 1, | |
| 'victoirewidgetdatebundle.php' => 1, | |
| 'victoirewidgetcookielawbundle.php' => 1, | |
| 'victoirewidgetconnectbundle.php' => 1, | |
| 'victoirewidgetcardbundle.php' => 1, | |
| 'victoirewidgetaggregateratingbundle.php' => 1, | |
| 'victoirewidgetpicturecomparatorbundle.php' => 1, | |
| 'locallang_tca.xml' => 1, | |
| 'formalibreplatformadministrationbundle.php' => 1, | |
| 'formalibreofficeconnectbundle.php' => 1, | |
| 'faultmemasync.php' => 1, | |
| 'mpjaxblock.php' => 1, | |
| 'radiusstrategy.php' => 1, | |
| 'radiusclient.php' => 1, | |
| 'ldapstrategy.php' => 1, | |
| 'flagship-library.php' => 1, | |
| 'flagbitmetricsbundle.php' => 1, | |
| 'flagbitcurrencybundle.php' => 1, | |
| 'creating_commands' => 1, | |
| 'runnercomponent.php' => 1, | |
| 'inlinerunner.php' => 1, | |
| 'baserunner.php' => 1, | |
| 'readmoreasset.php' => 1, | |
| 'readmore.php' => 1, | |
| 'footableasset.php' => 1, | |
| 'newplugin.php' => 1, | |
| 'flagsasset.php' => 1, | |
| 'calendarasset.php' => 1, | |
| 'devbridge-autocomplete.jquery.json' => 1, | |
| 'fz_log.php' => 1, | |
| 'fz_limonade.php' => 1, | |
| 'fz_helper_view.php' => 1, | |
| 'fz_config.php' => 1, | |
| 'multilanguage.php' => 1, | |
| 'fievelajaxtablebundle.php' => 1, | |
| 'zabbixcomponent.php' => 1, | |
| 'providers.json' => 1, | |
| 'feftaddressbundle.php' => 1, | |
| 'featurebrowser.yml.dist' => 1, | |
| 'flexmodelbundle.php' => 1, | |
| 'broken-links.php' => 1, | |
| 'formalibrejobbundle.php' => 1, | |
| 'product.tpl' => 1, | |
| 'formalibrebulletinbundle.php' => 1, | |
| 'forcec' => 1, | |
| 'plugin_packages' => 1, | |
| 'hooks_events_results' => 1, | |
| 'wordpresscomposertoolsplugin.php' => 1, | |
| 'flyingstructbundle.php' => 1, | |
| 'bujsonresponsebundle.php' => 1, | |
| 'buextraparamconverterbundle.php' => 1, | |
| 'vacancy.tpl' => 1, | |
| 'text.tpl' => 1, | |
| 'slider.tpl' => 1, | |
| 'project.tpl' => 1, | |
| 'person.tpl' => 1, | |
| 'plugin-cms.php' => 1, | |
| 'person-tiles.tpl' => 1, | |
| 'news.tpl' => 1, | |
| 'menu.tpl' => 1, | |
| 'featured_list.tpl' => 1, | |
| 'breadcrumbs.tpl' => 1, | |
| 'banner.tpl' => 1, | |
| 'fieldentityinterface.php' => 1, | |
| '.styleci.yaml' => 1, | |
| '.codeclimat.yaml' => 1, | |
| 'flubbigbangbundle.php' => 1, | |
| 'fsbproxybundle.php' => 1, | |
| 'requirementchecker.php' => 1, | |
| 'popular-posts.php' => 1, | |
| 'constantbackoffstrategy.php' => 1, | |
| 'exponentialbackoffstrategy.php' => 1, | |
| 'barcodefactory.php' => 1, | |
| 'imaticimportbundle.php' => 1, | |
| 'mysql-transfer.sh' => 1, | |
| 'mysql-restore.sh' => 1, | |
| 'mysql-remote-restore.sh' => 1, | |
| 'mysql-remote-backup.sh' => 1, | |
| 'mysql-csv-to-sql.php' => 1, | |
| 'mysql-backup.sh' => 1, | |
| 'api_calls.php' => 1, | |
| 'api_callback.php' => 1, | |
| 'testpdf.pdf' => 1, | |
| 'travis.config.ini' => 1, | |
| 'passport.php' => 1, | |
| 'importoption.php' => 1, | |
| 'anchovycurlbundle.php' => 1, | |
| 'icms_version.php' => 1, | |
| 'fr_fr.theme.frontend_magento_luma.csv' => 1, | |
| 'fr_fr.theme.frontend_magento_blank.csv' => 1, | |
| 'fr_fr.module.magento_wishlist.csv' => 1, | |
| 'fr_fr.module.magento_widget.csv' => 1, | |
| 'fr_fr.module.magento_weee.csv' => 1, | |
| 'fr_fr.module.magento_webapisecurity.csv' => 1, | |
| 'fr_fr.module.magento_webapi.csv' => 1, | |
| 'fr_fr.module.magento_variable.csv' => 1, | |
| 'fr_fr.module.magento_usps.csv' => 1, | |
| 'fr_fr.module.magento_user.csv' => 1, | |
| 'fr_fr.module.magento_urlrewrite.csv' => 1, | |
| 'fr_fr.module.magento_ups.csv' => 1, | |
| 'mysql-tunnel.sh' => 1, | |
| 'module.css' => 1, | |
| 'fr_fr.module.magento_translation.csv' => 1, | |
| 'ircategorybundle.php' => 1, | |
| 'irzonebundle.php' => 1, | |
| 'irproductevents.php' => 1, | |
| 'irproductbundle.php' => 1, | |
| 'irorderevents.php' => 1, | |
| 'irorderbundle.php' => 1, | |
| 'irnewsevents.php' => 1, | |
| 'irnewsbundle.php' => 1, | |
| 'ircustomerevents.php' => 1, | |
| 'ircustomerbundle.php' => 1, | |
| 'ircontactevents.php' => 1, | |
| 'ircontactbundle.php' => 1, | |
| 'ircategoryevents.php' => 1, | |
| 'ircartevents.php' => 1, | |
| 'module_rtl.css' => 1, | |
| 'ircartbundle.php' => 1, | |
| 'iraddressbundle.php' => 1, | |
| 'infinitedevelopersweatherwidgetbundle.php' => 1, | |
| 'infinitedevelopersbase64bundle.php' => 1, | |
| 'infernosquadcalculationbundle.php' => 1, | |
| 'migrationawaremodule.php' => 1, | |
| 'migrationawareinterface.php' => 1, | |
| 'bakery' => 1, | |
| 'gopher' => 1, | |
| 'logsafecheddargetterbundle.php' => 1, | |
| 'incenteevtranslationcheckerbundle.php' => 1, | |
| 'inpostvalidationbundle.php' => 1, | |
| 'dashboard.png' => 1, | |
| 'fr_fr.module.magento_ui.csv' => 1, | |
| 'fr_fr.module.magento_theme.csv' => 1, | |
| 'ingewikkeldwrapperbundle.php' => 1, | |
| 'fr_fr.module.magento_downloadable.csv' => 1, | |
| 'fr_fr.module.magento_indexer.csv' => 1, | |
| 'fr_fr.module.magento_importexport.csv' => 1, | |
| 'fr_fr.module.magento_groupedproduct.csv' => 1, | |
| 'fr_fr.module.magento_googleoptimizer.csv' => 1, | |
| 'fr_fr.module.magento_googleanalytics.csv' => 1, | |
| 'fr_fr.module.magento_googleadwords.csv' => 1, | |
| 'fr_fr.module.magento_giftmessage.csv' => 1, | |
| 'fr_fr.module.magento_fedex.csv' => 1, | |
