Skip to content

Instantly share code, notes, and snippets.

@patricksurry
Last active September 24, 2025 00:02
Show Gist options
  • Select an option

  • Save patricksurry/98faca3de0da1bc75d571a90f7ba3a34 to your computer and use it in GitHub Desktop.

Select an option

Save patricksurry/98faca3de0da1bc75d571a90f7ba3a34 to your computer and use it in GitHub Desktop.
Flowsnake visualization of structural protein sequence for covid19

Illustration of how to convert from traditional axial (or cubical) hex coordinates to and from two one-dimensional enumerations based on space-filling fractal curves. The spiral honeycomb mosaic enumeration recursively labels nested "super hexes" in base 7, starting from 0 at the origin. The flowsnake enumeration also call "Gosper7" here, recursively labels the same super hexes but in a continuous sequence with no jumps.
This uses a negative base 7 with an unbalanced signed representation using the digits = (-2), - (-1), 0, 1, 2, 3, and 4. These enumerations could be useful for compact visualization of one-dimensional sequence data as well indexing hexagonal data storage with good locality properties similar to the Hilbert curve.

This example shows a simple visualization of the structural protein sequence for covid-19, with individual amino acids mapped to a standard color palette.
The flowsnake embedding induces a characteristic boundary shape based on its length, with the snake's compact "folding" reminiscent of (but completely unrelated to) protein folding, which perhaps provides a useful visual fingerprint for the sequence.

