Last active
November 2, 2018 15:29
-
-
Save sorsaffari/f0a63f5c1fd9495ee08c4433b9bf65da to your computer and use it in GitHub Desktop.
Protein Structure Prediction: Get all structures of the sequences that have an alignment with a particular sequence (with unknown structure), given that the alignment has an identicality above 80%
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| match | |
| $target-sequence isa sequence "MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQIHFVLNTVSLMSVLIPKLPQLHGVRIFGINKY"; | |
| $similar-sequence isa sequence; | |
| $alignment (target-sequence: $target-sequence, matched-sequence: $similar-sequence) isa sequence-sequence-alignment; | |
| $alignment has identicality > 0.8; | |
| $structure isa structure; | |
| (mapping-sequence: $similar-sequence, mapped-structure: $structure) isa sequence-structure-mapping; | |
| get $structure; |
Sign up for free
to join this conversation on GitHub.
Already have an account?
Sign in to comment