| 'fr_fr.module.magento_encryptionkey.csv' => 1, | |
| 'fr_fr.module.magento_email.csv' => 1, | |
| 'fr_fr.module.magento_eav.csv' => 1, | |
| 'fr_fr.module.magento_downloadableimportexport.csv' => 1, | |
| 'fr_fr.module.magento_directory.csv' => 1, | |
| 'fr_fr.module.magento_layerednavigation.csv' => 1, | |
| 'fr_fr.module.magento_dhl.csv' => 1, | |
| 'fr_fr.module.magento_developer.csv' => 1, | |
| 'fr_fr.module.magento_deploy.csv' => 1, | |
| 'fr_fr.module.magento_customerimportexport.csv' => 1, | |
| 'fr_fr.module.magento_customer.csv' => 1, | |
| 'fr_fr.module.magento_currencysymbol.csv' => 1, | |
| 'fr_fr.module.magento_cron.csv' => 1, | |
| 'fr_fr.module.magento_cookie.csv' => 1, | |
| 'fr_fr.module.magento_contact.csv' => 1, | |
| 'fr_fr.module.magento_configurableproduct.csv' => 1, | |
| 'fr_fr.module.magento_config.csv' => 1, | |
| 'fr_fr.module.magento_cms.csv' => 1, | |
| 'fr_fr.module.magento_checkoutagreements.csv' => 1, | |
| 'fr_fr.module.magento_integration.csv' => 1, | |
| 'fr_fr.module.magento_marketplace.csv' => 1, | |
| 'fr_fr.module.magento_taximportexport.csv' => 1, | |
| 'fr_fr.module.magento_review.csv' => 1, | |
| 'fr_fr.module.magento_tax.csv' => 1, | |
| 'fr_fr.module.magento_swatches.csv' => 1, | |
| 'fr_fr.module.magento_store.csv' => 1, | |
| 'fr_fr.module.magento_sitemap.csv' => 1, | |
| 'fr_fr.module.magento_shipping.csv' => 1, | |
| 'fr_fr.module.magento_sendfriend.csv' => 1, | |
| 'fr_fr.module.magento_search.csv' => 1, | |
| 'fr_fr.module.magento_salessequence.csv' => 1, | |
| 'fr_fr.module.magento_salesrule.csv' => 1, | |
| 'fr_fr.module.magento_sales.csv' => 1, | |
| 'fr_fr.module.magento_rule.csv' => 1, | |
| 'fr_fr.module.magento_rss.csv' => 1, | |
| 'fr_fr.module.magento_reports.csv' => 1, | |
| 'fr_fr.module.magento_mediastorage.csv' => 1, | |
| 'fr_fr.module.magento_quote.csv' => 1, | |
| 'fr_fr.module.magento_productvideo.csv' => 1, | |
| 'fr_fr.module.magento_productalert.csv' => 1, | |
| 'fr_fr.module.magento_persistent.csv' => 1, | |
| 'fr_fr.module.magento_paypal.csv' => 1, | |
| 'fr_fr.module.magento_payment.csv' => 1, | |
| 'fr_fr.module.magento_pagecache.csv' => 1, | |
| 'fr_fr.module.magento_offlineshipping.csv' => 1, | |
| 'fr_fr.module.magento_offlinepayments.csv' => 1, | |
| 'fr_fr.module.magento_newsletter.csv' => 1, | |
| 'fr_fr.module.magento_newrelicreporting.csv' => 1, | |
| 'fr_fr.module.magento_multishipping.csv' => 1, | |
| 'fr_fr.module.magento_msrp.csv' => 1, | |
| 'irzoneevents.php' => 1, | |
| 'build.clip.php' => 1, | |
| 'fr_fr.module.magento_catalogwidget.csv' => 1, | |
| 'jcookieasset.php' => 1, | |
| 'ibtablemanagerbundle.php' => 1, | |
| 'rbacmodule.php' => 1, | |
| 'redisman.php' => 1, | |
| 'messages_conf_redisman' => 1, | |
| 'messages_conf_app' => 1, | |
| 'jgallerywidget.php' => 1, | |
| 'jgalleryasset.php' => 1, | |
| 'iconpicker.php' => 1, | |
| 'timelineitem.php' => 1, | |
| 'timeline' => 1, | |
| 'tile.php' => 1, | |
| 'smallbox.php' => 1, | |
| 'flashalerts.php' => 1, | |
| 'socialstatsbundle.php' => 1, | |
| 'extadminlteasset.php' => 1, | |
| 'exampletimelineitem.php' => 1, | |
| 'insightly.php' => 1, | |
| 'inoritwitterappbundle.php' => 1, | |
| 'innovataxonomybundle.php' => 1, | |
| 'innovasupportbundle.php' => 1, | |
| 'innovapathbundle.php' => 1, | |
| 'innovanondigitalresourcebundle.php' => 1, | |
| 'innovametronomebundle.php' => 1, | |
| 'innovamediaresourcebundle.php' => 1, | |
| 'innovalearningpathbundle.php' => 1, | |
| 'innovagitterbundle.php' => 1, | |
| 'innovaforummultimodalbundle.php' => 1, | |
| 'smartcodebundle.php' => 1, | |
| 'itcollectorbundle.php' => 1, | |
| 'innovafakerbundle.php' => 1, | |
| 'phpunit-wordpress-browser.xml.dist' => 1, | |
| 'docodile' => 1, | |
| 'arc2jsonldconverter.php' => 1, | |
| 'redistarget.php' => 1, | |
| 'tvmazeincludes.php' => 1, | |
| 'fatcowiconsbundle.php' => 1, | |
| 'testastring.php' => 1, | |
| 'jorgehernanodmrelationshipviewbundle.php' => 1, | |
| 'wp-l10n-validator.php' => 1, | |
| 'ignores-cache-generator.php' => 1, | |
| 'wp-http-testcase.php' => 1, | |
| 'pimple.json' => 1, | |
| 'phpunit-wordpress.xml.dist' => 1, | |
| 'phpunit-joomla.xml.dist' => 1, | |
| 'involvaitadminltebundle.php' => 1, | |
| 'phpunit-joomla-browser.xml.dist' => 1, | |
| 'jaiuserbundle.php' => 1, | |
| 'jaicontactbundle.php' => 1, | |
| 'configstore.php' => 1, | |
| 'easylang.php' => 1, | |
| 'jmosecommandschedulerbundle.php' => 1, | |
| 'parsleybundle.php' => 1, | |
| 'work' => 1, | |
| 'iteoformfilterbundle.php' => 1, | |
| 'irvyneembedlybundle.php' => 1, | |
| 'involvaitjqueryuibundle.php' => 1, | |
| 'involvaitfoundationbundle.php' => 1, | |
| 'involvaitfontawesomebundle.php' => 1, | |
| 'innovafavoritebundle.php' => 1, | |
| 'description-pak' => 1, | |
| 'crawlerinterface.php' => 1, | |
| 'innmindneo4jbundle.php' => 1, | |
| 'nullquery.php' => 1, | |
| 'nullpath.php' => 1, | |
| 'nullfragment.php' => 1, | |
| 'fragmentinterface.php' => 1, | |
| 'authorityinterface.php' => 1, | |
| 'authority.php' => 1, | |
| 'notinterface.php' => 1, | |
| 'compositeinterface.php' => 1, | |
| 'routeloader.php' => 1, | |
| 'innmindrestbundle.php' => 1, | |
| 'reflectionobject.php' => 1, | |
| 'instanciatorinterface.php' => 1, | |
| 'typedcollectioninterface.php' => 1, | |