const sqrt3 = Math.sqrt(3),
// seven axial direction vectors including the nil direction 0,0 which form a megahex of 7 hexes
unitDirs = [
{ q: 0, r: 0 },
{ q: 1, r: 0 }, { q: 0, r: 1 }, { q: -1, r: 1 },
{ q: -1, r: 0 }, { q: 0, r: -1 }, { q: 1, r: -1 },
], unitVertices = [
{ q: 1 / 3, r: 1 / 3 }, { q: -1 / 3, r: 2 / 3 }, { q: -2 / 3, r: 1 / 3 },
{ q: -1 / 3, r: -1 / 3 }, { q: 1 / 3, r: -2 / 3 }, { q: 2 / 3, r: -1 / 3 },
],
// ctrs = unitDirs.map(hextoxy),
// lookup table to recover direction index when projecting axial point (q, r) on (1, -2) mod 7
proj2dir = [0, 1, 5, 6, 3, 2, 4],
// the seven digits used to represent path offset within a 7hex unit, with '-' for -1, and '=' for -2 (double minus)
g7digits = '=-01234', g7vals = [-2, -1, 0, 1, 2, 3, 4],
// the repeating 7-hex path of Gospar curve visits dirs in this order in forward order
pos2dir = [2, 3, 0, 1, 6, 5, 4],
// the inverse mapping
dir2pos = [2, 3, 0, 1, 6, 5, 4],
// when we recurse, each unit of the Gospar curve gets rotated clockwise by rot steps
pos2rot = [0, 4, 0, 2, 0, 0, 2],
// we traverse some units in reverse order (-1)
pos2sgn = [-1, 1, 1, -1, -1, -1, 1];
/*
| 11 8 2 |
| 2 11 8 | / 3
| 8 2 11 |
*/
function twist({ q, r }) {
// rotates CCW by a little over 30deg and scales by sqrt(7)
const s = -(q + r);
return { q: (11 * q + 8 * r + 2 * s) / 3, r: (2 * q + 11 * r + 8 * s) / 3 };
}
/*
| 5 -4 2 |
| 2 5 -4 | / 21
| -4 2 5 |
*/
function untwist({ q, r }) {
// invert twist, ie. reverses rotatation and scale by 1/sqrt(y)
const s = -(q + r);
return { q: (5 * q - 4 * r + 2 * s) / 21, r: (2 * q + 5 * r - 4 * s) / 21 };
}
function hextoshm(p) {
// calculate a base-7 index for a hex using sprial honeycomb mosaic (shm) labeling
// see https://gamedev.stackexchange.com/questions/71785/converting-between-spiral-honeycomb-mosaic-and-axial-hex-coordinates
let n = 0;
while (p.q || p.r) {
// project onto (1,-2) to get the direction
const proj = (p.q - 2 * p.r) % 7, d = proj2dir[proj < 0 ? proj + 7 : proj];
n = n * 7 + d;
// remove any offset...
if (d) {
const dir = unitDirs[d];
p = { q: p.q - dir.q, r: p.r - dir.r };
}
// and scale down recursively
p = untwist(p);
}
return n;
}
function shmtohex(n) {
// return the hex corresponding to a shm-encoded integer
let p = { q: 0, r: 0 };
n.toString(7).split('').forEach(c => {
p = twist(p);
const { q, r } = unitDirs[+c];
p = { q: p.q + q, r: p.r + r };
});
return p;
}
function inttog7(v) {
// convert an integer to a base -7 string of g7 digits
let s = '';
v = -v;
while (v != 0) {
const tmp = v % 7, i = (tmp - g7vals[0] + 7) % 7;
s = g7digits[i] + s;
v = (v - g7vals[i]) / -7;
}
return s || '0';
}
function g7toint(s) {
// convert a g7-encoded integer represented as a string over the digits =-01234 back to an integer
let v = 0;
s.split('').forEach(c => {
const i = g7digits.indexOf(c);
if (i == null)
throw new Error(`Invalid character in g7 string ${s}`);
v = -7 * v + g7vals[i];
});
return -v;
}
function shmtog7(n) {
// given a SHM index, find the correspoding g7 index
const ds = n.toString(7).split('').map(c => +c);
let s = '', sgn = pos2sgn[dir2pos[0]], rot = (ds.length - 1) % 6;
ds.forEach(d => {
const pos = dir2pos[d ? ((d - 1 - rot + 6) % 6) + 1 : 0];
s += g7digits[sgn < 0 ? 6 - pos : pos];
rot = (rot - 1 + pos2rot[pos] + 6) % 6;
sgn *= pos2sgn[pos];
});
return s || '0';
}
function g7toshm(s) {
// given a g7 index, get the corresponding shm index
const ixs = s.split('').map(c => g7digits.indexOf(c));
let n = 0, sgn = pos2sgn[dir2pos[0]], // implicit 0 was prior digit so get sense of central unit
rot = (ixs.length - 1) % 6;
ixs.forEach(i => {
const pos = sgn < 0 ? 6 - i : i, d0 = pos2dir[pos], d = d0 ? ((d0 - 1 + rot) % 6 + 1) : 0;
n = n * 7 + d;
rot = (rot - 1 + pos2rot[pos] + 6) % 6;
sgn *= pos2sgn[pos];
});
return n;
}
function hexcenter({ q, r }, scale = 1) {
// convert axial hex coordinate to hex center
return {
x: scale * sqrt3 * (q + r / 2),
y: scale * 3 * r / 2,
};
}
function hexboundary({ q, r }, scale = 1) {
