Soroush Saffari sorsaffari
sorsaffari
/ clouds.py
Last active
March 7, 2019 00:50
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| def win(clouds): | |
| print(clouds) | |
| now_on = -1 | |
| jumps = 0 | |
| if clouds[-1] == 1: | |
| print("invalid game! ends with a thunderhead.") | |
| return None | |
| while True: |
sorsaffari
/ example-working-with-tweets-pom.xml
Created
January 16, 2019 12:10
example-working-with-tweets/pom.xml
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| <?xml version="1.0" encoding="UTF-8"?> | |
| <project xmlns="http://maven.apache.org/POM/4.0.0" | |
| xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" | |
| xsi:schemaLocation="http://maven.apache.org/POM/4.0.0 http://maven.apache.org/xsd/maven-4.0.0.xsd"> | |
| <modelVersion>4.0.0</modelVersion> | |
| <groupId>ai.grakn</groupId> | |
| <artifactId>twitterexample</artifactId> | |
| <version>1.0-SNAPSHOT</version> |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| insert | |
| "production" sub entity | |
| is-abstract | |
| ## Filming details | |
| plays production-with-crew | |
| plays production-with-cast | |
| plays production-with-company | |
| plays production-with-location |
sorsaffari
/ protein_structure_prediction_rule.gql
Created
November 2, 2018 16:49
Protein Structure Prediction: Implied sequence-function-mapping rule
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| sequence-function-mapping sub relationship, | |
| relates mapping-sequence, | |
| relates mapped-function; | |
| implied-sequence-function-mapping sub rule, | |
| when { | |
| $seq isa sequence; | |
| $struct isa structure; | |
| $func isa function; | |
| (mapping-sequence: $seq, mapped-structure: $struct) isa sequence-structure-mapping; |
sorsaffari
/ protein_structure_prediction_query_5.gql
Created
November 2, 2018 15:37
Protein Structure Prediction: Get all functions that relate directly or indirectly (via a similar sequence) to a particular sequence
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| match | |
| $target-sequence isa sequence "MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQIHFVLNTVSLMSVLIPKLPQLHGVRIFGINKY"; | |
| $direct-function isa function; | |
| (mapping-sequence: $target-sequence, mapped-function: $direct-function) isa sequence-function-mapping; | |
| $similar-sequence isa sequence; | |
| $alignment (target-sequence: $target-sequence, matched-sequence: $similar-sequence) isa sequence-sequence-alignment; | |
| $alignment has identicality > 0.8; | |
| $indirect-function isa function; | |
| (mapping-sequence: $similar-sequence, mapped-function: $indirect-function) isa sequence-function-mapping; | |
| get $direct-function, $indirect-function; |
sorsaffari
/ protein_structure_prediction_query_4.gql
Created
November 2, 2018 15:34
Protein Structure Prediction: Get all sequences that have a particular function
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| match | |
| $target-function isa function "enzyme"; | |
| $sequence isa sequence; | |
| (mapping-sequence: $sequence, mapped-function: $target-function) isa sequence-function-mapping; | |
| get $sequence; |
sorsaffari
/ protein_structure_prediction_query_3.gql
Last active
November 2, 2018 15:29
Protein Structure Prediction: Get all structures of the sequences that have an alignment with a particular sequence (with unknown structure), given that the alignment has an identicality above 80%
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| match | |
| $target-sequence isa sequence "MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQIHFVLNTVSLMSVLIPKLPQLHGVRIFGINKY"; | |
| $similar-sequence isa sequence; | |
| $alignment (target-sequence: $target-sequence, matched-sequence: $similar-sequence) isa sequence-sequence-alignment; | |
| $alignment has identicality > 0.8; | |
| $structure isa structure; | |
| (mapping-sequence: $similar-sequence, mapped-structure: $structure) isa sequence-structure-mapping; | |
| get $structure; |
sorsaffari
/ protein_structure_prediction_query_2.gql
Created
November 2, 2018 15:25
Protein Structure Prediction: Get all sequences that have a particular structure
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| match | |
| $target-structure isa strucuture has pdb-id "2RHC"; | |
| $sequence isa sequence; | |
| (mapping-sequence: $sequence, mapped-structure: $target-structure) isa sequence-structure-mapping; | |
| get $sequence; |
sorsaffari
/ protein_structure_prediction_query_1.gql
Created
November 2, 2018 15:19
Protein Structure Prediction: Get all structures of a particular sequence
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| match | |
| $target-sequence isa sequence "MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQIHFVLNTVSLMSVLIPKLPQLHGVRIFGINKY"; | |
| $structure isa structure; | |
| (mapping-sequence: $target-sequence, mapped-structure: $structure) isa sequence-structure-mapping; | |
| get $structure; |
sorsaffari
/ XmlMigration.java
Created
October 23, 2018 16:39
Migrating XML data into Grakn using the Java client
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| package ai.grakn.examples; | |
| import ai.grakn.GraknTxType; | |
| import ai.grakn.Keyspace; | |
| import ai.grakn.client.Grakn; | |
| import ai.grakn.util.SimpleURI; | |
| /** | |
| * a lean JSON Library for Java, | |
| * @see <a href="https://bolerio.github.io/mjson/">mjson</a> |
NewerOlder