| 'pathinterface.php' => 1, | |
| 'typedcollection.php' => 1, | |
| 'symbol.php' => 1, | |
| 'stringableinterface.php' => 1, | |
| 'stringprimitive.php' => 1, | |
| 'sizeableinterface.php' => 1, | |
| 'setinterface.php' => 1, | |
| 'sequenceinterface.php' => 1, | |
| 'primitiveinterface.php' => 1, | |
| 'pair.php' => 1, | |
| 'nameinterface.php' => 1, | |
| 'mediatypeinterface.php' => 1, | |
| 'lazyadapterinterface.php' => 1, | |
| 'domcrawlerfactory.php' => 1, | |
| 'nullscheme.php' => 1, | |
| 'clauseinterface.php' => 1, | |
| 'innovacollecticielbundle.php' => 1, | |
| 'formats.php' => 1, | |
| 'innovaaudiorecorderbundle.php' => 1, | |
| 'innovaangularuitreebundle.php' => 1, | |
| 'innovaangularuitranslationbundle.php' => 1, | |
| 'innovaangularuitinymcebundle.php' => 1, | |
| 'innovaangularuisortablebundle.php' => 1, | |
| 'innovaangularuiresourcepickerbundle.php' => 1, | |
| 'innovaangularuipageslidebundle.php' => 1, | |
| 'innovaangularjsbundle.php' => 1, | |
| 'innovaactivitybundle.php' => 1, | |
| 'urlresolver.php' => 1, | |
| 'storages.php' => 1, | |
| 'resourcebuilder.php' => 1, | |
| 'entitybuilder.php' => 1, | |
| 'cypher.php' => 1, | |
| 'definitioncompiler.php' => 1, | |
| 'compilerpassinterface.php' => 1, | |
| 'repositoryfactory.php' => 1, | |
| 'persisterinterface.php' => 1, | |
| 'metadatas.php' => 1, | |
| 'metadatafactoryinterface.php' => 1, | |
| 'metadatabuilder.php' => 1, | |
| 'managerfactory.php' => 1, | |
| 'identitymatch.php' => 1, | |
| 'identityinterface.php' => 1, | |
| 'entityfactoryinterface.php' => 1, | |
| 'transactions.php' => 1, | |
| 'resultinterface.php' => 1, | |
| 'fr_fr.module.magento_checkout.csv' => 1, | |
| 'fr_fr.module.magento_catalogurlrewrite.csv' => 1, | |
| 'httpbackoffstrategy.php' => 1, | |
| 'happyrnormaldistributionbundle.php' => 1, | |
| 'ajaxcreatetable.php' => 1, | |
| 'template.html.twig' => 1, | |
| 'listitems.js' => 1, | |
| 'headoomediasocialapibundle.php' => 1, | |
| 'headoomailjetbundle.php' => 1, | |
| 'headooecommercebundle.php' => 1, | |
| 'haverkamp87userbundle.php' => 1, | |
| 'haverkamp87corebundle.php' => 1, | |
| 'authentication_2016-04-19.sql' => 1, | |
| 'happyruserprojectbundle.php' => 1, | |
| 'happyrstompbundle.php' => 1, | |
| 'happyrslugifybundle.php' => 1, | |
| 'happyrmq2phpbundle.php' => 1, | |
| 'ajaximportfile.php' => 1, | |
| 'happyrlocationbundle.php' => 1, | |
| 'happyrlinkedinbundle.php' => 1, | |
| 'identifierinterface.php' => 1, | |
| 'happyrmailerbundle.php' => 1, | |
| 'happyrgooglesiteauthenticatorbundle.php' => 1, | |
| 'happyrgooglegeocoderbundle.php' => 1, | |
| 'happyrgoogleapibundle.php' => 1, | |
| 'happyrgoogleanalyticsbundle.php' => 1, | |
| 'happyrexcerptbundle.php' => 1, | |
| 'happyreventtrackerbundle.php' => 1, | |
| 'happyrcloudflarebundle.php' => 1, | |
| 'happyrbirthdaybundle.php' => 1, | |
| 'ajaxfulltext.php' => 1, | |
| 'ajaxquery.php' => 1, | |
| 'travisconfigs.tar.enc' => 1, | |
| 'fakeprocessbuilder.php' => 1, | |
| 'prepper-stop.sh' => 1, | |
| 'prepper-stop.php' => 1, | |
| 'prepper-stop.bat' => 1, | |
| 'prepper-start.sh' => 1, | |
| 'prepper-start.php' => 1, | |
| 'prepper-start.bat' => 1, | |
| 'testresult' => 1, | |
| '.gitignor' => 1, | |
| 'tokenize' => 1, | |
| 'hipi18nroutingbundle.php' => 1, | |
| 'htcnowtaxibundle.php' => 1, | |
| '.twgit' => 1, | |
| 'fakeprocess.php' => 1, | |
| 'ajaxsavecolumnedit.php' => 1, | |
| 'hexmediauserbundle.php' => 1, | |
| 'hexmediatimeformatterbundle.php' => 1, | |
| 'hexmediaknockoutbundle.php' => 1, | |
| 'hexmediaknockoutbootstrapbundle.php' => 1, | |
| 'hexmediacontentbundle.php' => 1, | |
| 'hexmediaasseticbundle.php' => 1, | |
| 'hexmediaadministratorbundle.php' => 1, | |
| 'arduinoclient.php' => 1, | |
| 'echofor.php' => 1, | |
| 'editcolumn.php' => 1, | |
| 'dboverview.php' => 1, | |
| 'ajaxsaveuseredit.php' => 1, | |
| 'ajaxsaveedit.php' => 1, | |
| 'hanfreysparkpostbundle.php' => 1, | |
| 'hdconfig.php' => 1, | |
| 'admin_index.php' => 1, | |
| 'cookieplugin.php' => 1, | |
| 'phpstreamrequestfactory.php' => 1, | |
| 'configloaderinterface.php' => 1, | |
| 'cachingconfigloader.php' => 1, | |
| 'abstractconfigloader.php' => 1, | |
| 'oauthplugin.php' => 1, | |
| 'md5validatorplugin.php' => 1, | |
| 'commandcontentmd5plugin.php' => 1, | |
| 'logplugin.php' => 1, | |
| 'historyplugin.php' => 1, | |
| 'errorresponseplugin.php' => 1, | |
| 'errorresponseexceptioninterface.php' => 1, | |
| 'curlauthplugin.php' => 1, | |
| 'skiprevalidation.php' => 1, | |
| 'multisite' => 1, | |
| 'revalidationinterface.php' => 1, | |
| 'denyrevalidation.php' => 1, | |
| 'defaultrevalidation.php' => 1, | |
| 'defaultcancachestrategy.php' => 1, | |
| 'defaultcachestorage.php' => 1, | |
| 'defaultcachekeyprovider.php' => 1, | |
| 'cancachestrategyinterface.php' => 1, | |
| 'callbackcancachestrategy.php' => 1, | |
| 'cachestorageinterface.php' => 1, | |
| 'cachekeyproviderinterface.php' => 1, | |
| 'truncatedbackoffstrategy.php' => 1, | |
| 'reasonphrasebackoffstrategy.php' => 1, | |
| 'linearbackoffstrategy.php' => 1, | |
| 'streamrequestfactoryinterface.php' => 1, | |
| 'class-h1-auto-image-download-admin.php' => 1, | |
| 'hd4helper.js' => 1, | |
| 'aplikasidakwah.sql' => 1, | |
| 'hdstore.php' => 1, | |
