Created
November 2, 2018 15:37
-
-
Save sorsaffari/3857da2142cace3609eff2355edf0902 to your computer and use it in GitHub Desktop.
Protein Structure Prediction: Get all functions that relate directly or indirectly (via a similar sequence) to a particular sequence
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| match | |
| $target-sequence isa sequence "MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQIHFVLNTVSLMSVLIPKLPQLHGVRIFGINKY"; | |
| $direct-function isa function; | |
| (mapping-sequence: $target-sequence, mapped-function: $direct-function) isa sequence-function-mapping; | |
| $similar-sequence isa sequence; | |
| $alignment (target-sequence: $target-sequence, matched-sequence: $similar-sequence) isa sequence-sequence-alignment; | |
| $alignment has identicality > 0.8; | |
| $indirect-function isa function; | |
| (mapping-sequence: $similar-sequence, mapped-function: $indirect-function) isa sequence-function-mapping; | |
| get $direct-function, $indirect-function; |
Sign up for free
to join this conversation on GitHub.
Already have an account?
Sign in to comment