// return a CW boundary for given hex
return unitVertices.map(({ q: vq, r: vr }) => hexcenter({ q: q + vq, r: r + vr }, scale));
}
export { hextoshm, shmtohex, inttog7, g7toint, shmtog7, g7toshm, hexcenter, hexboundary, unitDirs, unitVertices, twist, untwist, sqrt3, };
interface HexPoint {
q: number;
r: number;
}
interface Point {
x: number,
y: number,
}
const sqrt3 = Math.sqrt(3),
// seven axial direction vectors including the nil direction 0,0 which form a megahex of 7 hexes
unitDirs: HexPoint[] = [
{q: 0, r: 0},
{q: 1, r: 0}, {q: 0, r: 1}, {q: -1, r: 1},
{q: -1, r: 0}, {q: 0, r: -1}, {q: 1, r: -1},
],
unitVertices: HexPoint[] = [
{q: 1/3, r: 1/3}, {q: -1/3, r: 2/3}, {q: -2/3, r: 1/3},
{q: -1/3, r: -1/3}, {q: 1/3, r: -2/3}, {q: 2/3, r: -1/3},
],
// ctrs = unitDirs.map(hextoxy),
// lookup table to recover direction index when projecting axial point (q, r) on (1, -2) mod 7
proj2dir = [0, 1, 5, 6, 3, 2, 4],
// the seven digits used to represent path offset within a 7hex unit, with '-' for -1, and '=' for -2 (double minus)
g7digits = '=-01234',
g7vals = [-2, -1, 0, 1, 2, 3, 4],
// the repeating 7-hex path of Gospar curve visits dirs in this order in forward order
pos2dir = [2, 3, 0, 1, 6, 5, 4],
// the inverse mapping
dir2pos = [2, 3, 0, 1, 6, 5, 4],
// when we recurse, each unit of the Gospar curve gets rotated clockwise by rot steps
pos2rot = [0, 4, 0, 2, 0, 0, 2],
// we traverse some units in reverse order (-1)
pos2sgn = [-1, 1, 1, -1, -1, -1, 1];
/*
| 11 8 2 |
| 2 11 8 | / 3
| 8 2 11 |
*/
function twist({q, r}: HexPoint): HexPoint {
// rotates CCW by a little over 30deg and scales by sqrt(7)
const s = -(q + r);
return {q: (11*q + 8*r + 2*s)/3, r: (2*q + 11*r + 8*s)/3}
}
/*
| 5 -4 2 |
| 2 5 -4 | / 21
| -4 2 5 |
*/
function untwist({q, r}: HexPoint): HexPoint {
// invert twist, ie. reverses rotatation and scale by 1/sqrt(y)
const s = -(q + r);
return {q: (5*q - 4*r + 2*s)/21, r: (2*q + 5*r - 4*s)/21}
}
function hextoshm(p: HexPoint): number {
// calculate a base-7 index for a hex using sprial honeycomb mosaic (shm) labeling
// see https://gamedev.stackexchange.com/questions/71785/converting-between-spiral-honeycomb-mosaic-and-axial-hex-coordinates
let n = 0;
while(p.q || p.r) {
// project onto (1,-2) to get the direction
const proj = (p.q - 2*p.r) % 7,
d = proj2dir[proj < 0 ? proj+7: proj];
n = n * 7 + d;
// remove any offset...
if (d) {
const dir = unitDirs[d];
p = {q: p.q - dir.q, r: p.r - dir.r}
}
// and scale down recursively
p = untwist(p);
}
return n;
}
function shmtohex(n: number): HexPoint {
// return the hex corresponding to a shm-encoded integer
let p = {q: 0, r: 0};
n.toString(7).split('').forEach(c => {
p = twist(p);
const {q, r} = unitDirs[+c];
p = {q: p.q + q, r: p.r + r};
})
return p;
}
function inttog7(v: number): string {
// convert an integer to a base -7 string of g7 digits
let s = '';
v = -v;
while (v != 0) {
const tmp = v % 7,
i = (tmp - g7vals[0] + 7)%7;
s = g7digits[i] + s;
v = (v - g7vals[i]) / -7;
}
return s || '0';
}
function g7toint(s: string) {
// convert a g7-encoded integer represented as a string over the digits =-01234 back to an integer
let v = 0;
s.split('').forEach(c => {
const i = g7digits.indexOf(c);
if (i == null) throw new Error(`Invalid character in g7 string ${s}`)
v = -7*v + g7vals[i];
})
return -v;
}
function shmtog7(n: number): string {
// given a SHM index, find the correspoding g7 index
const ds = n.toString(7).split('').map(c => +c);
let s = '',
sgn = pos2sgn[dir2pos[0]],
rot = (ds.length - 1) % 6;
ds.forEach(d => {
const pos = dir2pos[d ? ((d-1-rot+6) % 6) + 1: 0];
s += g7digits[sgn < 0 ? 6-pos : pos];
rot = (rot - 1 + pos2rot[pos] + 6) % 6;
sgn *= pos2sgn[pos];
})
return s || '0';
}
function g7toshm(s: string): number {
// given a g7 index, get the corresponding shm index
const ixs = s.split('').map(c => g7digits.indexOf(c));
let n = 0,
sgn = pos2sgn[dir2pos[0]], // implicit 0 was prior digit so get sense of central unit
rot = (ixs.length - 1) % 6;