| 'hdextra.php' => 1, | |
| 'hddevice.php' => 1, | |
| 'hdcache.php' => 1, | |
| 'hdbase.php' => 1, | |
| 'hd4.php' => 1, | |
| 'halbehatwizardbundle.php' => 1, | |
| 'halbehattoolsbundle.php' => 1, | |
| 'hobtokenbundle.php' => 1, | |
| 'commonbundle.php' => 1, | |
| 'hobapibundle.php' => 1, | |
| 'run.py' => 1, | |
| 'espendzenddbbundle.php' => 1, | |
| 'class-h1-auto-image-download.php' => 1, | |
| 'hadesarchitectnotificationbundle.php' => 1, | |
| 'jsonschemabundle.php' => 1, | |
| 'ssql.php' => 1, | |
| 'basiq.php' => 1, | |
| 'infogen.php' => 1, | |
| 'app.css' => 1, | |
| 'listtable.twig' => 1, | |
| 'dbtools.php' => 1, | |
| 'dockerfile.phpspec' => 1, | |
| 'dockerfile.composer' => 1, | |
| 'supervisorasset.php' => 1, | |
| 'h1-auto-image-download.php' => 1, | |
| 'h1-auto-image-download.js' => 1, | |
| 'hotaru.php' => 1, | |
| 'htaccess_default' => 1, | |
| 'fr_fr.module.magento_catalogsearch.csv' => 1, | |
| 'phantom.js' => 1, | |
| 'cartpositionbehaviour.php' => 1, | |
| 'cartposition.php' => 1, | |
| 'sharebar.php' => 1, | |
| 'ipinfodb.php' => 1, | |
| 'currencyconverterinterface.php' => 1, | |
| 'currencyconverter.php' => 1, | |
| 'countrytocurrency.php' => 1, | |
| 'jabberjaxlbundle.php' => 1, | |
| 'ikimeapagebundle.php' => 1, | |
| 'ikimeackeditorbundle.php' => 1, | |
| 'imtdatagridbundle.php' => 1, | |
| 'planet' => 1, | |
| 'ifgmaclinterfacebundle.php' => 1, | |
| 'fr_fr.component.magento2_base.csv' => 1, | |
| 'id4vmenubundle.php' => 1, | |
| 'stikairinitbundle.php' => 1, | |
| 'icode4foodjqueryuibundle.php' => 1, | |
| 'packagemanager.png' => 1, | |
| 'itlizedzurbfoundationbundle.php' => 1, | |
| 'itlizedsocialbundle.php' => 1, | |
| 'pagerduty.php' => 1, | |
| 'requestreader.php' => 1, | |
| 'rsmartload.php' => 1, | |
| 'rsmartloadhelper.php' => 1, | |
| 'rsmartloadclientscript.php' => 1, | |
| 'seleniumtestcasedoc.php' => 1, | |
| 'iq2iprestashopwebservicebundle.php' => 1, | |
| 'sharebutton.php' => 1, | |
| 'fr_fr.custom.imaginaerum.csv' => 1, | |
| 'extdirectaction.php' => 1, | |
| 'fr_fr.module.magento_adminnotification.csv' => 1, | |
| 'fr_fr.module.magento_catalogrule.csv' => 1, | |
| 'fr_fr.module.magento_cataloginventory.csv' => 1, | |
| 'fr_fr.module.magento_catalogimportexport.csv' => 1, | |
| 'fr_fr.module.magento_catalog.csv' => 1, | |
| 'fr_fr.module.magento_captcha.csv' => 1, | |
| 'fr_fr.module.magento_bundle.csv' => 1, | |
| 'fr_fr.module.magento_braintree.csv' => 1, | |
| 'fr_fr.module.magento_backup.csv' => 1, | |
| 'fr_fr.module.magento_backend.csv' => 1, | |
| 'fr_fr.module.magento_authorizenet.csv' => 1, | |
| 'fr_fr.module.magento_authorization.csv' => 1, | |
| 'fr_fr.module.magento_advancedpricingimportexport.csv' => 1, | |
| 'fr_fr.lib.lib_web_mage_validation_validation_js.csv' => 1, | |
| 'fr_fr.deprecated.imaginaerum.after.2.0.0.csv' => 1, | |
| 'fr_fr.lib.lib_web_mage_validation_js.csv' => 1, | |
| 'fr_fr.lib.lib_web_mage_translate_inline_vde_js.csv' => 1, | |
| 'fr_fr.lib.lib_web_mage_translate_inline_js.csv' => 1, | |
| 'fr_fr.lib.lib_web_mage_menu_js.csv' => 1, | |
| 'fr_fr.lib.lib_web_mage_loader_old_js.csv' => 1, | |
| 'fr_fr.lib.lib_web_mage_loader_js.csv' => 1, | |
| 'fr_fr.lib.lib_web_mage_dropdown_js.csv' => 1, | |
| 'fr_fr.lib.lib_web_mage_decorate_js.csv' => 1, | |
| 'fr_fr.lib.lib_web_mage_backend_suggest_js.csv' => 1, | |
| 'fr_fr.lib.lib_web_mage_adminhtml_wysiwyg_widget_js.csv' => 1, | |
| 'fr_fr.lib.lib_web_mage_adminhtml_backup_js.csv' => 1, | |
| 'fr_fr.deprecated.imaginaerum.after.2.0.3.csv' => 1, | |
| 'fr_fr.deprecated.imaginaerum.after.2.0.2.csv' => 1, | |
| 'extdirectmanager.php' => 1, | |
| 'process_settings.php' => 1, | |
| 'hotflofeaturetogglebundle.php' => 1, | |
| 'usecase' => 1, | |
| 'idcicontactformbundle.php' => 1, | |
| 'idcicolorschemebundle.php' => 1, | |
| 'idcicodegeneratorbundle.php' => 1, | |
| 'codegeneratormanager.php' => 1, | |
| 'awssesbundle.php' => 1, | |
| 'idciadmingeneratorbundle.php' => 1, | |
| 'patches.php' => 1, | |
| 'logging.services.yml' => 1, | |
| 'logging.module' => 1, | |
| 'logging.info' => 1, | |
| 'icansloggingbundle.php' => 1, | |
| 'hypolayoutbundle.php' => 1, | |
| 'frameworks' => 1, | |
| 'idciextraformbundle.php' => 1, | |
| 'debugging' => 1, | |
| 'mwbsexporterbundle.php' => 1, | |
| 'lazyguy' => 1, | |
| 'fuzzypeanut.php' => 1, | |
| 'ip2location.class.php' => 1, | |
| 'ip2location_products_catalog.pdf' => 1, | |
| 'htimelightcmsbundle.php' => 1, | |
| 'hsererouter.php' => 1, | |
| 'hoanotificationevents.php' => 1, | |
| 'hoanotificationbundle.php' => 1, | |
| 'dacorpextraevents.php' => 1, | |
| 'dacorpextrabundle.php' => 1, | |
| 'hotflosupervisorbundle.php' => 1, | |
| 'idciexporterbundle.php' => 1, | |
| 'idcifilterformbundle.php' => 1, | |
| 'logconfig.xml' => 1, | |
| 'fullcalendar.css' => 1, | |
| 'default.settings.php' => 1, | |
| 'tableexport.js' => 1, | |
| 'tableexport.jquery.json' => 1, | |
| 'jquery.base64.js' => 1, | |
| 'html2canvas.js' => 1, | |
| 'project-assembly.xml' => 1, | |
| 'lang-all.js' => 1, | |
| 'gcal.js' => 1, | |
| 'fullcalendar.print.css' => 1, | |
| 'fullcalendar.min.js' => 1, | |
| 'fullcalendar.min.css' => 1, | |
| 'fullcalendar.js' => 1, | |
| 'mailchimp-tools.php' => 1, | |
| 'idcigenealogybundle.php' => 1, | |
| 'mailchimp-functions.php' => 1, | |
| 'illdatacitedoibundle.php' => 1, | |
| 'qqq.t' => 1, | |
| '.sams' => 1, | |
| 'idciwebpagescreenshotbundle.php' => 1, | |
| 'idcistepbundle.php' => 1, | |
| 'idcisimpleschedulebundle.php' => 1, | |
| 'idcisimplemetadatabundle.php' => 1, | |
| 'idcisimplemediabundle.php' => 1, | |
| 'idcipartnerbundle.php' => 1, | |
| 'idcinotificationbundle.php' => 1, | |
| 'idcinotificationapiclientbundle.php' => 1, | |
| 'idcinavbarbundle.php' => 1, | |
| 'gitlabmodel.php' => 1, | |
| 'modulebootstrap.php' => 1, | |
| 'baffordbowerbundle.php' => 1, | |
| 'examples_database.sql' => 1, | |
| 'intellijsetup' => 1, | |
| 'affirm.json' => 1, | |
| 'groovey.jpg' => 1, | |
| 'modulequery.php' => 1, | |
| 'moduleeventsinterface.php' => 1, | |
| 'objectmodelinterface.php' => 1, | |
| 'objectmodel.php' => 1, | |
| 'modelformasset.php' => 1, | |
| 'invokeevent.php' => 1, | |
| 'formnameevent.php' => 1, | |
| 'arraymodel.php' => 1, | |
| 'license-image-crud' => 1, | |
| 'grizzlylabuibundle.php' => 1, | |
| 'slack.hooks.php' => 1, | |
| 'grizzlylabmailerbundle.php' => 1, | |
| 'grinfeld_phpjsonable.phar' => 1, | |
| 'timingfield.scss' => 1, | |
| 'timingfield.min.js' => 1, | |
| 'timingfield.js' => 1, | |
| 'timingfield.css' => 1, | |
| 'grimmlinkalipaybundle.php' => 1, | |
| 'ymcomponent.php' => 1, | |
| 'awscomponent.php' => 1, | |
| 'gaspfile' => 1, | |
| 'gremosubscriptionbundle.php' => 1, | |
| 'gremopjaxbundle.php' => 1, | |
| 'grunchmercadopagobundle.php' => 1, | |
| 'prestashop' => 1, | |
| 'gremohighchartsbundle.php' => 1, | |
| '.travis.phpunit.xml.dist' => 1, | |
| 'web-test.php' => 1, | |
| 'commanderbundle.php' => 1, | |
| 'ispconfig-cli.phar' => 1, | |
| 'ispconfig-cli.dist.yml' => 1, | |
| 'environment.example.ini' => 1, | |
| 'validaterule.php' => 1, | |
| 'dataspringdemobundle.php' => 1, | |
| 'guiyomhgoogleauthenticatorbundle.php' => 1, | |
| 'clips' => 1, | |
| '.env-sample.php' => 1, | |
| 'udfangularjsbundle.php' => 1, | |
| 'undfangulartransbundle.php' => 1, | |
| 'kebhubapi.php' => 1, | |
| 'gtriasaddorselectbundle.php' => 1, | |
| 'donatopathwellbundle.php' => 1, | |
| 'ninjamutexbundle.php' => 1, | |
| 'donatogenerichwioauthproxybundle.php' => 1, | |
| 'donatohttpservicebundle.php' => 1, | |
| 'yamlconfig.php' => 1, | |
| 'arrayconfig.php' => 1, | |
| 'donatohttpproxiedbuzzbundle.php' => 1, | |
| 'plan_test.php' => 1, | |
| 'plan.php' => 1, | |
| 'sweethome' => 1, | |
| 'task.xml' => 1, | |
| 'hint.jpg' => 1, | |
| 'gtriastimepickerbundle.php' => 1, | |
| 'gremohmacauthenticationbundle.php' => 1, | |
| 'gremocaptchaformbundle.php' => 1, | |
| 'wellknowntext.php' => 1, | |
| 'cachetoolbundle.php' => 1, | |
| 'gpatonparsebundle.php' => 1, | |
| 'gpatonlabelconverterbundle.php' => 1, | |
| 'gotakkviewmodelbundle.php' => 1, | |
| 'doc.ini' => 1, | |
| 'wsdl.xml' => 1, | |
| 'contactemail.ss' => 1, | |
| 'extensions.yml' => 1, | |
| 'gordalinamangopaybundle.php' => 1, | |
| 'ifmbevents.php' => 1, | |
| 'gordalinaifmbbundle.php' => 1, | |
| 'gordalinamixpanelbundle.php' => 1, | |
| 'gordalinaeasypaybundle.php' => 1, | |
| 'phpunit.full.xml' => 1, | |
| 'demoportalbundle.php' => 1, | |
| 'youtubereporting.php' => 1, | |
| 'youtubeanalytics.php' => 1, | |
| 'webmasters.php' => 1, | |
| 'webfonts.php' => 1, | |
| 'vision.php' => 1, | |
| 'urlshortener.php' => 1, | |
| 'toolresults.php' => 1, | |
| 'taskqueue.php' => 1, | |
| 'tagmanager.php' => 1, | |
| 'storagetransfer.php' => 1, | |
| 'spectrum.php' => 1, | |
| 'siteverification.php' => 1, | |
| 'shoppingcontent.php' => 1, | |
| 'helloworld.hello.xml' => 1, | |
| 'vagrant-up' => 1, | |
| 'gremobuzzbundle.php' => 1, | |
| 'pkg_sales.xml' => 1, | |
| 'yiimandrill.php' => 1, | |
| 'scriptcore.php' => 1, | |
| 'design.jpg' => 1, | |
| 'install_demo.sh' => 1, | |
| 'install_demo.bat' => 1, | |
| '.coverage.yml' => 1, | |
| '.drush-lock-update' => 1, | |
| '.eclipse-php-formatter.xml' => 1, | |
| 'phpari.php' => 1, | |
| 'phpari.ini' => 1, | |
| 'ixr_xmlrpc.php' => 1, | |
| 'pkg_translations.xml' => 1, | |
| 'pkg_articles.xml' => 1, | |
| 'markethubbundle.php' => 1, | |
| 'arrayvalidator.php' => 1, | |
| 'queries' => 1, | |
| 'polylang-slug.php' => 1, | |
| 'config.yml.default' => 1, | |
| 'ofreader' => 1, | |
| 'grachevenumbundle.php' => 1, | |
| 'grachevcronbundle.php' => 1, | |
| 'deploy.default.properties' => 1, | |
| 'inputreader.php' => 1, | |
| 'githelper.php' => 1, | |
| 'gitdeploy.php' => 1, | |
| 'ftphelper.php' => 1, | |
| 'sevendigitalbundle.php' => 1, | |
| 'effect.php' => 1, | |
| 'flush_privileges.php' => 1, | |
| 'resourceviews.php' => 1, | |
| 'imagemanagerexception.php' => 1, | |
| 'hackzillabarcodebundle.php' => 1, | |
| 'procergslogincidadaobadgesbundle.php' => 1, | |
| 'hacfirequestdumperbundle.php' => 1, | |
| 'phpfa' => 1, | |
| 'hacfiobjectbridgebundle.php' => 1, | |
| 'haberbergerredisstoragebundle.php' => 1, | |
| 'romenumber.php' => 1, | |
| 'nonobject.php' => 1, | |
| 'filetools.php' => 1, | |
| 'feast.php' => 1, | |
| 'arraystatic.php' => 1, | |
| 'pathnizer.php' => 1, | |
| 'period.php' => 1, | |
| 'hackzillaticketbundle.php' => 1, | |
| 'silpionloggerextrabundle.php' => 1, | |
| 'h4ccalicefixturesbundle.php' => 1, | |
| 'hnmessageformatbundle.php' => 1, | |