ixs.forEach(i => {
const pos = sgn < 0 ? 6-i: i,
d0 = pos2dir[pos],
d = d0 ? ((d0-1+rot) % 6 + 1): 0;
n = n * 7 + d;
rot = (rot - 1 + pos2rot[pos] + 6) % 6;
sgn *= pos2sgn[pos];
})
return n;
}
function hexcenter({q, r}: HexPoint, scale=1): Point {
// convert axial hex coordinate to hex center
return {
x: scale * sqrt3 * (q + r/2),
y: scale * 3 * r/2,
}
}
function hexboundary({q, r}: HexPoint, scale=1): Point[] {
// return a CW boundary for given hex
return unitVertices.map(({q: vq, r: vr}) => hexcenter({q: q+vq, r: r+vr}, scale));
}
export type {Point, HexPoint};
export {
hextoshm, shmtohex, inttog7, g7toint, shmtog7, g7toshm,
hexcenter, hexboundary, unitDirs, unitVertices,
twist, untwist, sqrt3,
};
<html>
<style>
body {
background-color: black;
}
svg {
display: block;
margin: 0 auto;
}
circle {
stroke: none;
}
path {
vector-effect: non-scaling-stroke;
}
.seq {
stroke-width: 2px;
stroke: #999;
opacity: 75%;
}
</style>
<body>
<script src="https://d3js.org/d3.v7.min.js"></script>
<script type="module">
import {sqrt3, shmtohex, g7toshm, inttog7, hexcenter, hexboundary} from './flowsnake.js';
const
// Amino acid color scheme inspired by https://www.bioinformatics.nl/~berndb/aacolour.html
aminoColor = {
A: 'limegreen',
G: 'limegreen',
C: 'olive',
D: 'darkgreen',
E: 'darkgreen',
N: 'darkgreen',
Q: 'darkgreen',
I: 'royalblue',
L: 'royalblue',
M: 'royalblue',
V: 'royalblue',
F: 'mediumpurple',
W: 'mediumpurple',
Y: 'mediumpurple',
H: 'mediumblue',
K: 'orange',
R: 'orange',
P: 'hotpink',
S: 'red',
T: 'red',
B: 'grey',
Z: 'grey',
X: 'grey',
STOP: 'grey',
START: 'grey',
},
// Covid 19 structural protein sequence data from https://www.ncbi.nlm.nih.gov/nuccore/MN908947.3
covid19seq=`
MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFR
SSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIR
GWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVY
SSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQ
GFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFL
LKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITN
LCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCF
TNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYN
YLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPY
RVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFG
RDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAI
HADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPR
RARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTM
YICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFG
GFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFN
GLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQN
VLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGA
ISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMS
ECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAH
FPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELD
SFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELG
KYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSE
PVLKGVKLHYT`.trim().replace(/\s+/g, ''),
// show half the sequence on each side of the origin
start = -Math.floor(covid19seq.length/2),
vs = covid19seq.split(''),
ps = vs.map((_, i) => hexcenter(shmtohex(g7toshm(inttog7(start+i))))),
scale = 1.1*Math.max(...ps.map(p => Math.max(Math.abs(p.x), Math.abs(p.y)))),
svg = d3.select('body')
.append('svg')
.attr('width', 800)
.attr('height', 800)
.attr('viewBox', `-${scale} -${scale} ${2*scale} ${2*scale}`);
// display a line tracing the flowsnake enumeration of the amino acid sequence
svg.append('path')
.attr('class', 'seq')
.attr('d', d3.line(d => d.x, d => d.y)(ps));
// string circular beads along the flowsnake based on amino acid color
svg.append('g')
.selectAll('circle')
.data(ps)
.join('circle')
.attr('cx', d => d.x)
.attr('cy', d => d.y)
.attr('r', 1/sqrt3)
.style('fill', (_, i) => aminoColor[vs[i]]);
</script>
</body>
</html>
Sign up for free to join this conversation on GitHub. Already have an account? Sign in to comment