| 'widgets.html' => 1, | |
| 'typo.html' => 1, | |
| 'two-sidebars.html' => 1, | |
| 'tables.html' => 1, | |
| 'support.html' => 1, | |
| 'structure.html' => 1, | |
| 'simplechartsloadedviajson.zip' => 1, | |
| 'simplechart.zip' => 1, | |
| 'right-sidebar.html' => 1, | |
| 'hackzillafosuserbridgebundle.php' => 1, | |
| 'ticketevents.php' => 1, | |
| 'offline.html' => 1, | |
| 'phockito_globals.php' => 1, | |
| 'wikimate.php' => 1, | |
| 'pheditor.php' => 1, | |
| 'faraso.class.php' => 1, | |
| 'hamepub' => 1, | |
| 'roles.png' => 1, | |
| 'resources.png' => 1, | |
| 'permissions.png' => 1, | |
| 'hamaryuginhmeekrodbbundle.php' => 1, | |
| 'hamaryuginhgoogleanalyticsbundle.php' => 1, | |
| 'littlesnapper.php' => 1, | |
| '__bootstrap.php' => 1, | |
| 'awscloudsearchbundle.php' => 1, | |
| 'phockitosilverstripe.php' => 1, | |
| 'ticketrole.php' => 1, | |
| 'phockito.php' => 1, | |
| 'hamcresttypebridge_globals.php' => 1, | |
| 'hamcresttypebridge.php' => 1, | |
| 'hadonraaddressbundle.php' => 1, | |
| 'metamaterial.php' => 1, | |
| 'mm_user.php' => 1, | |
| 'mm_taxonomy.php' => 1, | |
| 'mm_metabox.php' => 1, | |
| 'mm_mediaaccess.php' => 1, | |
| 'mm_loop.php' => 1, | |
| 'mm_dashboard.php' => 1, | |
| 'hackzillapasswordgeneratorbundle.php' => 1, | |
| 'hackzillabootstrapbundle.php' => 1, | |
| 'profile.html' => 1, | |
| 'no-sidebar.html' => 1, | |
| 'recover_password.php' => 1, | |
| 'wee.php' => 1, | |
| 'pointcutinjector.php' => 1, | |
| 'pointcut.php' => 1, | |
| 'patternvalueset.php' => 1, | |
| 'patternnamespace.php' => 1, | |
| 'patternfunction.php' => 1, | |
| 'patternfilename.php' => 1, | |
| 'patternclass.php' => 1, | |
| 'pattern.php' => 1, | |
| 'aoptests.php' => 1, | |
| 'aop.php' => 1, | |
| 'weeplugininterface.php' => 1, | |
| 'weepluginabstract.php' => 1, | |
| 'gwkmailjetbundle.php' => 1, | |
| 'file_put_contents_backup.php' => 1, | |
| 'gwkdynamosessionbundle.php' => 1, | |
| 'gwinntinymcefastloadbundle.php' => 1, | |
| 'gw-config.php.dist' => 1, | |
| 'cakeblog.sql' => 1, | |
| 'mohostrategy.php' => 1, | |
| 'zero-header.jpg' => 1, | |
| '.scruitinzr.yml' => 1, | |
| 'nicescrollasset.php' => 1, | |
| 'nicescroll.php' => 1, | |
| 'jquerycustomcontentscrollerasset.php' => 1, | |
| 'jquerycustomcontentscroller.php' => 1, | |
| 'create_translations.sh' => 1, | |
| 'switch_project.php' => 1, | |
| 'fakepath.php' => 1, | |
| 'rcopy.php' => 1, | |
| 'icons.html' => 1, | |
| '503.html' => 1, | |
| 'grid.html' => 1, | |
| 'forms.html' => 1, | |
| 'forms-validation.html' => 1, | |
| 'fixed-topbar.html' => 1, | |
| 'file.html' => 1, | |
| 'faq.html' => 1, | |
| 'email.html' => 1, | |
| 'drag.html' => 1, | |
| 'data-table.html' => 1, | |
| 'charts.html' => 1, | |
| 'calendar.html' => 1, | |
| 'buttons.html' => 1, | |
| '405.html' => 1, | |
| 'jquery.easing.1.3.js' => 1, | |
| 'xparserexception.php' => 1, | |
| 'xnodelist.php' => 1, | |
| 'xnode.php' => 1, | |
| 'stricttrait.php' => 1, | |
| 'strict.php' => 1, | |
| 'multitonfactory.php' => 1, | |
| 'associativetrait.php' => 1, | |
| 'associativestrict.php' => 1, | |
| 'associative.php' => 1, | |
| 'minitestinterface.php' => 1, | |
| 'minitestabstract.php' => 1, | |
| 'jquery.easing.js' => 1, | |
| 'jquery.easing.compatibility.js' => 1, | |
| 'sqladmin.php' => 1, | |
| 'reseller.php' => 1, | |
| 'ups.rate.class.php' => 1, | |
| 'jquerynicescrollasset.php' => 1, | |
| 'oauth_testserver.php' => 1, | |
| 'oauthtests.xml' => 1, | |
| 'glavwebuserbundle.php' => 1, | |
| 'glavwebuploaderbundle.php' => 1, | |
| 'glavwebsubscriptionbundle.php' => 1, | |
| 'glavwebsimpletablebundle.php' => 1, | |
| 'glavwebrestbundle.php' => 1, | |
| 'glavwebcorebundle.php' => 1, | |
| 'glavwebcontentblockbundle.php' => 1, | |
| 'glavwebadminbundle.php' => 1, | |
| 'woklfsrbundle.php' => 1, | |
| 'keymasterjsasset.php' => 1, | |
| 'gaugejsasset.php' => 1, | |
| 'glitresquebundle.php' => 1, | |
| 'test-bootstrap.php' => 1, | |
| 'gl3nserializationgroupbundle.php' => 1, | |
| 'gl3nhttpquerystringfilterbundle.php' => 1, | |
| 'caster.php' => 1, | |
| 'license.javascriptpacker' => 1, | |
| 'gkocakayaparsesdkbundle.php' => 1, | |
| '.gitignore.json' => 1, | |
| 'generatedocs' => 1, | |
| 'bootstrap.core.php' => 1, | |
| 'autoload.core.php' => 1, | |
| 'make-million.php' => 1, | |
| 'mysqlconnector.php' => 1, | |
| 'test-client.php' => 1, | |
| 'gliverich' => 1, | |
| 'wabbr.php' => 1, | |
| 'license_symfony' => 1, | |
| 'svggraphcoords.php' => 1, | |
| 'flood.php' => 1, | |
| 'edgeevent.php' => 1, | |
| 'edge.php' => 1, | |
| 'jwtmiddleware.php' => 1, | |
| 'gnugatsearchenginebundle.php' => 1, | |
| 'gnugatredaktilobundle.php' => 1, | |
| 'gnugatquerybusbundle.php' => 1, | |
| 'gnugatpommfoundationbundle.php' => 1, | |
| 'gnugatmicroframeworkbundle.php' => 1, | |
| 'gnugatmarshallerbundle.php' => 1, | |
| 'license-gnkwldf' => 1, | |
| 'flycatcher_medoo.php' => 1, | |
| 'mistranscriptions' => 1, | |
| 'syncer.php' => 1, | |
| 'functions_post_oo.php' => 1, | |
| 'gmorelstateworkflowbundle.php' => 1, | |
| 'testhook.php' => 1, | |
| 'neptune' => 1, | |
| 'ztecsecurityactivedirectorybundle.php' => 1, | |
| 'phpmetrics.yml' => 1, | |
| 'kalendarasset.php' => 1, | |
| 'kalendar.php' => 1, | |
| 'php-iso7064.php' => 1, | |
| 'registry' => 1, | |
| 'php-iban.php' => 1, | |
| 'oophp-iban.php' => 1, | |
| 'zlider.php' => 1, | |
| 'cuztom.php' => 1, | |
| 'svggraphshape.php' => 1, | |
| 'slice.php' => 1, | |
| 'devtimerafflerbundle.php' => 1, | |
| 'devtimebackbonebundle.php' => 1, | |
| 'libphonenumber-for-php.spec' => 1, | |
| 'metadata-version' => 1, | |
| 'gbpersonaproviderbundle.php' => 1, | |
| 'giftcardspackagistbundle.php' => 1, | |
| 'rewriterbuilder.php' => 1, | |
| 'rewriter.php' => 1, | |
| 'matchstate.php' => 1, | |
| 'giftcardsmodrewritebundle.php' => 1, | |
| 'giftcardsfixedwidthbundle.php' => 1, | |
| 'giftcardsencryptionbundle.php' => 1, | |
| 'linetoreaderiterator.php' => 1, | |
| 'gikoimagebundle.php' => 1, | |
| 'linereader.php' => 1, | |
| 'lineinterface.php' => 1, | |
| 'inmemoryfile.php' => 1, | |
| 'filesystemline.php' => 1, | |
| 'filesystemfile.php' => 1, | |
| 'fileiterator.php' => 1, | |
| 'filefactory.php' => 1, | |
| 'filebuilder.php' => 1, | |
| 'fieldrequiredexception.php' => 1, | |
| 'fieldnotfoundexception.php' => 1, | |
| 'abstractline.php' => 1, | |
| 'abstractfile.php' => 1, | |
| 'encryptorbuilder.php' => 1, | |
| 'gikoaliyunossbundle.php' => 1, | |
| 'gikopinyinbundle.php' => 1, | |
| 'asq.php' => 1, | |
| 'deployii' => 1, | |
| 'pokus.php' => 1, | |
| 'test-git-versions.sh' => 1, | |
| 'gitonomygitbundle.php' => 1, | |
| 'reftest.php' => 1, | |
| 'readtest.php' => 1, | |
| 'cleartrustbundle.php' => 1, | |
| 'php-to-7-aid.phar' => 1, | |
| 'php-to-7-aid' => 1, | |
| 'updatelayerextent.php' => 1, | |
| 'syntaxhighlighterasset.php' => 1, | |
| 'yiiangularjshelper.php' => 1, | |
| 'deployii.bat' => 1, | |
| 'readme-pt' => 1, | |
| 'gikosinaweibobundle.php' => 1, | |
| 'giosh94mhzsimplepreauthenticatorbundle.php' => 1, | |
| 'phpunit-selenium-bootstrap.php' => 1, | |
| 'readthedocs.yml' => 1, | |
| 'readthedocs.requirements' => 1, | |
| 'photosort' => 1, | |
| 'services.json.dist' => 1, | |
| 'pazure.phar' => 1, | |
| 'pazure' => 1, | |
| 'mysqlnduhtool.phar' => 1, | |
| 'index.php.dist' => 1, | |
| 'sclr.php' => 1, | |
| 'gikocorpbundle.php' => 1, | |
| 'gikotaobaobundle.php' => 1, | |
| 'svggraphhistogram.php' => 1, | |
| 'svggraphstackedgroupedbar3dgraph.php' => 1, | |
| 'reports.php' => 1, | |
| 'cloudmonitoring.php' => 1, | |
| 'dataproc.php' => 1, | |
| 'customsearch.php' => 1, | |
| 'coordinate.php' => 1, | |
| 'consumersurveys.php' => 1, | |
| 'compute.php' => 1, | |
| 'cloudtrace.php' => 1, | |
| 'cloudresourcemanager.php' => 1, | |
| 'cloudlatencytest.php' => 1, | |
| 'clouderrorreporting.php' => 1, | |
| 'clouddebugger.php' => 1, | |
| 'cloudbilling.php' => 1, | |
| 'clouduseraccounts.php' => 1, | |
| 'cloudbuild.php' => 1, | |
| 'dfareporting.php' => 1, | |
| 'classroom.php' => 1, | |
| 'civicinfo.php' => 1, | |
| 'books.php' => 1, | |
| 'blogger.php' => 1, | |
| 'bigquery.php' => 1, | |
| 'autoscaler.php' => 1, | |
| 'appsactivity.php' => 1, | |
| 'appengine.php' => 1, | |
| 'appstate.php' => 1, | |
| 'androidpublisher.php' => 1, | |
| 'androidenterprise.php' => 1, | |
| 'analyticsreporting.php' => 1, | |
| 'adsensehost.php' => 1, | |
| 'deploymentmanager.php' => 1, | |
| 'doubleclickbidmanager.php' => 1, | |
| 'adexchangeseller.php' => 1, | |
| 'mirror.php' => 1, | |
| 'replicapoolupdater.php' => 1, | |
| 'replicapool.php' => 1, | |
| 'qpxexpress.php' => 1, | |
| 'pubsub.php' => 1, | |
| 'proximitybeacon.php' => 1, | |
| 'prediction.php' => 1, | |
| 'plusdomains.php' => 1, | |
| 'plus.php' => 1, | |
| 'playmoviespartner.php' => 1, | |
| 'people.php' => 1, | |
| 'partners.php' => 1, | |
| 'pagespeedonline.php' => 1, | |
| 'licensing.php' => 1, | |
| 'doubleclicksearch.php' => 1, | |
| 'kgsearch.php' => 1, | |
| 'identitytoolkit.php' => 1, | |
| 'iam.php' => 1, | |
| 'groupssettings.php' => 1, | |
| 'groupsmigration.php' => 1, | |
| 'gmail.php' => 1, | |
| 'genomics.php' => 1, | |
| 'gamesmanagement.php' => 1, | |
| 'gamesconfiguration.php' => 1, | |
| 'fusiontables.php' => 1, | |
| 'freebase.php' => 1, | |
| 'fitness.php' => 1, | |
| 'drive.php' => 1, | |
| 'adsense.php' => 1, | |
| 'adexchangebuyerii.php' => 1, | |
| 'svggraphstackedgroupedcylindergraph.php' => 1, | |
| 'rah_bitly_localhost.php' => 1, | |
| 'rah_repeat.php' => 1, | |
| 'rah_minify.php' => 1, | |
| 'rah_knots.php' => 1, | |
| 'rah_function.php' => 1, | |
| 'rah_external_output.php' => 1, | |
| 'rah_expanding.php' => 1, | |
| 'rah_dupliquer.php' => 1, | |
| 'rah_debug.php' => 1, | |
| 'rah_cache_minify.php' => 1, | |
| 'rah_cache.php' => 1, | |
| 'rah_blobin.php' => 1, | |
| 'rah_bitly_prevent.php' => 1, | |
| 'rah_bitly.php' => 1, | |
| 'rah_runtime.php' => 1, | |
| 'rah_backup_dropbox.php' => 1, | |
| 'rah_autoload.php' => 1, | |
| 'abc_theme.php' => 1, | |
| 'abc_plugin.php' => 1, | |
| 'wp-markdown.php' => 1, | |
| 'style.less' => 1, | |
| 'post-form.php' => 1, | |
| 'page-resetpass.php' => 1, | |
| 'page-register.php' => 1, | |
| 'page-lostpassword.php' => 1, | |
| 'page-login.php' => 1, | |
| 'gh-minify.php' => 1, | |
| 'gh-cache.php' => 1, | |
| 'rah_replace.php' => 1, | |
| 'rah_sitemap_links.php' => 1, | |
| 'adexchangebuyer.php' => 1, | |
| 'iframeautoheight.php' => 1, | |
| 'biicode.conf' => 1, | |
| 'apixmlresponseprovider.php' => 1, | |
| 'apitestcase.php' => 1, | |
| 'apiresponseprovider.php' => 1, | |
| 'apirelationprovider.php' => 1, | |
| 'apijsonresponseprovider.php' => 1, | |
| 'apibasecontroller.php' => 1, | |
| 'dbsync.php' => 1, | |
| 'tecsprocomunbundle.php' => 1, | |
| 'tecsproapipostbundle.php' => 1, | |
| 'parsetorg12.php' => 1, | |
| 'completed' => 1, | |
| 'response3fm.php' => 1, | |
| 'rah_swap.php' => 1, | |
| 'helper3fm.php' => 1, | |
| 'getargs2.php' => 1, | |
| 'file2' => 1, | |
| 'file1' => 1, | |
| 'github-btn.html' => 1, | |
| 'ggmtoolsbundle.php' => 1, | |
| 'gitpush.sh' => 1, | |
| 'zem_nth.php' => 1, | |
| 'rah_updater.php' => 1, | |
| 'rah_terminal_txpmarkup.php' => 1, | |
| 'rah_terminal_textile.php' => 1, | |
| 'rah_terminal_markdown.php' => 1, | |
| 'rah_terminal.php' => 1, | |
| 'license.modernizr-server' => 1, | |
| 'frnkcronexpressionparserbundle.php' => 1, | |
| 'redgemservicesiobundle.php' => 1, | |
| 'multilevelhorizontalmenu.php' => 1, | |
| 'live-reload-kid.js' => 1, | |
| 'readme.highcharts' => 1, | |
| 'houssradmangopaybundle.php' => 1, | |
| 'houndedfpdfbundle.php' => 1, | |
| 'gridlbundle.php' => 1, | |
| 'iugu.php' => 1, | |
| 'markdownassets.php' => 1, | |
| 'fakeloaderasset.php' => 1, | |
| 'artdialogasset.php' => 1, | |
| 'readme.auth' => 1, | |
| 'readme.advancedsecurity' => 1, | |
| 'multilevelverticalmenu.php' => 1, | |
| 'yboardsettingsasset.php' => 1, | |
| 'hpatoiobitlybundle.php' => 1, | |
| 'yboardasset.php' => 1, | |
| 'yboard.php' => 1, | |
| 'profilemodule.php' => 1, | |
| 'profileasset.php' => 1, | |
| 'audiojsasset.php' => 1, | |
| 'audiojs.php' => 1, | |
| 'horriblesolutionsflaggerizerbundle.php' => 1, | |
| 'jdf.php' => 1, | |
| '.environaut.cache' => 1, | |
| 'hospectphptojsbundle.php' => 1, | |
| 'art.png' => 1, | |
| 'hwbasicsbundle.php' => 1, | |
| 'hoyesimagemanagerbundle.php' => 1, | |
| 'hpatoiocommonbackendbundle.php' => 1, | |
| 'tigert.class.php' => 1, | |
| 'hslavichoneloginsamlbundle.php' => 1, | |
| 'arraycounter.php' => 1, | |
| 'config.sql' => 1, | |
| 'dbconfig.php' => 1, | |
| 'hashcache.php' => 1, | |
| 'instantiatetrait.php' => 1, | |
| 'buildkeytrait.php' => 1, | |
| 'applicationtrait.php' => 1, | |
| 'ampsubrequestextrabundle.php' => 1, | |
| 'bak.json' => 1, | |
| 'carbon-fields.php' => 1, | |
| 'carbon-fields-plugin.php' => 1, | |
| 'hslavichsimplesamlphpbundle.php' => 1, | |
| 'hshnclassmatcherbundle.php' => 1, | |
| '.rsync_exclude.txt.dist' => 1, | |
| 'classmatcherbuilder.php' => 1, | |
| 'classmatcher.php' => 1, | |
| 'screenshoot.png' => 1, | |
| 'opentbs.php' => 1, | |
| 'nada.php' => 1, | |
| 'ipbase.php' => 1, | |
| 'wp-helpers.php' => 1, | |
| 'wp-bridges.php' => 1, | |
| 'hproseworkermanservice.php' => 1, | |
| 'localemanager.php' => 1, | |
| 'i18nserviceprovider.php' => 1, | |
| 'hpdevjquerybundle.php' => 1, | |
| 'deploybundle.php' => 1, | |
| 'codeigniter-2.2.6' => 1, | |
| 'cleverreach-extension.php' => 1, | |
| 'rediscounter.php' => 1, | |
| 'boundfloat.php' => 1, | |
| 'realdom.php' => 1, | |
| 'odd.php' => 1, | |
| 'natural.php' => 1, | |
| 'integer.php' => 1, | |
| 'even.php' => 1, | |
| 'disjunction.php' => 1, | |
| 'conststring.php' => 1, | |
| 'constnull.php' => 1, | |
| 'constinteger.php' => 1, | |
| 'constfloat.php' => 1, | |
| 'constboolean.php' => 1, | |
| 'constarray.php' => 1, | |
| 'boolean.php' => 1, | |
| 'realdomclass.php' => 1, | |
| 'praspel.php' => 1, | |
| 'arithmetic.pp' => 1, | |
| 'seekable.php' => 1, | |
| 'repeater.php' => 1, | |
| 'regularexpression.php' => 1, | |
| 'outer.php' => 1, | |
| 'norewind.php' => 1, | |
| 'multiple.php' => 1, | |
| 'lookbehind.php' => 1, | |
| 'lookahead.php' => 1, | |
| 'iteratoriterator.php' => 1, | |
| 'infinite.php' => 1, | |
| 'demultiplexer.php' => 1, | |
| 'realdomarray.php' => 1, | |
| 'realdomempty.php' => 1, | |
| 'screenshot-frontend.jpg' => 1, | |
| 'csstoxpath.php' => 1, | |
| 'screenshot-backend.jpg' => 1, | |
| 'screenshot_subscribe-extended-fe.png' => 1, | |
| 'screenshot_subscribe-extended-be.png' => 1, | |
| 'hochstrasserwirecardbundle.php' => 1, | |
| 'sg_dev.php' => 1, | |
| 'sg.php' => 1, | |
| 'phpunit.phar.xml' => 1, | |
| 'autoloader-phar.php' => 1, | |
| 'hobnobamaziumbundle.php' => 1, | |
| 'zombie.php' => 1, | |
| 'parameterizable.php' => 1, | |
| 'xyl.php' => 1, | |
| 'visit.php' => 1, | |
| 'realdomfloat.php' => 1, | |
| 'viewable.php' => 1, | |
| 'ustring.php' => 1, | |
| '.autoload.atoum.php' => 1, | |
| 'stringbuffer.php' => 1, | |
| 'serializable.php' => 1, | |
| 'cryonicable.php' => 1, | |
| 'ruler.php' => 1, | |
| 'dynamiccallable.php' => 1, | |
| 'timestamp.php' => 1, | |
| 'smallinteger.php' => 1, | |
| 'smallfloat.php' => 1, | |
| 'realdomstring.php' => 1, | |
| 'realdomobject.php' => 1, | |
| 'dbcounter.php' => 1, | |
| 'chinesechar.php' => 1, | |
| 'callbackfilter.php' => 1, | |
| 'wanaworkjmspaypalrestbundle.php' => 1, | |
| 'icapwebsitebundle.php' => 1, | |
| 'icapsocialmediabundle.php' => 1, | |
| 'icaplyon1simpletagbundle.php' => 1, | |
| 'icapreferencebundle.php' => 1, | |
| 'icapportfoliobundle.php' => 1, | |
| 'icapoauthbundle.p |
View raw
(Sorry about that, but we can’t show files that are this big right now.)
Sign up for free
to join this conversation on GitHub.
Already have an account?
Sign in to comment